F438931

General Info

Members Datasets Scaffolds Average Seq Length
416 230 832 403

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2506783011|2506866995
Length 453
Sequence PASPEPPTAAPSPRAAETAAPSPPHRQQAEHHLPVAARRRGGPFGAGLGRRSFLAGALTAGAAVGVSGTALATTAGDDQDGTRDRNPNQTVDFHGTHQAGILTPAPAAAMFASFDVIATYRAGLTELFTTITERARFLTAGGVPVDLGTTAPPSDSGIVGPVVPPDALTVTVGVGASLFDDRFGLADRRPRRLTPMRTFPNDALDPAHCHGDLSLQLCAHNRDTVLHALRDIARHTRGGMQLRWRVDGFQNPPRPSGTQRNLLGFKDGTANPDATSAAEMDRLVWVRGGGEPAWTEGGSYQVIRVIRMLVEFWDRVSLNEQEMMIGRRRDTGAPLDGTVEADTPDYTRDPEGGIIPLDAHIRLSNPRTPATDSSRILRRGYNYDRGIDSNGNLDMGLLFCCYQQDIARQFETTQTRLIDEPLVDYISPTGGGYFFVMPGVRGSTDHLGRTLLA

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
19 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
20 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
24 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
25 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
26 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
27 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
28 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
29 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
30 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
31 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
32 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
34 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
50 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
51 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
52 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
53 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
54 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
55 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
56 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
57 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
58 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
59 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
60 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
61 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
62 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
63 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
64 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
65 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
66 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
67 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
68 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
69 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
70 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
71 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
72 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
73 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
74 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
75 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
76 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
77 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
78 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
79 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
80 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
81 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
82 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
83 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
84 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
85 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
86 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
87 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
88 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
89 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
90 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
91 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
92 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
93 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
94 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
95 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
96 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
97 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
98 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
99 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
100 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
101 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
102 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
103 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
104 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
105 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
106 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
