F438966

General Info

Members Datasets Scaffolds Average Seq Length
417 201 418 87

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10041023|Ga0070658_100410235
Length 90
Sequence METTELKEKLKKQIIQFLNLTDLTPEDIKDDEPLFGDGLGLDSIDSLELIVLLKKEYGITIKDPREGRKVLVDVNSMAAYIEEHGGNTTS

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
83 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
85 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
87 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
88 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
89 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
90 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
130 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
131 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
132 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
133 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
136 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
137 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
138 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
144 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
145 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
146 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
147 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
152 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
153 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
154 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
155 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
156 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
157 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
158 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
159 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
160 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
161 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
162 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
163 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
164 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
165 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
166 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
167 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
168 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
169 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
170 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
171 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
172 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
173 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
174 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
175 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
176 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
177 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
178 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
179 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
180 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
181 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
182 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
183 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
184 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
185 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
186 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
187 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
188 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
189 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
190 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
191 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
192 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
193 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
194 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
195 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
196 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
197 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
198 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
199 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
200 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
201 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.04
Metatranscriptomes 0.96
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.47
Nodule 0
Rhizoplane 0.48
Rhizosphere 88.01
Stem 0
Stem Tuber 0
Unclassified 5.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10108277 3300001979 Bacteria 702
2 JGI24737J22298_10004123 3300001990 Bacteria 5078
3 JGI24737J22298_10070628 3300001990 Unclassified 1043
4 JGI24735J21928_10003843 3300002067 Bacteria 5085
5 JGI24744J21845_10000567 3300002077 Bacteria 6672
6 JGI25162J39368_1001018 3300002737 Bacteria 17457
7 JGI25157J39369_1003302 3300002741 Bacteria 3362
8 JGI25157J39369_1010665 3300002741 Unclassified 1204
9 JGI25165J46597_1002560 3300003214 Bacteria 5613
10 rootH1_10088202 3300003316 Bacteria 2219
11 rootH2_10005827 3300003320 Bacteria 117906
12 rootH2_10114409 3300003320 Bacteria 2589
13 rootH2_10163918 3300003320 Bacteria 1990
14 rootL2_10035132 3300003322 Bacteria 5779
15 rootL2_10269531 3300003322 Bacteria 2158
16 rootH1_10000566 3300003316 Bacteria 33162
17 rootH1_10000566 3300003323 Bacteria 205679
18 rootH1_10090310 3300003323 Bacteria 7096
19 rootH1_10122080 3300003323 Bacteria 7673
20 rootH1_10328624 3300003323 Bacteria 3567
21 Ga0058863_10343366 3300004799 Bacteria 751
22 Ga0065714_10067513 3300005288 Bacteria 5422
23 Ga0065715_10127873 3300005293 Bacteria 2069
24 Ga0070658_10000075 3300005327 Bacteria 95412
25 Ga0070658_10041023 3300005327 Bacteria 3734
26 Ga0070658_10549692 3300005327 Unclassified 999
27 Ga0070658_11473288 3300005327 Bacteria 590
28 Ga0070658_11740647 3300005327 Bacteria 539
29 Ga0070676_10001405 3300005328 Bacteria 12139
30 Ga0070670_100067336 3300005331 Unclassified 3072
31 Ga0070670_100482889 3300005331 Bacteria 1100
32 Ga0070677_10216113 3300005333 Bacteria 933
33 Ga0070677_10940138 3300005333 Bacteria 502
34 Ga0068869_100688613 3300005334 Bacteria 871
35 Ga0068869_101086863 3300005334 Bacteria 699
36 Ga0070666_11015736 3300005335 Bacteria 615
37 Ga0070680_100011377 3300005336 Bacteria 6882
38 Ga0070682_100506309 3300005337 Bacteria 937
39 Ga0068868_100001486 3300005338 Bacteria 16186
40 Ga0068868_100869404 3300005338 Unclassified 817
41 Ga0068868_101004877 3300005338 Bacteria 763