107 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
108 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
109 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
110 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
111 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
112 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
113 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
114 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
115 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
116 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
117 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
118 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
119 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
120 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
121 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
122 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
123 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
124 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
125 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
126 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
127 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
128 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
129 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
130 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
131 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
132 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
133 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
134 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
135 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
136 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
137 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
138 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
139 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
140 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
141 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
142 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
143 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
144 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
145 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
146 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
147 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
148 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
149 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
150 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
153 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
154 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
159 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
160 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
161 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
162 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
163 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
173 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
177 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
178 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
179 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
180 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
181 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
182 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
183 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
184 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
185 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
186 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
187 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
188 2506783011 Frankia datiscae Dg1 Isolate Nodule
189 2527291627 Frankia casuarinae Thr Isolate Nodule
190 2527291629 Frankia sp. BMG5.23 Isolate Nodule
191 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
192 2547132424 Nocardia nova SH22a Isolate Unclassified
193 2576861822 Frankia sp. CeD Isolate Nodule
194 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
195 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
196 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
197 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
198 2643221647 Streptomyces sp. Root369 Isolate Unclassified
199 2684623036 Frankia sp. CgIM4 Isolate Nodule
200 2687453737 Frankia sp. BMG5.36 Isolate Nodule
201 2710264753 Frankia sp. KB5 Isolate Nodule
202 2773857924 Frankia sp. CgIS1 Isolate Nodule
203 2773857933 Frankia sp. BMG5.30 Isolate Nodule
204 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