42 Ga0070660_100008755 3300005339 Bacteria 7088
43 Ga0070660_100032947 3300005339 Bacteria 3903
44 Ga0070660_100427977 3300005339 Unclassified 1096
45 Ga0070668_100577272 3300005347 Bacteria 981
46 Ga0070669_101520195 3300005353 Bacteria 582
47 Ga0070675_101453927 3300005354 Bacteria 632
48 Ga0070671_100056189 3300005355 Bacteria 3275
49 Ga0070671_100074394 3300005355 Unclassified 2838
50 Ga0070674_101360088 3300005356 Bacteria 635
51 Ga0070673_100028678 3300005364 Bacteria 4142
52 Ga0070673_100055683 3300005364 Unclassified 3117
53 Ga0070688_100087447 3300005365 Unclassified 2030
54 Ga0070659_100001045 3300005366 Bacteria 20218
55 Ga0070659_100016831 3300005366 Bacteria 5493
56 Ga0070659_100092117 3300005366 Unclassified 2430
57 Ga0070667_100008389 3300005367 Bacteria 8567
58 Ga0070667_100239036 3300005367 Bacteria 1621
59 Ga0070713_100925026 3300005436 Unclassified 839
60 Ga0070663_100051490 3300005455 Bacteria 2934
61 Ga0070663_101072123 3300005455 Unclassified 703
62 Ga0070663_101539223 3300005455 Unclassified 592
63 Ga0070663_101902402 3300005455 Bacteria 534
64 Ga0070678_100000635 3300005456 Bacteria 17178
65 Ga0070678_100034281 3300005456 Bacteria 3533
66 Ga0070678_101624364 3300005456 Bacteria 607
67 Ga0070662_100000167 3300005457 Bacteria 38204
68 Ga0070662_100168545 3300005457 Bacteria 1718
69 Ga0070681_10035380 3300005458 Bacteria 5017
70 Ga0070681_11308116 3300005458 Bacteria 648
71 Ga0068867_101133291 3300005459 Unclassified 715
72 Ga0068867_101428038 3300005459 Bacteria 642
73 Ga0070685_10066034 3300005466 Unclassified 2131
74 Ga0068853_100047838 3300005539 Unclassified 3671
75 Ga0068853_100051125 3300005539 Bacteria 3557
76 Ga0068853_100160720 3300005539 Bacteria 2027
77 Ga0068853_100398654 3300005539 Bacteria 1287
78 Ga0068853_100489721 3300005539 Bacteria 1160
79 Ga0068853_101191983 3300005539 Bacteria 735
80 Ga0070672_100210745 3300005543 Bacteria 1627
81 Ga0070672_100448933 3300005543 Bacteria 1110
82 Ga0070672_101917520 3300005543 Bacteria 533
83 Ga0070665_100000284 3300005548 Bacteria 82062
84 Ga0068855_100009981 3300005563 Bacteria 11442
85 Ga0068855_100044817 3300005563 Bacteria 5233
86 Ga0068855_100196861 3300005563 Bacteria 2270
87 Ga0068855_100431075 3300005563 Bacteria 1441
88 Ga0068855_100919326 3300005563 Bacteria 923
89 Ga0068855_101391786 3300005563 Bacteria 723
90 Ga0068855_101575384 3300005563 Unclassified 673
91 Ga0068857_100013369 3300005577 Bacteria 7149
92 Ga0068857_101673324 3300005577 Unclassified 622
93 Ga0068854_100311949 3300005578 Bacteria 1276
94 Ga0068854_100747032 3300005578 Unclassified 848
95 Ga0068856_100000044 3300005614 Bacteria 111437
96 Ga0068856_100003367 3300005614 Bacteria 16201
97 Ga0068856_100020596 3300005614 Bacteria 6408
98 Ga0068856_101217734 3300005614 Unclassified 769
99 Ga0068856_101895383 3300005614 Bacteria 607
100 Ga0068852_100000386 3300005616 Bacteria 29492
101 Ga0068852_100096042 3300005616 Bacteria 2663
102 Ga0068852_100992288 3300005616 Unclassified 858
103 Ga0068852_101483428 3300005616 Bacteria 700
104 Ga0068864_100099617 3300005618 Bacteria 2575
105 Ga0068866_10140297 3300005718 Unclassified 1386
106 Ga0068851_10049235 3300005834 Unclassified 2137
107 Ga0068851_10422645 3300005834 Bacteria 787
108 Ga0068863_100009631 3300005841 Bacteria 9424
109 Ga0068858_100116835 3300005842 Unclassified 2493
110 Ga0068860_100008374 3300005843 Bacteria 10298
111 Ga0068860_100783916 3300005843 Bacteria 966
112 Ga0075366_10000091 3300006195 Bacteria 36066
113 Ga0075366_10001842 3300006195 Bacteria 10695
114 Ga0075366_10129775 3300006195 Bacteria 1521
115 Ga0097621_100003703 3300006237 Bacteria 10578
116 Ga0097621_101218529 3300006237 Unclassified 709
117 Ga0097621_101800621 3300006237 Bacteria 584
118 Ga0097621_102436538 3300006237 Bacteria 501
119 Ga0068871_100000070 3300006358 Bacteria 57286
120 Ga0068871_100256784 3300006358 Unclassified 1523
121 Ga0068871_100375945 3300006358 Unclassified 1261
122 Ga0068865_100000448 3300006881 Bacteria 22921
123 Ga0105240_10004296 3300009093 Bacteria 21764
124 Ga0105240_10009293 3300009093 Bacteria 13938
125 Ga0105240_10012464 3300009093 Bacteria 11730
126 Ga0105240_10143718 3300009093 Bacteria 2849
127 Ga0105240_10202158 3300009093 Bacteria 2327
128 Ga0105240_10213761 3300009093 Bacteria 2251
129 Ga0105240_10253072 3300009093 Bacteria 2036
130 Ga0105240_10926707 3300009093 Unclassified 936
131 Ga0105240_11146218 3300009093 Bacteria 825
132 Ga0105245_10858898 3300009098 Unclassified 948
133 Ga0105243_10252100 3300009148 Bacteria 1576
134 Ga0105241_10001799 3300009174 Bacteria 16279
135 Ga0105241_10003945 3300009174 Bacteria 10980
136 Ga0105241_10021169 3300009174 Bacteria 4807
137 Ga0105241_10048026 3300009174 Bacteria 3247
138 Ga0105241_11392041 3300009174 Bacteria 671
139 Ga0105241_12245632 3300009174 Bacteria 542
140 Ga0105242_10094410 3300009176 Bacteria 2523
141 Ga0105242_10231240 3300009176 Bacteria 1657
142 Ga0105242_11222898 3300009176 Bacteria 771
143 Ga0105242_11555818 3300009176 Bacteria 694
144 Ga0105242_11567561 3300009176 Bacteria 691
145 Ga0105237_10001162 3300009545 Bacteria 35201
146 Ga0105237_10002306 3300009545 Bacteria 23725
147 Ga0105237_10016270 3300009545 Bacteria 7731
148 Ga0105237_10070166 3300009545 Unclassified 3499
149 Ga0105237_10213037 3300009545 Bacteria 1931
150 Ga0105237_10227752 3300009545 Bacteria 1865
151 Ga0105237_10659599 3300009545 Unclassified 1053
152 Ga0105238_10000693 3300009551 Bacteria 35265
153 Ga0105238_10949090 3300009551 Unclassified 880
154 Ga0105238_12327434 3300009551 Bacteria 571
155 Ga0105249_11898803 3300009553 Bacteria 668
156 Ga0105239_10000002 3300010375 Bacteria 610298
157 Ga0105239_10000006 3300010375 Bacteria 442319
158 Ga0105239_10005880 3300010375 Bacteria 14296
159 Ga0105239_10114113 3300010375 Unclassified 2997
160 Ga0105239_10195521 3300010375 Bacteria 2265
161 Ga0105239_10227281 3300010375 Unclassified 2093
162 Ga0105239_10899427 3300010375 Unclassified 1016
163 Ga0105246_10009185 3300011119 Bacteria 6088
164 Ga0105246_10994414 3300011119 Bacteria 759
165 Ga0157373_10125268 3300013100 Unclassified 1807
166 Ga0157373_10312718 3300013100 Unclassified 1116
167 Ga0157371_10000269 3300013102 Bacteria 70787
168 Ga0157371_10001621 3300013102 Bacteria 23010
169 Ga0157371_10891164 3300013102 Bacteria 674
170 Ga0157370_10047247 3300013104 Bacteria 4127
171 Ga0157370_10126075 3300013104 Bacteria 2389