205 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
206 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
207 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
208 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
209 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
210 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
211 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
212 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
213 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
214 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
215 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
216 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
217 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
218 2928153084 Leifsonia sp. 563 Isolate Unclassified
219 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
220 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
221 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
222 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
223 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
224 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
225 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
226 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
227 637000116 Frankia casuarinae CcI3 Isolate Nodule
228 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
229 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
230 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.98
Metatranscriptomes 0.48
Isolates 11.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.4
Nodule 2.88
Rhizoplane 2.4
Rhizosphere 80.53
Stem 0
Stem Tuber 0.24
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10014833 3300001990 Bacteria 2526
2 rootL2_10010584 3300003322 Bacteria 10621
3 rootL2_10014657 3300003322 Bacteria 3927
4 rootH1_10100537 3300003323 Bacteria 2133
5 Ga0006562J51391_1046577 3300003578 Bacteria 13256
6 Ga0006562J51391_1046578 3300003578 Bacteria 13190
7 Ga0070709_10061771 3300005434 Bacteria 2386
8 Ga0070709_10063246 3300005434 Bacteria 2363
9 Ga0070709_10065517 3300005434 Bacteria 2327
10 Ga0070714_100001065 3300005435 Bacteria 19615
11 Ga0070714_100001183 3300005435 Bacteria 18799
12 Ga0070714_100057425 3300005435 Bacteria 3332
13 Ga0070714_100087977 3300005435 Bacteria 2717
14 Ga0070714_100124020 3300005435 Bacteria 2301
15 Ga0070714_100220875 3300005435 Bacteria 1741
16 Ga0070713_100009114 3300005436 Bacteria 7079
17 Ga0070710_10010732 3300005437 Bacteria 4504
18 Ga0070710_10166370 3300005437 Bacteria 1371
19 Ga0070711_100081869 3300005439 Bacteria 2302
20 Ga0070711_100131818 3300005439 Bacteria 1862
21 Ga0070663_100001305 3300005455 Bacteria 13642
22 Ga0070707_100011841 3300005468 Bacteria 8142
23 Ga0070665_100385975 3300005548 Bacteria 1408
24 Ga0068854_100062386 3300005578 Bacteria 2702
25 Ga0068856_100079822 3300005614 Bacteria 3245
26 Ga0068859_100005051 3300005617 Bacteria 13395
27 Ga0081539_10000162 3300005985 Bacteria 156292
28 Ga0070717_10075855 3300006028 Bacteria 2813
29 Ga0070712_100058233 3300006175 Bacteria 2717
30 Ga0070712_100061828 3300006175 Bacteria 2647
31 Ga0075367_10001344 3300006178 Bacteria 10446
32 Ga0097620_100005051 3300006931 Bacteria 13395
33 Ga0099826_10020909 3300006948 Bacteria 4904
34 Ga0105240_10132051 3300009093 Bacteria 2994
35 Ga0105240_10175056 3300009093 Bacteria 2537
36 Ga0105247_10000489 3300009101 Bacteria 32877
37 Ga0105248_10002242 3300009177 Bacteria 21386
38 Ga0105237_10056082 3300009545 Bacteria 3945
39 Ga0105246_10020122 3300011119 Bacteria 4278
40 Ga0157372_10116671 3300013307 Bacteria 3061
41 Ga0157372_10166439 3300013307 Bacteria 2550
42 Ga0182008_10002910 3300014497 Bacteria 10593
43 Ga0157379_10093419 3300014968 Bacteria 2699
44 Ga0182007_10001534 3300015262 Bacteria 12333
45 Ga0213875_10000281 3300021388 Bacteria 49818
46 Ga0209455_1002024 3300025272 Bacteria 8274
47 Ga0207426_1000707 3300025302 Bacteria 39468
48 Ga0207692_10008237 3300025898 Bacteria 4309
49 Ga0207710_10000262 3300025900 Bacteria 43743
50 Ga0207699_10144786 3300025906 Bacteria 1565
51 Ga0207695_10060852 3300025913 Bacteria 3906
52 Ga0207695_10071981 3300025913 Bacteria 3529
53 Ga0207693_10021406 3300025915 Bacteria 5139
54 Ga0207693_10145816 3300025915 Bacteria 1861
55 Ga0207663_10080568 3300025916 Bacteria 2129
56 Ga0207646_10016692 3300025922 Bacteria 6887
57 Ga0207700_10171711 3300025928 Bacteria 1809
58 Ga0207664_10007861 3300025929 Bacteria 7408
59 Ga0207664_10023409 3300025929 Bacteria 4627
60 Ga0207664_10058970 3300025929 Bacteria 3056
61 Ga0207711_10037420 3300025941 Bacteria 4121
62 Ga0207668_10002912 3300025972 Bacteria 10043
63 Ga0207678_10001335 3300026067 Bacteria 22751
64 Ga0207708_10070003 3300026075 Bacteria 2686
65 Ga0207702_10059882 3300026078 Bacteria 3245
66 Ga0268266_10186120 3300028379 Bacteria 1894
67 Ga0307517_10005158 3300028786 Bacteria 19824
68 Ga0307515_10000657 3300028794 Bacteria 79784
69 Ga0307515_10021555 3300028794 Bacteria 11417
70 Ga0307511_10000237 3300030521 Bacteria 56458
71 Ga0307511_10004979 3300030521 Bacteria 13546
72 Ga0307511_10013357 3300030521 Bacteria 8025
73 Ga0307511_10028993 3300030521 Bacteria 5009
74 Ga0265340_10002026 3300031247 Bacteria 11599
75 Ga0265327_10000001 3300031251 Bacteria 894475
76 Ga0265327_10001316 3300031251 Bacteria 32359
77 Ga0307509_10017732 3300031507 Bacteria 8181
78 Ga0307509_10037147 3300031507 Bacteria 5326
79 Ga0307509_10040642 3300031507 Bacteria 5056
80 Ga0307509_10105796 3300031507 Bacteria 2834
81 Ga0307509_10120454 3300031507 Bacteria 2602
82 Ga0307508_10002627 3300031616 Bacteria 18885
83 Ga0307516_10009119 3300031730 Bacteria 11112
84 Ga0307413_10000726 3300031824 Bacteria 11335
85 Ga0307518_10078908 3300031838 Bacteria 2378
86 Ga0307410_10118094 3300031852 Bacteria 1929
87 Ga0307507_10000020 3300033179 Bacteria 220880
88 Ga0307507_10014421 3300033179 Bacteria 9427
89 Ga0307507_10059831 3300033179 Bacteria 3563
90 Ga0307507_10076674 3300033179 Bacteria 2979
91 Ga0307510_10017246 3300033180 Bacteria 8520
92 Ga0307510_10023440 3300033180 Bacteria 7154
93 Ga0373950_0001582 3300034818 Bacteria 2994
94 Ga0373938_0004621 3300034957 Bacteria 2310
95 Ga0373942_0000040 3300035207 Bacteria 24793
96 Ga0373924_0037861 3300035410 Bacteria 1966
97 Ga0373937_0134896 3300036401 Bacteria 2307
98 Ga0373925_0021562 3300037068 Bacteria 4695
99 Ga0395900_0019108 3300037418 Bacteria 6988
100 Ga0395900_0047878 3300037418 Bacteria 4404
101 Ga0395898_0004999 3300037466 Bacteria 14384
102 Ga0395898_0045193 3300037466 Bacteria 4330
103 Ga0436364_0077046 3300037853 Bacteria 111992
104 Ga0395901_0118124 3300038443 Bacteria 2786
105 Ga0439436_0007139 3300041404 Bacteria 3439
106 Ga0439466_0003292 3300041411 Bacteria 6292
107 Ga0439431_0012274 3300041997 Bacteria 1966
108 Ga0439433_0001933 3300041999 Bacteria 4339
109 Ga0439442_010629 3300042002 Bacteria 1869
110 Ga0439442_011405 3300042002 Bacteria 1810
111 Ga0439445_0028145 3300042004 Bacteria 1447
112 Ga0439449_0016267 3300042007 Bacteria 2795
113 Ga0439455_0006581 3300042012 Bacteria 2419
114 Ga0466969_0002295 3300044656 Bacteria 10208
115 Ga0466969_0004252 3300044656 Bacteria 7614
116 Ga0466969_0010420 3300044656 Bacteria 4927
117 Ga0466969_0071724 3300044656 Bacteria 1665
118 Ga0466969_0095889 3300044656 Bacteria 1401
119 Ga0466972_0072583 3300044658 Bacteria 1641
120 Ga0466965_0001715 3300044683 Bacteria 9013
121 Ga0466966_0002537 3300044684 Bacteria 11956
122 Ga0466966_0013286 3300044684 Bacteria 5451
123 Ga0466966_0014620 3300044684 Bacteria 5196
124 Ga0466966_0017077 3300044684 Bacteria 4800
125 Ga0466961_0009570 3300044693 Bacteria 6169
126 Ga0466961_0034618 3300044693 Bacteria 3242
127 Ga0466961_0039110 3300044693 Bacteria 3041
128 Ga0466961_0065154 3300044693 Bacteria 2315
129 Ga0466963_0037962 3300044694 Bacteria 3148
130 Ga0466963_0090287 3300044694 Bacteria 2086
131 Ga0466964_0007015 3300044706 Bacteria 4213
132 Ga0466971_0000448 3300044719 Bacteria 16110
133 Ga0466971_0000552 3300044719 Bacteria 14835
134 Ga0466970_0064561 3300044765 Bacteria 1963
135 Ga0466970_0108109 3300044765 Bacteria 1518
136 Ga0466957_0001771 3300044842 Bacteria 11368
137 Ga0466959_0002172 3300045049 Bacteria 12472
138 Ga0466959_0003206 3300045049 Bacteria 10634
139 Ga0466959_0003938 3300045049 Bacteria 9863
140 Ga0466959_0031800 3300045049 Bacteria 3905
141 Ga0466959_0049753 3300045049 Bacteria 3078
142 Ga0466958_0001894 3300045836 Bacteria 10232
143 Ga0466958_0027613 3300045836 Bacteria 3360
144 Ga0466967_0007610 3300045976 Bacteria 7833
145 Ga0466967_0030810 3300045976 Bacteria 4506
146 Ga0495592_0021075 3300046454 Bacteria 4956
147 Ga0495592_0051327 3300046454 Bacteria 3063
148 Ga0495592_0080798 3300046454 Bacteria 2351
149 Ga0495603_0035067 3300046455 Bacteria 3015
150 Ga0495629_0013765 3300046459 Bacteria 5836
151 Ga0495629_0024667 3300046459 Bacteria 4281
152 Ga0495629_0032178 3300046459 Bacteria 3714
153 Ga0495651_0000600 3300046462 Bacteria 27956
154 Ga0495651_0010256 3300046462 Bacteria 7194
155 Ga0495651_0011529 3300046462 Bacteria 6789
156 Ga0495651_0027312 3300046462 Bacteria 4445
157 Ga0495653_0026739 3300046463 Bacteria 4624
158 Ga0495653_0214603 3300046463 Bacteria 1297
159 Ga0495580_0006245 3300046472 Bacteria 9740