172 Ga0157370_10437768 3300013104 Bacteria 1202
173 Ga0157370_10549168 3300013104 Bacteria 1059
174 Ga0157369_10012411 3300013105 Bacteria 9671
175 Ga0157369_10077184 3300013105 Unclassified 3570
176 Ga0157369_10094674 3300013105 Bacteria 3188
177 Ga0157369_10133824 3300013105 Bacteria 2626
178 Ga0157374_10004549 3300013296 Bacteria 11638
179 Ga0157374_10038219 3300013296 Bacteria 4411
180 Ga0157374_10142659 3300013296 Bacteria 2325
181 Ga0157374_10289133 3300013296 Unclassified 1619
182 Ga0157374_10302616 3300013296 Bacteria 1582
183 Ga0157378_10012296 3300013297 Bacteria 7494
184 Ga0157378_10029320 3300013297 Bacteria 4858
185 Ga0157378_10036855 3300013297 Bacteria 4329
186 Ga0157378_10059958 3300013297 Unclassified 3396
187 Ga0157378_10449575 3300013297 Bacteria 1278
188 Ga0157378_11353694 3300013297 Unclassified 754
189 Ga0157378_11937660 3300013297 Unclassified 639
190 Ga0163162_10000044 3300013306 Bacteria 128200
191 Ga0163162_10018680 3300013306 Bacteria 6792
192 Ga0163162_10103522 3300013306 Bacteria 2941
193 Ga0163162_10142644 3300013306 Bacteria 2509
194 Ga0163162_10304349 3300013306 Bacteria 1726
195 Ga0163162_11187504 3300013306 Bacteria 866
196 Ga0163162_12328268 3300013306 Bacteria 615
197 Ga0157372_10000009 3300013307 Bacteria 302051
198 Ga0157372_10001087 3300013307 Bacteria 29605
199 Ga0157372_10010312 3300013307 Bacteria 9928
200 Ga0157372_10121427 3300013307 Bacteria 3001
201 Ga0157372_10462750 3300013307 Bacteria 1478
202 Ga0157375_10030759 3300013308 Bacteria 5067
203 Ga0157375_10121218 3300013308 Unclassified 2724
204 Ga0163163_11508492 3300014325 Bacteria 733
205 Ga0157380_10341752 3300014326 Bacteria 1396
206 Ga0157377_10442755 3300014745 Unclassified 895
207 Ga0157376_10304635 3300014969 Bacteria 1509
208 Ga0182007_10266481 3300015262 Unclassified 619
209 Ga0154015_1569203 3300020610 Unclassified 1172
210 Ga0213872_10013116 3300021361 Bacteria 3885
211 Ga0224712_10575145 3300022467 Unclassified 549
212 Ga0207427_100093 3300025231 Bacteria 125910
213 Ga0207427_117579 3300025231 Bacteria 661
214 Ga0209437_100008 3300025233 Bacteria 921142
215 Ga0209026_1000930 3300025250 Bacteria 14845
216 Ga0209026_1002432 3300025250 Bacteria 7004
217 Ga0209233_1000024 3300025261 Bacteria 695418
218 Ga0209233_1001096 3300025261 Bacteria 11120
219 Ga0209233_1011068 3300025261 Bacteria 2672
220 Ga0209455_1001317 3300025272 Bacteria 11494
221 Ga0207656_10544556 3300025321 Bacteria 591
222 Ga0207642_10756141 3300025899 Bacteria 616
223 Ga0207647_10000209 3300025904 Bacteria 47604
224 Ga0207647_10000463 3300025904 Bacteria 32923
225 Ga0207647_10499459 3300025904 Unclassified 678
226 Ga0207645_10001060 3300025907 Bacteria 22749
227 Ga0207645_10078690 3300025907 Bacteria 2113
228 Ga0207645_11046739 3300025907 Unclassified 552
229 Ga0207705_10000102 3300025909 Bacteria 98105
230 Ga0207705_10460125 3300025909 Unclassified 987
231 Ga0207705_10574561 3300025909 Bacteria 876
232 Ga0207654_10035950 3300025911 Unclassified 2764
233 Ga0207654_10081034 3300025911 Unclassified 1953
234 Ga0207707_10007990 3300025912 Bacteria 9188
235 Ga0207707_11534680 3300025912 Bacteria 527
236 Ga0207695_10006768 3300025913 Bacteria 14780
237 Ga0207695_10008363 3300025913 Bacteria 12962
238 Ga0207695_10069540 3300025913 Unclassified 3602
239 Ga0207695_10179488 3300025913 Bacteria 2038
240 Ga0207695_10337668 3300025913 Bacteria 1395
241 Ga0207695_10367219 3300025913 Bacteria 1325
242 Ga0207695_10414580 3300025913 Unclassified 1231
243 Ga0207695_10557522 3300025913 Bacteria 1027
244 Ga0207695_10894646 3300025913 Unclassified 767
245 Ga0207695_10896512 3300025913 Bacteria 766
246 Ga0207671_10000901 3300025914 Bacteria 37526
247 Ga0207671_10002483 3300025914 Bacteria 19710
248 Ga0207671_10063154 3300025914 Bacteria 2751
249 Ga0207671_10072003 3300025914 Unclassified 2579
250 Ga0207671_10348529 3300025914 Unclassified 1174
251 Ga0207671_10428753 3300025914 Unclassified 1052
252 Ga0207660_10053988 3300025917 Bacteria 2866
253 Ga0207657_10036426 3300025919 Bacteria 4403
254 Ga0207657_10036557 3300025919 Bacteria 4394
255 Ga0207657_10281593 3300025919 Unclassified 1320
256 Ga0207652_10415191 3300025921 Bacteria 1214
257 Ga0207652_10432196 3300025921 Bacteria 1187
258 Ga0207694_10033717 3300025924 Unclassified 3922
259 Ga0207650_10417885 3300025925 Unclassified 1112
260 Ga0207659_11354503 3300025926 Bacteria 610
261 Ga0207644_10044686 3300025931 Bacteria 3148
262 Ga0207644_10045374 3300025931 Unclassified 3127
263 Ga0207690_10000770 3300025932 Bacteria 20723
264 Ga0207690_10003147 3300025932 Bacteria 9907
265 Ga0207706_10000257 3300025933 Bacteria 57965
266 Ga0207706_10380410 3300025933 Bacteria 1225
267 Ga0207686_10173752 3300025934 Bacteria 1522
268 Ga0207669_10047903 3300025937 Bacteria 2535
269 Ga0207704_10000016 3300025938 Bacteria 158362
270 Ga0207691_10443916 3300025940 Bacteria 1104
271 Ga0207691_11612650 3300025940 Bacteria 527
272 Ga0207667_10006040 3300025949 Bacteria 14732
273 Ga0207667_10053592 3300025949 Bacteria 4244
274 Ga0207667_10248746 3300025949 Bacteria 1819
275 Ga0207667_10482990 3300025949 Bacteria 1258
276 Ga0207667_10988084 3300025949 Bacteria 829
277 Ga0207667_11258888 3300025949 Unclassified 717
278 Ga0207651_10113012 3300025960 Unclassified 2042
279 Ga0207651_10255338 3300025960 Unclassified 1436
280 Ga0207651_10545333 3300025960 Bacteria 1008
281 Ga0207640_10403411 3300025981 Bacteria 1114
282 Ga0207640_10699798 3300025981 Bacteria 869
283 Ga0207658_10984146 3300025986 Bacteria 769
284 Ga0207677_10014835 3300026023 Bacteria 4563
285 Ga0207677_10166370 3300026023 Unclassified 1719
286 Ga0207703_11736229 3300026035 Unclassified 600
287 Ga0207639_10009526 3300026041 Bacteria 6706
288 Ga0207639_10033306 3300026041 Bacteria 3800
289 Ga0207639_10109573 3300026041 Bacteria 2247
290 Ga0207639_10575068 3300026041 Unclassified 1037
291 Ga0207639_10795406 3300026041 Bacteria 881
292 Ga0207639_11175080 3300026041 Bacteria 720
293 Ga0207678_10216829 3300026067 Bacteria 1638
294 Ga0207678_10908691 3300026067 Unclassified 778
295 Ga0207678_11769587 3300026067 Bacteria 541
296 Ga0207702_10000140 3300026078 Bacteria 87544
297 Ga0207702_10021409 3300026078 Bacteria 5353
298 Ga0207702_10845459 3300026078 Unclassified 906
299 Ga0207702_11567496 3300026078 Bacteria 652
300 Ga0207648_10321516 3300026089 Bacteria 1390
301 Ga0207648_11071449 3300026089 Bacteria 756