160 Ga0495580_0017255 3300046472 Bacteria 5405
161 Ga0495580_0020343 3300046472 Bacteria 4913
162 Ga0495580_0106071 3300046472 Bacteria 1952
163 Ga0495580_0135654 3300046472 Bacteria 1706
164 Ga0495582_0031322 3300046473 Bacteria 2923
165 Ga0495605_0016694 3300046474 Bacteria 3969
166 Ga0495662_0000556 3300046476 Bacteria 17125
167 Ga0495662_0001464 3300046476 Bacteria 11691
168 Ga0495662_0001526 3300046476 Bacteria 11498
169 Ga0495662_0039169 3300046476 Bacteria 2289
170 Ga0495664_0000557 3300046477 Bacteria 18755
171 Ga0495664_0001172 3300046477 Bacteria 13643
172 Ga0495664_0003882 3300046477 Bacteria 8156
173 Ga0495664_0105794 3300046477 Bacteria 1696
174 Ga0495594_0029367 3300046499 Bacteria 2970
175 Ga0495594_0043494 3300046499 Bacteria 2462
176 Ga0495594_0051275 3300046499 Bacteria 2271
177 Ga0495606_0056793 3300046507 Bacteria 2524
178 Ga0495608_0001185 3300046511 Bacteria 18505
179 Ga0495608_0001568 3300046511 Bacteria 16329
180 Ga0495608_0007883 3300046511 Bacteria 7484
181 Ga0495608_0008060 3300046511 Bacteria 7404
182 Ga0495610_0048518 3300046512 Bacteria 2084
183 Ga0495616_0003602 3300046513 Bacteria 9895
184 Ga0495618_0004322 3300046514 Bacteria 8746
185 Ga0495618_0046230 3300046514 Bacteria 2747
186 Ga0495620_0024558 3300046515 Bacteria 2864
187 Ga0495628_0001195 3300046516 Bacteria 23744
188 Ga0495628_0003925 3300046516 Bacteria 13253
189 Ga0495628_0019522 3300046516 Bacteria 5601
190 Ga0495628_0033655 3300046516 Bacteria 4128
191 Ga0495628_0069943 3300046516 Bacteria 2737
192 Ga0495630_0026672 3300046517 Bacteria 4279
193 Ga0495630_0045450 3300046517 Bacteria 3281
194 Ga0495631_0008842 3300046518 Bacteria 5055
195 Ga0495643_0002665 3300046522 Bacteria 13811
196 Ga0495666_0000489 3300046526 Bacteria 17605
197 Ga0495666_0001676 3300046526 Bacteria 10934
198 Ga0495666_0001841 3300046526 Bacteria 10487
199 Ga0495666_0012867 3300046526 Bacteria 4170
200 Ga0495652_0007325 3300046529 Bacteria 10175
201 Ga0495652_0029780 3300046529 Bacteria 4792
202 Ga0495652_0030070 3300046529 Bacteria 4766
203 Ga0495652_0038153 3300046529 Bacteria 4163
204 Ga0495652_0050752 3300046529 Bacteria 3545
205 Ga0495665_0009296 3300046531 Bacteria 5322
206 Ga0495665_0018734 3300046531 Bacteria 3719
207 Ga0495665_0072747 3300046531 Bacteria 1810
208 Ga0495640_0002966 3300046533 Bacteria 13660
209 Ga0495640_0005115 3300046533 Bacteria 10420
210 Ga0495640_0026879 3300046533 Bacteria 4153
211 Ga0495640_0046537 3300046533 Bacteria 3005
212 Ga0495640_0052957 3300046533 Bacteria 2784
213 Ga0495640_0058028 3300046533 Bacteria 2641
214 Ga0495586_0005371 3300046535 Bacteria 6850
215 Ga0495586_0013011 3300046535 Bacteria 4410
216 Ga0495586_0038301 3300046535 Bacteria 2574
217 Ga0495586_0061975 3300046535 Bacteria 2036
218 Ga0495586_0132617 3300046535 Bacteria 1395
219 Ga0495587_0007368 3300046536 Bacteria 7131
220 Ga0495587_0024305 3300046536 Bacteria 3715
221 Ga0495587_0080430 3300046536 Bacteria 1888
222 Ga0495609_0029103 3300046538 Bacteria 2517
223 Ga0495645_0002150 3300046543 Bacteria 13376
224 Ga0495645_0002967 3300046543 Bacteria 11481
225 Ga0495645_0010136 3300046543 Bacteria 6601
226 Ga0495645_0032751 3300046543 Bacteria 3792
227 Ga0495645_0035297 3300046543 Bacteria 3645
228 Ga0495645_0056653 3300046543 Bacteria 2846
229 Ga0495645_0084857 3300046543 Bacteria 2267
230 Ga0495645_0111113 3300046543 Bacteria 1939
231 Ga0495645_0120041 3300046543 Bacteria 1852
232 Ga0495645_0153411 3300046543 Bacteria 1598
233 Ga0495622_0009888 3300046557 Bacteria 4413
234 Ga0495667_0000947 3300046559 Bacteria 18764
235 Ga0495667_0018519 3300046559 Bacteria 4704
236 Ga0495667_0018786 3300046559 Bacteria 4666
237 Ga0495667_0043506 3300046559 Bacteria 2975
238 Ga0495667_0078807 3300046559 Bacteria 2142
239 Ga0495668_0008090 3300046616 Bacteria 6621
240 Ga0495634_0007950 3300046642 Bacteria 7911
241 Ga0495634_0012220 3300046642 Bacteria 6224
242 Ga0495634_0015738 3300046642 Bacteria 5423
243 Ga0495634_0018080 3300046642 Bacteria 5022
244 Ga0495634_0076962 3300046642 Bacteria 2189
245 Ga0495625_0023044 3300046660 Bacteria 4761
246 Ga0495625_0027579 3300046660 Bacteria 4272
247 Ga0495635_0001704 3300046663 Bacteria 14795
248 Ga0495635_0008334 3300046663 Bacteria 7239
249 Ga0495635_0011413 3300046663 Bacteria 6231
250 Ga0495635_0016862 3300046663 Bacteria 5101
251 Ga0495588_0047972 3300046674 Bacteria 2194
252 Ga0495657_0001534 3300046675 Bacteria 19852
253 Ga0495657_0008564 3300046675 Bacteria 7813
254 Ga0495657_0017849 3300046675 Bacteria 5145
255 Ga0495657_0021948 3300046675 Bacteria 4577
256 Ga0495657_0031805 3300046675 Bacteria 3685