302 Ga0207648_11139826 3300026089 Unclassified 732
303 Ga0207676_11590806 3300026095 Bacteria 651
304 Ga0207674_10073673 3300026116 Bacteria 3427
305 Ga0207674_11134047 3300026116 Unclassified 751
306 Ga0207683_10003553 3300026121 Bacteria 13596
307 Ga0207683_10052708 3300026121 Bacteria 3565
308 Ga0207698_10310285 3300026142 Bacteria 1473
309 Ga0207698_12018370 3300026142 Unclassified 591
310 Ga0268266_10000291 3300028379 Bacteria 82093
311 Ga0268264_10067420 3300028381 Unclassified 3021
312 Ga0307517_10003309 3300028786 Bacteria 25165
313 Ga0307515_10000790 3300028794 Bacteria 72891
314 Ga0307515_10001523 3300028794 Bacteria 51822
315 Ga0265327_10000410 3300031251 Bacteria 78900
316 Ga0265327_10014734 3300031251 Bacteria 5094
317 Ga0265327_10086247 3300031251 Bacteria 1540
318 Ga0265327_10351411 3300031251 Unclassified 644
319 Ga0265313_10306191 3300031595 Unclassified 637
320 Ga0307516_10003007 3300031730 Bacteria 22014
321 Ga0307412_10249544 3300031911 Unclassified 1377
322 Ga0307507_10000078 3300033179 Bacteria 151026
323 Ga0307510_10003634 3300033180 Bacteria 18006
324 Ga0373939_0436343 3300035114 Bacteria 549
325 Ga0395899_0000001 3300037312 Bacteria 1750322
326 Ga0395899_0002782 3300037312 Bacteria 14097
327 Ga0395899_0002957 3300037312 Bacteria 13598
328 Ga0395900_0000327 3300037418 Bacteria 70365
329 Ga0395900_0005440 3300037418 Bacteria 13342
330 Ga0395900_0024302 3300037418 Bacteria 6205
331 Ga0395900_0060434 3300037418 Bacteria 3900
332 Ga0395900_0269019 3300037418 Bacteria 1700
333 Ga0395898_0030098 3300037466 Bacteria 5435
334 Ga0395898_0196689 3300037466 Bacteria 1925
335 Ga0395898_1826853 3300037466 Bacteria 529
336 Ga0395905_0000461 3300037471 Bacteria 56680
337 Ga0395905_0001887 3300037471 Bacteria 24161
338 Ga0395901_0000464 3300038443 Bacteria 47061
339 Ga0395901_0019758 3300038443 Bacteria 6889
340 Ga0395901_0249847 3300038443 Unclassified 1848
341 Ga0436361_0773655 3300039447 Bacteria 3958
342 Ga0451791_1158038 3300041451 Unclassified 614
343 Ga0451802_1609586 3300041460 Unclassified 712
344 Ga0451853_0690033 3300041512 Bacteria 745
345 Ga0466966_0014474 3300044684 Bacteria 5221
346 Ga0453684_2291453 3300044712 Bacteria 537
347 Ga0466968_0211232 3300044735 Bacteria 912
348 Ga0466959_0318514 3300045049 Unclassified 1063
349 Ga0466959_0468449 3300045049 Bacteria 853
350 Ga0466958_0022787 3300045836 Bacteria 3671
351 Ga0495629_0035858 3300046459 Bacteria 3504
352 Ga0495638_0121403 3300046460 Bacteria 1544
353 Ga0495651_0275478 3300046462 Unclassified 1139
354 Ga0495650_0065277 3300046471 Bacteria 1445
355 Ga0495605_0101503 3300046474 Unclassified 1322
356 Ga0495639_0525027 3300046475 Bacteria 605
357 Ga0495585_0001288 3300046492 Bacteria 19979
358 Ga0495596_0127069 3300046500 Bacteria 990
359 Ga0495607_0549863 3300046501 Bacteria 507
360 Ga0495583_0070154 3300046506 Bacteria 1542
361 Ga0495583_0099576 3300046506 Bacteria 1242
362 Ga0495583_0425124 3300046506 Unclassified 521
363 Ga0495606_0011271 3300046507 Bacteria 7313
364 Ga0495606_0398752 3300046507 Unclassified 717
365 Ga0495616_0043690 3300046513 Bacteria 2276
366 Ga0495618_0904065 3300046514 Bacteria 509
367 Ga0495631_0007451 3300046518 Bacteria 5561
368 Ga0495644_0001493 3300046523 Bacteria 9535
369 Ga0495648_0005741 3300046524 Bacteria 10240
370 Ga0495654_0034404 3300046530 Bacteria 2556
371 Ga0495609_0044220 3300046538 Bacteria 1998
372 Ga0495597_0323574 3300046542 Bacteria 595
373 Ga0495622_0052178 3300046557 Bacteria 1897
374 Ga0495633_0000074 3300046558 Bacteria 130197
375 Ga0495668_0000017 3300046616 Bacteria 434025
376 Ga0495668_0162376 3300046616 Unclassified 1224
377 Ga0495668_0221404 3300046616 Bacteria 1036
378 Ga0495634_0276508 3300046642 Bacteria 1021
379 Ga0495625_0000435 3300046660 Bacteria 62758
380 Ga0495625_0001213 3300046660 Bacteria 32692
381 Ga0495625_0034761 3300046660 Bacteria 3718
382 Ga0495625_0064937 3300046660 Bacteria 2574
383 Ga0495625_0247100 3300046660 Bacteria 1159
384 Ga0495661_0021254 3300046665 Bacteria 4233
385 Ga0495661_0036115 3300046665 Unclassified 3096
386 Ga0495646_0688490 3300046680 Bacteria 515
387 Ga0495658_0005676 3300046683 Bacteria 6131
388 Ga0495669_0169578 3300046684 Unclassified 1038
389 Ga0495669_0517941 3300046684 Bacteria 580
390 Ga0495670_0152610 3300046691 Unclassified 1211
391 Ga0495670_0667948 3300046691 Unclassified 566
392 Ga0495660_0065685 3300046810 Bacteria 1936
393 Ga0495636_0316227 3300047318 Unclassified 732
394 Ga0495683_0122756 3300047323 Bacteria 1231
395 Ga0495683_0397991 3300047323 Bacteria 573
396 Ga0495687_013514 3300047443 Bacteria 4256
397 Ga0495677_0043010 3300047445 Unclassified 1656
398 Ga0495686_0000616 3300047472 Bacteria 49206
399 Ga0495686_0001184 3300047472 Bacteria 30421
400 Ga0495686_0019882 3300047472 Bacteria 4482
401 Ga0495682_0005922 3300049460 Bacteria 5014
402 Ga0501034_0000002 3300049571 Bacteria 565510
403 nmdc:mga0k408_175310_c1 3300050493 Bacteria 1278
404 nmdc:mga0k408_323_c1 3300050493 Bacteria 26051
405 nmdc:mga0k408_424_c1 3300050493 Bacteria 23079
406 nmdc:mga07m45_124498_c1 3300050496 Unclassified 1003
407 Ga0500635_0043391 3300053080 Unclassified 1512
408 Ga0500650_0265761 3300053098 Bacteria 766
409 Ga0500562_049710 3300053108 Bacteria 1121
410 Ga0500608_000931 3300053122 Bacteria 10509
411 Ga0500608_019034 3300053122 Bacteria 3142
412 Ga0500618_000020 3300053125 Bacteria 161356
413 Ga0500642_0064393 3300053130 Bacteria 1655
414 Ga0500655_132271 3300053133 Bacteria 533
415 Ga0500561_0141872 3300053137 Bacteria 744
416 Ga0500616_0409362 3300053153 Bacteria 540
417 Ga0500622_0000719 3300053156 Bacteria 28939
418 Ga0587073_0109868 3300059492 Bacteria 729

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006237 Ga0097621_102436538 Ga0097621_1024365382 81
2 3300047472 Ga0495686_0001184 Ga0495686_0001184_20515_20778 81
3 3300003320 rootH2_10163918 rootH2_101639182 85
4 3300031251 Ga0265327_10351411 Ga0265327_103514112 85
5 3300053153 Ga0500616_0409362 Ga0500616_0409362_15_272 85
6 3300005331 Ga0070670_100482889 Ga0070670_1004828892 86
7 3300005333 Ga0070677_10940138 Ga0070677_109401382 86
8 3300005338 Ga0068868_101004877 Ga0068868_1010048771 86
9 3300005347 Ga0070668_100577272 Ga0070668_1005772722 86
10 3300005353 Ga0070669_101520195 Ga0070669_1015201951 86
11 3300005356 Ga0070674_101360088 Ga0070674_1013600882 86
12 3300005539 Ga0068853_100160720 Ga0068853_1001607202 86