257 Ga0495599_0012692 3300046678 Bacteria 5195
258 Ga0495599_0020627 3300046678 Bacteria 4105
259 Ga0495623_0023424 3300046679 Bacteria 3985
260 Ga0495623_0056212 3300046679 Bacteria 2477
261 Ga0495646_0011126 3300046680 Bacteria 5714
262 Ga0495646_0026796 3300046680 Bacteria 3617
263 Ga0495646_0053295 3300046680 Bacteria 2439
264 Ga0495658_0050533 3300046683 Bacteria 2353
265 Ga0495613_0003548 3300046689 Bacteria 11698
266 Ga0495613_0008741 3300046689 Bacteria 7512
267 Ga0495624_0036008 3300046690 Bacteria 3193
268 Ga0495671_0021705 3300046692 Bacteria 3369
269 Ga0495649_0035852 3300046694 Bacteria 2727
270 Ga0495589_0005688 3300046794 Bacteria 6572
271 Ga0495600_0016546 3300046809 Bacteria 4682
272 Ga0495600_0038690 3300046809 Bacteria 3104
273 Ga0495581_0002409 3300047315 Bacteria 10569
274 Ga0495581_0002624 3300047315 Bacteria 10231
275 Ga0495581_0010423 3300047315 Bacteria 5374
276 Ga0495581_0013075 3300047315 Bacteria 4812
277 Ga0495604_0000479 3300047317 Bacteria 35157
278 Ga0495604_0000621 3300047317 Bacteria 30468
279 Ga0495604_0000873 3300047317 Bacteria 25153
280 Ga0495604_0003020 3300047317 Bacteria 13454
281 Ga0495604_0020862 3300047317 Bacteria 5231
282 Ga0495674_0007623 3300047319 Bacteria 10340
283 Ga0495674_0015357 3300047319 Bacteria 7162
284 Ga0495674_0029969 3300047319 Bacteria 4950
285 Ga0495674_0033959 3300047319 Bacteria 4615
286 Ga0495674_0131825 3300047319 Bacteria 2105
287 Ga0495676_0001917 3300047321 Bacteria 18244
288 Ga0495676_0003458 3300047321 Bacteria 14293
289 Ga0495676_0035375 3300047321 Bacteria 4178
290 Ga0495676_0056408 3300047321 Bacteria 3106
291 Ga0495680_0057800 3300047322 Bacteria 2998
292 Ga0495680_0057805 3300047322 Bacteria 2998
293 Ga0495687_029648 3300047443 Bacteria 2528
294 Ga0495675_0008003 3300047444 Bacteria 6538
295 Ga0495675_0010902 3300047444 Bacteria 5696
296 Ga0495675_0021636 3300047444 Bacteria 4097
297 Ga0495675_0026146 3300047444 Bacteria 3721
298 Ga0495675_0051267 3300047444 Bacteria 2621
299 Ga0495677_0057035 3300047445 Bacteria 1443
300 Ga0495685_014889 3300047447 Bacteria 2647
301 Ga0495593_0000423 3300047673 Bacteria 23593
302 Ga0495602_0020289 3300048088 Bacteria 6570
303 Ga0495602_0025450 3300048088 Bacteria 5727
304 Ga0495602_0045612 3300048088 Bacteria 3965
305 Ga0495602_0049799 3300048088 Bacteria 3748
306 Ga0496102_0163061 3300048905 Bacteria 2097
307 Ga0496103_0031921 3300048906 Bacteria 3212
308 Ga0496105_0075947 3300048908 Bacteria 2774
309 Ga0496106_0196259 3300048909 Bacteria 1606
310 Ga0496109_0003785 3300048912 Bacteria 12625
311 Ga0496110_0005661 3300048913 Bacteria 9806
312 Ga0496112_0066081 3300048915 Bacteria 3569
313 Ga0496112_0212339 3300048915 Bacteria 1892
314 Ga0496115_0015627 3300048918 Bacteria 5762
315 Ga0496119_0000022 3300048922 Bacteria 269878
316 Ga0496119_0020175 3300048922 Bacteria 4869
317 Ga0496120_0011184 3300048923 Bacteria 6193
318 Ga0496120_0017507 3300048923 Bacteria 4643
319 Ga0496122_0064798 3300048925 Bacteria 2656
320 Ga0496126_0000026 3300048929 Bacteria 422310
321 Ga0501032_0045799 3300049569 Bacteria 2957
322 Ga0501033_0005854 3300049570 Bacteria 9662
323 Ga0501033_0006016 3300049570 Bacteria 9517
324 Ga0501033_0228852 3300049570 Bacteria 1321
325 Ga0501034_0009984 3300049571 Bacteria 9923
326 Ga0501034_0012184 3300049571 Bacteria 8893
327 Ga0501034_0062363 3300049571 Bacteria 3743
328 Ga0501036_0008092 3300049572 Bacteria 8614
329 Ga0501037_0000167 3300049573 Bacteria 61779
330 Ga0501038_0003744 3300049574 Bacteria 14160
331 Ga0501038_0008456 3300049574 Bacteria 9467
332 Ga0501038_0011637 3300049574 Bacteria 8025
333 Ga0501038_0108590 3300049574 Bacteria 2300
334 Ga0501039_0001120 3300049575 Bacteria 19696
335 Ga0501043_0009105 3300049579 Bacteria 7809
336 Ga0501043_0012202 3300049579 Bacteria 6716
337 Ga0501043_0033361 3300049579 Bacteria 4050
338 Ga0501043_0073253 3300049579 Bacteria 2690
339 Ga0501047_0008226 3300049581 Bacteria 9847
340 Ga0501047_0009854 3300049581 Bacteria 9029
341 Ga0501070_0002952 3300049586 Bacteria 14811
342 Ga0501070_0008490 3300049586 Bacteria 8680
343 Ga0501073_0025319 3300049589 Bacteria 4257
344 Ga0501035_0022555 3300049822 Bacteria 5782
345 Ga0501035_0022732 3300049822 Bacteria 5759
346 Ga0501035_0055143 3300049822 Bacteria 3549
347 Ga0501035_0075390 3300049822 Bacteria 2983
348 Ga0501035_0086196 3300049822 Bacteria 2767
349 Ga0501044_0008716 3300049823 Bacteria 11101
350 Ga0501044_0060804 3300049823 Bacteria 3866
351 Ga0501044_0095233 3300049823 Bacteria 3000
352 Ga0501045_0186722 3300049824 Bacteria 1545
353 Ga0501045_0197155 3300049824 Bacteria 1500
354 nmdc:mga06z11_24239_c1 3300050494 Bacteria 2859
355 Ga0495601_0016663 3300053077 Bacteria 4455
356 Ga0495601_0019775 3300053077 Bacteria 4110
357 Ga0495601_0023564 3300053077 Bacteria 3783
358 Ga0495612_0000466 3300053078 Bacteria 16236
359 Ga0495619_0067377 3300053085 Bacteria 2390
360 Ga0495619_0076198 3300053085 Bacteria 2251
361 Ga0500640_003236 3300053095 Bacteria 5629
362 Ga0500572_008402 3300053111 Bacteria 2412
363 Ga0500559_0053679 3300053136 Bacteria 1784
364 Ga0500568_0000050 3300053139 Bacteria 115722
365 Ga0500573_0014364 3300053140 Bacteria 4480
366 Ga0500616_0000755 3300053153 Bacteria 37233
367 Ga0466962_0017012 3300061719 Bacteria 3502
368 Ga0466962_0031081 3300061719 Bacteria 2556
369 2506866995 2506783011 Bacteria 5323186
370 2528205008 2527291627 Bacteria 5309833
371 2528215251 2527291629 Bacteria 5267418
372 2546950347 2546825537 Bacteria 5389291
373 2548697826 2547132424 Bacteria 8348532
374 2579748689 2576861822 Bacteria 5004595
375 2585305910 2582581313 Bacteria 10042643
376 2585312506 2582581314 Bacteria 11452267
377 2616693272 2616644814 Bacteria 11555299
378 2644182063 2643221632 Bacteria 3406696
379 2644270189 2643221647 Bacteria 10741251
380 2686542258 2684623036 Bacteria 5199090
381 2689961259 2687453737 Bacteria 11203906
382 2710603924 2710264753 Bacteria 5455564
383 2774866185 2773857924 Bacteria 5256821
384 2774903654 2773857933 Bacteria 5818019
385 2785373833 2784746768 Bacteria 10036182
386 2786667299 2786546132 Bacteria 10419719
387 2812360907 2811994879 Bacteria 9313447
388 2819743388 2818991472 Bacteria 10089953
389 2819745983 2818991472 Bacteria 10089953
390 2842139279 2842134933 Bacteria 5847019
391 2844844148 2844841374 Bacteria 3917147
392 2862182156 2862178590 Bacteria 8583590
393 2862283502 2862281513 Bacteria 9621493
394 2877677025 2877676314 Bacteria 9512378
395 2899370819 2899370129 Bacteria 6781179
396 2912728311 2912723979 Bacteria 8557534
397 2917737931 2917736166 Bacteria 9690793
398 2917742260 2917736166 Bacteria 9690793
399 2917743690 2917736166 Bacteria 9690793
400 2919056090 2919055335 Bacteria 3875751
401 2919715987 2919713450 Bacteria 7431245
402 2928154230 2928153084 Bacteria 4020257
403 2946064963 2946064051 Bacteria 8957905
404 2947232464 2947224130 Bacteria 9938529
405 2954389513 2954380949 Bacteria 10050426
406 2954682387 2954673503 Bacteria 9685905
407 2954690537 2954682443 Bacteria 9862841
408 2954700290 2954691527 Bacteria 10720516
409 2954701939 2954701450 Bacteria 10834262
410 2995470329 2995463766 Bacteria 8577691
411 2995471332 2995463766 Bacteria 8577691
412 637880727 637000116 Bacteria 5433628
413 8003317065 8003314358 Bacteria 10575343
414 8054165411 8054160619 Bacteria 7783213
415 8054165597 8054160619 Bacteria 7783213
416 8056834783 8056829672 Bacteria 9045328
417 JGI24737J22298_10014833
418 rootL2_10010584
419 rootL2_10014657
420 rootH1_10100537
421 Ga0006562J51391_1046577
422 Ga0006562J51391_1046578
423 Ga0070709_10061771
424 Ga0070709_10063246
425 Ga0070709_10065517
426 Ga0070714_100001065
427 Ga0070714_100001183
428 Ga0070714_100057425
429 Ga0070714_100087977
430 Ga0070714_100124020
431 Ga0070714_100220875
432 Ga0070713_100009114
433 Ga0070710_10010732
434 Ga0070710_10166370
435 Ga0070711_100081869
436 Ga0070711_100131818
437 Ga0070663_100001305
438 Ga0070707_100011841
439 Ga0070665_100385975
440 Ga0068854_100062386
441 Ga0068856_100079822
442 Ga0068859_100005051
443 Ga0081539_10000162
444 Ga0070717_10075855
445 Ga0070712_100058233
446 Ga0070712_100061828
447 Ga0075367_10001344
448 Ga0097620_100005051
449 Ga0099826_10020909
450 Ga0105240_10132051
451 Ga0105240_10175056
452 Ga0105247_10000489
453 Ga0105248_10002242
454 Ga0105237_10056082
455 Ga0105246_10020122
456 Ga0157372_10116671
457 Ga0157372_10166439
458 Ga0182008_10002910
459 Ga0157379_10093419
460 Ga0182007_10001534
461 Ga0213875_10000281
462 Ga0209455_1002024
463 Ga0207426_1000707
464 Ga0207692_10008237
465 Ga0207710_10000262
466 Ga0207699_10144786
467 Ga0207695_10060852
468 Ga0207695_10071981
469 Ga0207693_10021406
470 Ga0207693_10145816
471 Ga0207663_10080568
472 Ga0207646_10016692
473 Ga0207700_10171711
474 Ga0207664_10007861
475 Ga0207664_10023409
476 Ga0207664_10058970
477 Ga0207711_10037420
478 Ga0207668_10002912
479 Ga0207678_10001335
480 Ga0207708_10070003
481 Ga0207702_10059882
482 Ga0268266_10186120
483 Ga0307517_10005158
484 Ga0307515_10000657
485 Ga0307515_10021555
486 Ga0307511_10000237
487 Ga0307511_10004979
488 Ga0307511_10013357
489 Ga0307511_10028993
490 Ga0265340_10002026
491 Ga0265327_10000001
492 Ga0265327_10001316
493 Ga0307509_10017732
494 Ga0307509_10037147
495 Ga0307509_10040642
496 Ga0307509_10105796