13 3300005543 Ga0070672_100210745 Ga0070672_1002107452 86
14 3300005563 Ga0068855_100431075 Ga0068855_1004310752 86
15 3300005614 Ga0068856_100000044 Ga0068856_10000004496 86
16 3300005618 Ga0068864_100099617 Ga0068864_1000996172 86
17 3300009174 Ga0105241_11392041 Ga0105241_113920412 86
18 3300009176 Ga0105242_11222898 Ga0105242_112228982 86
19 3300009545 Ga0105237_10227752 Ga0105237_102277522 86
20 3300009551 Ga0105238_12327434 Ga0105238_123274342 86
21 3300009553 Ga0105249_11898803 Ga0105249_118988031 86
22 3300010375 Ga0105239_10195521 Ga0105239_101955213 86
23 3300011119 Ga0105246_10994414 Ga0105246_109944141 86
24 3300013306 Ga0163162_10304349 Ga0163162_103043492 86
25 3300014325 Ga0163163_11508492 Ga0163163_115084922 86
26 3300025907 Ga0207645_10078690 Ga0207645_100786902 86
27 3300025914 Ga0207671_10063154 Ga0207671_100631544 86
28 3300025949 Ga0207667_10482990 Ga0207667_104829902 86
29 3300026078 Ga0207702_10000140 Ga0207702_1000014077 86
30 3300026089 Ga0207648_10321516 Ga0207648_103215162 86
31 3300031595 Ga0265313_10306191 Ga0265313_103061911 86
32 3300035114 Ga0373939_0436343 Ga0373939_0436343_246_506 86
33 3300041451 Ga0451791_1158038 Ga0451791_1158038_253_513 86
34 3300041460 Ga0451802_1609586 Ga0451802_1609586_45_305 86
35 3300001979 JGI24740J21852_10108277 JGI24740J21852_101082772 87
36 3300001990 JGI24737J22298_10004123 JGI24737J22298_100041234 87
37 3300001990 JGI24737J22298_10070628 JGI24737J22298_100706282 87
38 3300002067 JGI24735J21928_10003843 JGI24735J21928_100038434 87
39 3300002077 JGI24744J21845_10000567 JGI24744J21845_100005676 87
40 3300002737 JGI25162J39368_1001018 JGI25162J39368_100101812 87
41 3300002741 JGI25157J39369_1003302 JGI25157J39369_10033023 87
42 3300002741 JGI25157J39369_1010665 JGI25157J39369_10106652 87
43 3300003214 JGI25165J46597_1002560 JGI25165J46597_10025604 87
44 3300003316 rootH1_10088202 rootH1_100882022 87
45 3300003320 rootH2_10005827 rootH2_1000582764 87
46 3300003320 rootH2_10114409 rootH2_101144092 87
47 3300003322 rootL2_10035132 rootL2_100351322 87
48 3300003322 rootL2_10269531 rootL2_102695311 87
49 3300003323 rootH1_10000566 rootH1_10000566156 87
50 3300003323 rootH1_10090310 rootH1_100903106 87
51 3300003323 rootH1_10122080 rootH1_101220809 87
52 3300003323 rootH1_10328624 rootH1_103286244 87
53 3300004799 Ga0058863_10343366 Ga0058863_103433661 87
54 3300005288 Ga0065714_10067513 Ga0065714_100675132 87
55 3300005293 Ga0065715_10127873 Ga0065715_101278732 87
56 3300005327 Ga0070658_10000075 Ga0070658_1000007526 87
57 3300005327 Ga0070658_10041023 Ga0070658_100410235 87
58 3300005327 Ga0070658_10549692 Ga0070658_105496922 87
59 3300005327 Ga0070658_11473288 Ga0070658_114732882 87
60 3300005327 Ga0070658_11740647 Ga0070658_117406472 87
61 3300005328 Ga0070676_10001405 Ga0070676_100014052 87
62 3300005331 Ga0070670_100067336 Ga0070670_1000673363 87
63 3300005333 Ga0070677_10216113 Ga0070677_102161132 87
64 3300005334 Ga0068869_100688613 Ga0068869_1006886132 87
65 3300005334 Ga0068869_101086863 Ga0068869_1010868632 87
66 3300005335 Ga0070666_11015736 Ga0070666_110157362 87
67 3300005336 Ga0070680_100011377 Ga0070680_1000113773 87
68 3300005337 Ga0070682_100506309 Ga0070682_1005063091 87
69 3300005338 Ga0068868_100001486 Ga0068868_10000148617 87
70 3300005338 Ga0068868_100869404 Ga0068868_1008694042 87
71 3300005339 Ga0070660_100008755 Ga0070660_1000087554 87
72 3300005339 Ga0070660_100032947 Ga0070660_1000329474 87
73 3300005339 Ga0070660_100427977 Ga0070660_1004279772 87
74 3300005354 Ga0070675_101453927 Ga0070675_1014539271 87
75 3300005355 Ga0070671_100056189 Ga0070671_1000561893 87
76 3300005355 Ga0070671_100074394 Ga0070671_1000743942 87
77 3300005364 Ga0070673_100028678 Ga0070673_1000286783 87
78 3300005364 Ga0070673_100055683 Ga0070673_1000556832 87
79 3300005365 Ga0070688_100087447 Ga0070688_1000874472 87
80 3300005366 Ga0070659_100001045 Ga0070659_10000104512 87
81 3300005366 Ga0070659_100016831 Ga0070659_1000168314 87
82 3300005366 Ga0070659_100092117 Ga0070659_1000921173 87
83 3300005367 Ga0070667_100008389 Ga0070667_1000083893 87
84 3300005367 Ga0070667_100239036 Ga0070667_1002390362 87
85 3300005436 Ga0070713_100925026 Ga0070713_1009250262 87
86 3300005455 Ga0070663_100051490 Ga0070663_1000514904 87
87 3300005455 Ga0070663_101072123 Ga0070663_1010721232 87
88 3300005455 Ga0070663_101539223 Ga0070663_1015392232 87
89 3300005455 Ga0070663_101902402 Ga0070663_1019024021 87
90 3300005456 Ga0070678_100000635 Ga0070678_10000063514 87
91 3300005456 Ga0070678_100034281 Ga0070678_1000342813 87
92 3300005456 Ga0070678_101624364 Ga0070678_1016243642 87
93 3300005457 Ga0070662_100000167 Ga0070662_1000001674 87
94 3300005457 Ga0070662_100168545 Ga0070662_1001685451 87
95 3300005458 Ga0070681_10035380 Ga0070681_100353804 87
96 3300005458 Ga0070681_11308116 Ga0070681_113081162 87
97 3300005459 Ga0068867_101133291 Ga0068867_1011332912 87
98 3300005459 Ga0068867_101428038 Ga0068867_1014280381 87
99 3300005466 Ga0070685_10066034 Ga0070685_100660341 87
100 3300005539 Ga0068853_100047838 Ga0068853_1000478384 87
101 3300005539 Ga0068853_100051125 Ga0068853_1000511254 87
102 3300005539 Ga0068853_100398654 Ga0068853_1003986543 87
103 3300005539 Ga0068853_100489721 Ga0068853_1004897212 87
104 3300005539 Ga0068853_101191983 Ga0068853_1011919832 87
105 3300005543 Ga0070672_100448933 Ga0070672_1004489332 87
106 3300005543 Ga0070672_101917520 Ga0070672_1019175202 87
107 3300005548 Ga0070665_100000284 Ga0070665_10000028444 87
108 3300005563 Ga0068855_100009981 Ga0068855_10000998111 87
109 3300005563 Ga0068855_100044817 Ga0068855_1000448177 87
110 3300005563 Ga0068855_100196861 Ga0068855_1001968614 87
111 3300005563 Ga0068855_100919326 Ga0068855_1009193261 87
112 3300005563 Ga0068855_101391786 Ga0068855_1013917862 87
113 3300005563 Ga0068855_101575384 Ga0068855_1015753842 87
114 3300005577 Ga0068857_100013369 Ga0068857_1000133697 87
115 3300005577 Ga0068857_101673324 Ga0068857_1016733242 87
116 3300005578 Ga0068854_100311949 Ga0068854_1003119492 87
117 3300005578 Ga0068854_100747032 Ga0068854_1007470323 87
118 3300005614 Ga0068856_100003367 Ga0068856_1000033677 87
119 3300005614 Ga0068856_100020596 Ga0068856_1000205964 87
120 3300005614 Ga0068856_101217734 Ga0068856_1012177341 87
121 3300005614 Ga0068856_101895383 Ga0068856_1018953832 87
122 3300005616 Ga0068852_100000386 Ga0068852_1000003865 87
123 3300005616 Ga0068852_100096042 Ga0068852_1000960422 87
124 3300005616 Ga0068852_100992288 Ga0068852_1009922882 87
125 3300005616 Ga0068852_101483428 Ga0068852_1014834281 87
126 3300005718 Ga0068866_10140297 Ga0068866_101402973 87
127 3300005834 Ga0068851_10049235 Ga0068851_100492352 87
128 3300005834 Ga0068851_10422645 Ga0068851_104226452 87
129 3300005841 Ga0068863_100009631 Ga0068863_10000963111 87
130 3300005842 Ga0068858_100116835 Ga0068858_1001168351 87
131 3300005843 Ga0068860_100008374 Ga0068860_1000083746 87
132 3300005843 Ga0068860_100783916 Ga0068860_1007839162 87
133 3300006195 Ga0075366_10000091 Ga0075366_100000916 87
134 3300006195 Ga0075366_10001842 Ga0075366_100018423 87
135 3300006195 Ga0075366_10129775 Ga0075366_101297752 87
136 3300006237 Ga0097621_100003703 Ga0097621_1000037032 87
137 3300006237 Ga0097621_101218529 Ga0097621_1012185292 87
138 3300006237 Ga0097621_101800621 Ga0097621_1018006211 87
139 3300006358 Ga0068871_100000070 Ga0068871_10000007043 87
140 3300006358 Ga0068871_100256784 Ga0068871_1002567842 87
141 3300006358 Ga0068871_100375945 Ga0068871_1003759452 87
142 3300006881 Ga0068865_100000448 Ga0068865_10000044816 87
143 3300009093 Ga0105240_10004296 Ga0105240_1000429617 87
144 3300009093 Ga0105240_10009293 Ga0105240_1000929311 87
145 3300009093 Ga0105240_10012464 Ga0105240_1001246411 87
146 3300009093 Ga0105240_10143718 Ga0105240_101437182 87
147 3300009093 Ga0105240_10202158 Ga0105240_102021582 87
148 3300009093 Ga0105240_10213761 Ga0105240_102137613 87
149 3300009093 Ga0105240_10253072 Ga0105240_102530724 87
150 3300009093 Ga0105240_10926707 Ga0105240_109267072 87
151 3300009093 Ga0105240_11146218 Ga0105240_111462182 87
152 3300009098 Ga0105245_10858898 Ga0105245_108588982 87
153 3300009148 Ga0105243_10252100 Ga0105243_102521002 87
154 3300009174 Ga0105241_10001799 Ga0105241_1000179914 87
155 3300009174 Ga0105241_10003945 Ga0105241_1000394512 87
156 3300009174 Ga0105241_10021169 Ga0105241_100211694 87
157 3300009174 Ga0105241_10048026 Ga0105241_100480262 87
158 3300009174 Ga0105241_12245632 Ga0105241_122456322 87
159 3300009176 Ga0105242_10094410 Ga0105242_100944104 87
160 3300009176 Ga0105242_10231240 Ga0105242_102312404 87
161 3300009176 Ga0105242_11555818 Ga0105242_115558182 87
162 3300009176 Ga0105242_11567561 Ga0105242_115675612 87
163 3300009545 Ga0105237_10001162 Ga0105237_1000116215 87
164 3300009545 Ga0105237_10002306 Ga0105237_1000230621 87
165 3300009545 Ga0105237_10016270 Ga0105237_100162704 87
166 3300009545 Ga0105237_10070166 Ga0105237_100701664 87
167 3300009545 Ga0105237_10213037 Ga0105237_102130374 87
168 3300009545 Ga0105237_10659599 Ga0105237_106595992 87
169 3300009551 Ga0105238_10000693 Ga0105238_100006933 87
170 3300009551 Ga0105238_10949090 Ga0105238_109490902 87
171 3300010375 Ga0105239_10000002 Ga0105239_10000002287 87
172 3300010375 Ga0105239_10000006 Ga0105239_10000006191 87
173 3300010375 Ga0105239_10005880 Ga0105239_100058804 87
174 3300010375 Ga0105239_10114113 Ga0105239_101141132 87
175 3300010375 Ga0105239_10227281 Ga0105239_102272812 87
176 3300010375 Ga0105239_10899427 Ga0105239_108994272 87
177 3300011119 Ga0105246_10009185 Ga0105246_100091856 87
178 3300013100 Ga0157373_10125268 Ga0157373_101252683 87
179 3300013100 Ga0157373_10312718 Ga0157373_103127181 87
180 3300013102 Ga0157371_10000269 Ga0157371_1000026919 87
181 3300013102 Ga0157371_10001621 Ga0157371_100016214 87
182 3300013102 Ga0157371_10891164 Ga0157371_108911642 87
183 3300013104 Ga0157370_10047247 Ga0157370_100472475 87
184 3300013104 Ga0157370_10126075 Ga0157370_101260754 87
185 3300013104 Ga0157370_10437768 Ga0157370_104377682 87
186 3300013104 Ga0157370_10549168 Ga0157370_105491682 87
187 3300013105 Ga0157369_10012411 Ga0157369_1001241111 87
188 3300013105 Ga0157369_10077184 Ga0157369_100771844 87
189 3300013105 Ga0157369_10094674 Ga0157369_100946745 87
190 3300013105 Ga0157369_10133824 Ga0157369_101338243 87
191 3300013296 Ga0157374_10004549 Ga0157374_1000454915 87
192 3300013296 Ga0157374_10038219 Ga0157374_100382192 87
193 3300013296 Ga0157374_10142659 Ga0157374_101426592 87
194 3300013296 Ga0157374_10289133 Ga0157374_102891332 87
195 3300013296 Ga0157374_10302616 Ga0157374_103026162 87
196 3300013297 Ga0157378_10012296 Ga0157378_100122961 87
197 3300013297 Ga0157378_10029320 Ga0157378_100293204 87
198 3300013297 Ga0157378_10036855 Ga0157378_100368553 87
199 3300013297 Ga0157378_10059958 Ga0157378_100599584 87
200 3300013297 Ga0157378_10449575 Ga0157378_104495752 87
201 3300013297 Ga0157378_11353694 Ga0157378_113536942 87
202 3300013297 Ga0157378_11937660 Ga0157378_119376602 87
203 3300013306 Ga0163162_10000044 Ga0163162_1000004454 87
204 3300013306 Ga0163162_10018680 Ga0163162_100186806 87
205 3300013306 Ga0163162_10103522 Ga0163162_101035223 87
206 3300013306 Ga0163162_10142644 Ga0163162_101426442 87
207 3300013306 Ga0163162_11187504 Ga0163162_111875042 87
208 3300013306 Ga0163162_12328268 Ga0163162_123282681 87
209 3300013307 Ga0157372_10000009 Ga0157372_10000009108 87
210 3300013307 Ga0157372_10001087 Ga0157372_100010872 87
211 3300013307 Ga0157372_10010312 Ga0157372_1001031211 87
212 3300013307 Ga0157372_10121427 Ga0157372_101214272 87
213 3300013307 Ga0157372_10462750 Ga0157372_104627503 87
214 3300013308 Ga0157375_10030759 Ga0157375_100307592 87
215 3300013308 Ga0157375_10121218 Ga0157375_101212182 87
216 3300014326 Ga0157380_10341752 Ga0157380_103417522 87
217 3300014745 Ga0157377_10442755 Ga0157377_104427552 87
218 3300014969 Ga0157376_10304635 Ga0157376_103046352 87
219 3300015262 Ga0182007_10266481 Ga0182007_102664811 87
220 3300020610 Ga0154015_1569203 Ga0154015_15692032 87
221 3300021361 Ga0213872_10013116 Ga0213872_100131165 87
222 3300022467 Ga0224712_10575145 Ga0224712_105751452 87
223 3300025231 Ga0207427_100093 Ga0207427_10009363 87
224 3300025231 Ga0207427_117579 Ga0207427_1175791 87
225 3300025233 Ga0209437_100008 Ga0209437_100008481 87
226 3300025250 Ga0209026_1000930 Ga0209026_10009304 87
227 3300025250 Ga0209026_1002432 Ga0209026_10024325 87
228 3300025261 Ga0209233_1000024 Ga0209233_1000024176 87
229 3300025261 Ga0209233_1001096 Ga0209233_10010962 87
230 3300025261 Ga0209233_1011068 Ga0209233_10110683 87
231 3300025272 Ga0209455_1001317 Ga0209455_10013172 87
232 3300025321 Ga0207656_10544556 Ga0207656_105445562 87
233 3300025899 Ga0207642_10756141 Ga0207642_107561412 87
234 3300025904 Ga0207647_10000209 Ga0207647_1000020929 87
235 3300025904 Ga0207647_10000463 Ga0207647_1000046331 87
236 3300025904 Ga0207647_10499459 Ga0207647_104994591 87
237 3300025907 Ga0207645_10001060 Ga0207645_100010606 87
238 3300025907 Ga0207645_11046739 Ga0207645_110467392 87
239 3300025909 Ga0207705_10000102 Ga0207705_1000010227 87
240 3300025909 Ga0207705_10460125 Ga0207705_104601252 87
241 3300025909 Ga0207705_10574561 Ga0207705_105745612 87
242 3300025911 Ga0207654_10035950 Ga0207654_100359502 87
243 3300025911 Ga0207654_10081034 Ga0207654_100810342 87
244 3300025912 Ga0207707_10007990 Ga0207707_100079902 87
245 3300025912 Ga0207707_11534680 Ga0207707_115346801 87
246 3300025913 Ga0207695_10006768 Ga0207695_1000676810 87
247 3300025913 Ga0207695_10008363 Ga0207695_100083638 87
248 3300025913 Ga0207695_10069540 Ga0207695_100695401 87
249 3300025913 Ga0207695_10179488 Ga0207695_101794882 87
250 3300025913 Ga0207695_10337668 Ga0207695_103376682 87
251 3300025913 Ga0207695_10367219 Ga0207695_103672192 87
252 3300025913 Ga0207695_10414580 Ga0207695_104145802 87
253 3300025913 Ga0207695_10557522 Ga0207695_105575221 87
254 3300025913 Ga0207695_10894646 Ga0207695_108946462 87
255 3300025913 Ga0207695_10896512 Ga0207695_108965121 87
256 3300025914 Ga0207671_10000901 Ga0207671_1000090111 87
257 3300025914 Ga0207671_10002483 Ga0207671_1000248320 87
258 3300025914 Ga0207671_10072003 Ga0207671_100720033 87
259 3300025914 Ga0207671_10348529 Ga0207671_103485292 87
260 3300025914 Ga0207671_10428753 Ga0207671_104287532 87
261 3300025917 Ga0207660_10053988 Ga0207660_100539884 87
262 3300025919 Ga0207657_10036426 Ga0207657_100364262 87
263 3300025919 Ga0207657_10036557 Ga0207657_100365573 87
264 3300025919 Ga0207657_10281593 Ga0207657_102815932 87
265 3300025921 Ga0207652_10415191 Ga0207652_104151912 87
266 3300025921 Ga0207652_10432196 Ga0207652_104321962 87
267 3300025924 Ga0207694_10033717 Ga0207694_100337173 87
268 3300025925 Ga0207650_10417885 Ga0207650_104178852 87
269 3300025926 Ga0207659_11354503 Ga0207659_113545032 87
270 3300025931 Ga0207644_10044686 Ga0207644_100446862 87
271 3300025931 Ga0207644_10045374 Ga0207644_100453742 87
272 3300025932 Ga0207690_10000770 Ga0207690_1000077014 87
273 3300025932 Ga0207690_10003147 Ga0207690_100031475 87
274 3300025933 Ga0207706_10000257 Ga0207706_1000025736 87
275 3300025933 Ga0207706_10380410 Ga0207706_103804101 87
276 3300025934 Ga0207686_10173752 Ga0207686_101737524 87
277 3300025937 Ga0207669_10047903 Ga0207669_100479032 87
278 3300025938 Ga0207704_10000016 Ga0207704_10000016102 87
279 3300025940 Ga0207691_10443916 Ga0207691_104439162 87
280 3300025940 Ga0207691_11612650 Ga0207691_116126502 87
281 3300025949 Ga0207667_10006040 Ga0207667_1000604011 87
282 3300025949 Ga0207667_10053592 Ga0207667_100535924 87
283 3300025949 Ga0207667_10248746 Ga0207667_102487463 87
284 3300025949 Ga0207667_10988084 Ga0207667_109880842 87
285 3300025949 Ga0207667_11258888 Ga0207667_112588882 87
286 3300025960 Ga0207651_10113012 Ga0207651_101130122 87
287 3300025960 Ga0207651_10255338 Ga0207651_102553382 87
288 3300025960 Ga0207651_10545333 Ga0207651_105453332 87
289 3300025981 Ga0207640_10403411 Ga0207640_104034112 87
290 3300025981 Ga0207640_10699798 Ga0207640_106997981 87
291 3300025986 Ga0207658_10984146 Ga0207658_109841462 87
292 3300026023 Ga0207677_10014835 Ga0207677_100148353 87
293 3300026023 Ga0207677_10166370 Ga0207677_101663702 87
294 3300026035 Ga0207703_11736229 Ga0207703_117362291 87
295 3300026041 Ga0207639_10009526 Ga0207639_100095262 87
296 3300026041 Ga0207639_10033306 Ga0207639_100333065 87
297 3300026041 Ga0207639_10109573 Ga0207639_101095732 87
298 3300026041 Ga0207639_10575068 Ga0207639_105750682 87
299 3300026041 Ga0207639_10795406 Ga0207639_107954062 87
300 3300026041 Ga0207639_11175080 Ga0207639_111750802 87
301 3300026067 Ga0207678_10216829 Ga0207678_102168292 87
302 3300026067 Ga0207678_10908691 Ga0207678_109086912 87
303 3300026067 Ga0207678_11769587 Ga0207678_117695872 87
304 3300026078 Ga0207702_10021409 Ga0207702_100214094 87
305 3300026078 Ga0207702_10845459 Ga0207702_108454592 87
306 3300026078 Ga0207702_11567496 Ga0207702_115674962 87
307 3300026089 Ga0207648_11071449 Ga0207648_110714492 87
308 3300026089 Ga0207648_11139826 Ga0207648_111398262 87
309 3300026095 Ga0207676_11590806 Ga0207676_115908062 87
310 3300026116 Ga0207674_10073673 Ga0207674_100736734 87
311 3300026116 Ga0207674_11134047 Ga0207674_111340471 87
312 3300026121 Ga0207683_10003553 Ga0207683_100035536 87
313 3300026121 Ga0207683_10052708 Ga0207683_100527083 87
314 3300026142 Ga0207698_10310285 Ga0207698_103102852 87
315 3300026142 Ga0207698_12018370 Ga0207698_120183701 87
316 3300028379 Ga0268266_10000291 Ga0268266_1000029143 87
317 3300028381 Ga0268264_10067420 Ga0268264_100674202 87
318 3300028786 Ga0307517_10003309 Ga0307517_1000330911 87
319 3300028794 Ga0307515_10000790 Ga0307515_1000079030 87
320 3300028794 Ga0307515_10001523 Ga0307515_100015239 87
321 3300031251 Ga0265327_10000410 Ga0265327_1000041051 87
322 3300031251 Ga0265327_10014734 Ga0265327_100147342 87
323 3300031251 Ga0265327_10086247 Ga0265327_100862472 87
324 3300031730 Ga0307516_10003007 Ga0307516_100030076 87
325 3300031911 Ga0307412_10249544 Ga0307412_102495443 87
326 3300033179 Ga0307507_10000078 Ga0307507_1000007899 87
327 3300033180 Ga0307510_10003634 Ga0307510_1000363414 87
328 3300037312 Ga0395899_0000001 Ga0395899_0000001_1225679_1225942 87
329 3300037312 Ga0395899_0002782 Ga0395899_0002782_9873_10139 87
330 3300037312 Ga0395899_0002957 Ga0395899_0002957_12116_12379 87
331 3300037418 Ga0395900_0000327 Ga0395900_0000327_39704_39967 87
332 3300037418 Ga0395900_0005440 Ga0395900_0005440_3509_3775 87
333 3300037418 Ga0395900_0024302 Ga0395900_0024302_1752_2024 87
334 3300037418 Ga0395900_0060434 Ga0395900_0060434_393_656 87
335 3300037418 Ga0395900_0269019 Ga0395900_0269019_211_474 87
336 3300037466 Ga0395898_0030098 Ga0395898_0030098_4437_4703 87
337 3300037466 Ga0395898_0196689 Ga0395898_0196689_825_1097 87
338 3300037466 Ga0395898_1826853 Ga0395898_1826853_177_440 87
339 3300037471 Ga0395905_0000461 Ga0395905_0000461_28087_28353 87
340 3300037471 Ga0395905_0001887 Ga0395905_0001887_13521_13793 87
341 3300038443 Ga0395901_0000464 Ga0395901_0000464_22713_22979 87
342 3300038443 Ga0395901_0019758 Ga0395901_0019758_1503_1775 87
343 3300038443 Ga0395901_0249847 Ga0395901_0249847_107_370 87
344 3300039447 Ga0436361_0773655 Ga0436361_0773655_3221_3484 87
345 3300041512 Ga0451853_0690033 Ga0451853_0690033_416_679 87
346 3300044684 Ga0466966_0014474 Ga0466966_0014474_3267_3530 87
347 3300044712 Ga0453684_2291453 Ga0453684_2291453_256_519 87
348 3300044735 Ga0466968_0211232 Ga0466968_0211232_343_606 87
349 3300045049 Ga0466959_0318514 Ga0466959_0318514_419_682 87
350 3300045049 Ga0466959_0468449 Ga0466959_0468449_472_747 87
351 3300045836 Ga0466958_0022787 Ga0466958_0022787_1336_1599 87
352 3300046459 Ga0495629_0035858 Ga0495629_0035858_1073_1336 87
353 3300046460 Ga0495638_0121403 Ga0495638_0121403_618_881 87
354 3300046462 Ga0495651_0275478 Ga0495651_0275478_667_933 87
355 3300046471 Ga0495650_0065277 Ga0495650_0065277_1158_1421 87
356 3300046474 Ga0495605_0101503 Ga0495605_0101503_670_933 87
357 3300046475 Ga0495639_0525027 Ga0495639_0525027_98_361 87
358 3300046492 Ga0495585_0001288 Ga0495585_0001288_6755_7018 87
359 3300046500 Ga0495596_0127069 Ga0495596_0127069_499_762 87
360 3300046501 Ga0495607_0549863 Ga0495607_0549863_157_420 87
361 3300046506 Ga0495583_0070154 Ga0495583_0070154_406_669 87
362 3300046506 Ga0495583_0099576 Ga0495583_0099576_799_1062 87
363 3300046506 Ga0495583_0425124 Ga0495583_0425124_55_321 87
364 3300046507 Ga0495606_0011271 Ga0495606_0011271_4582_4845 87
365 3300046507 Ga0495606_0398752 Ga0495606_0398752_315_578 87
366 3300046513 Ga0495616_0043690 Ga0495616_0043690_489_752 87
367 3300046514 Ga0495618_0904065 Ga0495618_0904065_88_351 87
368 3300046518 Ga0495631_0007451 Ga0495631_0007451_2166_2429 87
369 3300046523 Ga0495644_0001493 Ga0495644_0001493_5360_5623 87
370 3300046524 Ga0495648_0005741 Ga0495648_0005741_4529_4792 87
371 3300046530 Ga0495654_0034404 Ga0495654_0034404_744_1007 87
372 3300046538 Ga0495609_0044220 Ga0495609_0044220_46_309 87
373 3300046542 Ga0495597_0323574 Ga0495597_0323574_279_542 87
374 3300046557 Ga0495622_0052178 Ga0495622_0052178_395_658 87
375 3300046558 Ga0495633_0000074 Ga0495633_0000074_127501_127764 87
376 3300046616 Ga0495668_0000017 Ga0495668_0000017_266861_267124 87
377 3300046616 Ga0495668_0162376 Ga0495668_0162376_511_774 87
378 3300046616 Ga0495668_0221404 Ga0495668_0221404_524_787 87
379 3300046642 Ga0495634_0276508 Ga0495634_0276508_124_387 87
380 3300046660 Ga0495625_0000435 Ga0495625_0000435_19978_20241 87
381 3300046660 Ga0495625_0001213 Ga0495625_0001213_27760_28023 87
382 3300046660 Ga0495625_0034761 Ga0495625_0034761_532_795 87
383 3300046660 Ga0495625_0064937 Ga0495625_0064937_574_837 87
384 3300046660 Ga0495625_0247100 Ga0495625_0247100_464_727 87
385 3300046665 Ga0495661_0021254 Ga0495661_0021254_3343_3606 87
386 3300046665 Ga0495661_0036115 Ga0495661_0036115_2777_3040 87
387 3300046680 Ga0495646_0688490 Ga0495646_0688490_50_316 87
388 3300046683 Ga0495658_0005676 Ga0495658_0005676_1972_2235 87
389 3300046684 Ga0495669_0169578 Ga0495669_0169578_339_602 87
390 3300046684 Ga0495669_0517941 Ga0495669_0517941_180_443 87
391 3300046691 Ga0495670_0152610 Ga0495670_0152610_931_1194 87
392 3300046691 Ga0495670_0667948 Ga0495670_0667948_252_518 87
393 3300046810 Ga0495660_0065685 Ga0495660_0065685_292_555 87
394 3300047318 Ga0495636_0316227 Ga0495636_0316227_388_651 87
395 3300047323 Ga0495683_0122756 Ga0495683_0122756_784_1047 87
396 3300047323 Ga0495683_0397991 Ga0495683_0397991_125_388 87
397 3300047443 Ga0495687_013514 Ga0495687_013514_3718_3984 87
398 3300047445 Ga0495677_0043010 Ga0495677_0043010_461_724 87
399 3300047472 Ga0495686_0000616 Ga0495686_0000616_5084_5347 87
400 3300047472 Ga0495686_0019882 Ga0495686_0019882_1312_1575 87
401 3300049460 Ga0495682_0005922 Ga0495682_0005922_166_429 87
402 3300049571 Ga0501034_0000002 Ga0501034_0000002_189045_189308 87
403 3300050493 nmdc:mga0k408_175310_c1 nmdc:mga0k408_175310_c1_548_811 87
404 3300050493 nmdc:mga0k408_323_c1 nmdc:mga0k408_323_c1_7095_7361 87
405 3300050493 nmdc:mga0k408_424_c1 nmdc:mga0k408_424_c1_3760_4023 87
406 3300050496 nmdc:mga07m45_124498_c1 nmdc:mga07m45_124498_c1_601_864 87
407 3300053080 Ga0500635_0043391 Ga0500635_0043391_319_582 87
408 3300053098 Ga0500650_0265761 Ga0500650_0265761_139_402 87
409 3300053108 Ga0500562_049710 Ga0500562_049710_218_481 87
410 3300053122 Ga0500608_000931 Ga0500608_000931_1426_1689 87
411 3300053122 Ga0500608_019034 Ga0500608_019034_1613_1876 87
412 3300053125 Ga0500618_000020 Ga0500618_000020_153688_153951 87
413 3300053130 Ga0500642_0064393 Ga0500642_0064393_948_1211 87
414 3300053133 Ga0500655_132271 Ga0500655_132271_220_483 87
415 3300053137 Ga0500561_0141872 Ga0500561_0141872_138_401 87
416 3300053156 Ga0500622_0000719 Ga0500622_0000719_13722_13985 87
417 3300059492 Ga0587073_0109868 Ga0587073_0109868_429_692 87

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00550

PP-binding

Phosphopantetheine attachment site

8

65

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fac-assembly1.cif.gz_A crystal structure of e. coli hexanoyl-acp 0.8949 6 86
8jfh-assembly1.cif.gz_E crystal structure of 3-oxoacyl-acp reductase fabg in complex with nadp+ and 3-keto-octanoyl-acp from helicobacter pylori in an inactive form that priors the acyl substrate delivery 0.8879 4 87
1l0i-assembly1.cif.gz_A crystal structure of butyryl-acp i62m mutant 0.8816 6 86
4ihg-assembly1.cif.gz_H chasing acyl carrier protein through a catalytic cycle of lipid a production 0.8723 7 82
2ehs-assembly1.cif.gz_A crystal structure of acyl carrier protein from aquifex aeolicus (form 1) 0.8702 6 83
ID Description Score Start End Superfamily
af_Q7KWJ1_42_137_1.10.1200.10 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.891 3 84 1.10.1200.10
3gzmA00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.8867 2 85 1.10.1200.10
3gzmA00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.8766 2 85 1.10.1200.10
af_P0A6A8_1_78_1.10.1200.10 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.8636 6 83 1.10.1200.10
3ejeA00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.8563 6 84 1.10.1200.10
ID Description Score Start End GO Terms
AF-A0A5B8UTF6-F1-model_v4 Acyl carrier protein 1.001 1 86
AF-A0A1I3RP14-F1-model_v4 Acyl carrier protein 0.9993 4 87
AF-A0A4R7D4G2-F1-model_v4 Acyl carrier protein 0.9984 3 87
AF-A0A327R5R6-F1-model_v4 Acyl carrier protein 0.9982 3 83
AF-A0A7V0UAN3-F1-model_v4 Acyl carrier protein 0.9976 4 82

Feature Viewer

pLDDT pTM Quality
91.98 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map