497 Ga0307509_10120454
498 Ga0307508_10002627
499 Ga0307516_10009119
500 Ga0307413_10000726
501 Ga0307518_10078908
502 Ga0307410_10118094
503 Ga0307507_10000020
504 Ga0307507_10014421
505 Ga0307507_10059831
506 Ga0307507_10076674
507 Ga0307510_10017246
508 Ga0307510_10023440
509 Ga0373950_0001582
510 Ga0373938_0004621
511 Ga0373942_0000040
512 Ga0373924_0037861
513 Ga0373937_0134896
514 Ga0373925_0021562
515 Ga0395900_0019108
516 Ga0395900_0047878
517 Ga0395898_0004999
518 Ga0395898_0045193
519 Ga0436364_0077046
520 Ga0395901_0118124
521 Ga0439436_0007139
522 Ga0439466_0003292
523 Ga0439431_0012274
524 Ga0439433_0001933
525 Ga0439442_010629
526 Ga0439442_011405
527 Ga0439445_0028145
528 Ga0439449_0016267
529 Ga0439455_0006581
530 Ga0466969_0002295
531 Ga0466969_0004252
532 Ga0466969_0010420
533 Ga0466969_0071724
534 Ga0466969_0095889
535 Ga0466972_0072583
536 Ga0466965_0001715
537 Ga0466966_0002537
538 Ga0466966_0013286
539 Ga0466966_0014620
540 Ga0466966_0017077
541 Ga0466961_0009570
542 Ga0466961_0034618
543 Ga0466961_0039110
544 Ga0466961_0065154
545 Ga0466963_0037962
546 Ga0466963_0090287
547 Ga0466964_0007015
548 Ga0466971_0000448
549 Ga0466971_0000552
550 Ga0466970_0064561
551 Ga0466970_0108109
552 Ga0466957_0001771
553 Ga0466959_0002172
554 Ga0466959_0003206
555 Ga0466959_0003938
556 Ga0466959_0031800
557 Ga0466959_0049753
558 Ga0466958_0001894
559 Ga0466958_0027613
560 Ga0466967_0007610
561 Ga0466967_0030810
562 Ga0495592_0021075
563 Ga0495592_0051327
564 Ga0495592_0080798
565 Ga0495603_0035067
566 Ga0495629_0013765
567 Ga0495629_0024667
568 Ga0495629_0032178
569 Ga0495651_0000600
570 Ga0495651_0010256
571 Ga0495651_0011529
572 Ga0495651_0027312
573 Ga0495653_0026739
574 Ga0495653_0214603
575 Ga0495580_0006245
576 Ga0495580_0017255
577 Ga0495580_0020343
578 Ga0495580_0106071
579 Ga0495580_0135654
580 Ga0495582_0031322
581 Ga0495605_0016694
582 Ga0495662_0000556
583 Ga0495662_0001464
584 Ga0495662_0001526
585 Ga0495662_0039169
586 Ga0495664_0000557
587 Ga0495664_0001172
588 Ga0495664_0003882
589 Ga0495664_0105794
590 Ga0495594_0029367
591 Ga0495594_0043494
592 Ga0495594_0051275
593 Ga0495606_0056793
594 Ga0495608_0001185
595 Ga0495608_0001568
596 Ga0495608_0007883
597 Ga0495608_0008060
598 Ga0495610_0048518
599 Ga0495616_0003602
600 Ga0495618_0004322
601 Ga0495618_0046230
602 Ga0495620_0024558
603 Ga0495628_0001195
604 Ga0495628_0003925
605 Ga0495628_0019522
606 Ga0495628_0033655
607 Ga0495628_0069943
608 Ga0495630_0026672
609 Ga0495630_0045450
610 Ga0495631_0008842
611 Ga0495643_0002665
612 Ga0495666_0000489
613 Ga0495666_0001676
614 Ga0495666_0001841
615 Ga0495666_0012867
616 Ga0495652_0007325
617 Ga0495652_0029780
618 Ga0495652_0030070
619 Ga0495652_0038153
620 Ga0495652_0050752
621 Ga0495665_0009296
622 Ga0495665_0018734
623 Ga0495665_0072747
624 Ga0495640_0002966
625 Ga0495640_0005115
626 Ga0495640_0026879
627 Ga0495640_0046537
628 Ga0495640_0052957
629 Ga0495640_0058028
630 Ga0495586_0005371
631 Ga0495586_0013011
632 Ga0495586_0038301
633 Ga0495586_0061975
634 Ga0495586_0132617
635 Ga0495587_0007368
636 Ga0495587_0024305
637 Ga0495587_0080430
638 Ga0495609_0029103
639 Ga0495645_0002150
640 Ga0495645_0002967
641 Ga0495645_0010136
642 Ga0495645_0032751
643 Ga0495645_0035297
644 Ga0495645_0056653
645 Ga0495645_0084857
646 Ga0495645_0111113
647 Ga0495645_0120041
648 Ga0495645_0153411
649 Ga0495622_0009888
650 Ga0495667_0000947
651 Ga0495667_0018519
652 Ga0495667_0018786
653 Ga0495667_0043506
654 Ga0495667_0078807
655 Ga0495668_0008090
656 Ga0495634_0007950
657 Ga0495634_0012220
658 Ga0495634_0015738
659 Ga0495634_0018080
660 Ga0495634_0076962
661 Ga0495625_0023044
662 Ga0495625_0027579
663 Ga0495635_0001704
664 Ga0495635_0008334
665 Ga0495635_0011413
666 Ga0495635_0016862
667 Ga0495588_0047972
668 Ga0495657_0001534
669 Ga0495657_0008564
670 Ga0495657_0017849
671 Ga0495657_0021948
672 Ga0495657_0031805
673 Ga0495599_0012692
674 Ga0495599_0020627
675 Ga0495623_0023424
676 Ga0495623_0056212
677 Ga0495646_0011126
678 Ga0495646_0026796
679 Ga0495646_0053295
680 Ga0495658_0050533
681 Ga0495613_0003548
682 Ga0495613_0008741
683 Ga0495624_0036008
684 Ga0495671_0021705
685 Ga0495649_0035852
686 Ga0495589_0005688
687 Ga0495600_0016546
688 Ga0495600_0038690
689 Ga0495581_0002409
690 Ga0495581_0002624
691 Ga0495581_0010423
692 Ga0495581_0013075
693 Ga0495604_0000479
694 Ga0495604_0000621
695 Ga0495604_0000873
696 Ga0495604_0003020
697 Ga0495604_0020862
698 Ga0495674_0007623
699 Ga0495674_0015357
700 Ga0495674_0029969
701 Ga0495674_0033959
702 Ga0495674_0131825
703 Ga0495676_0001917
704 Ga0495676_0003458
705 Ga0495676_0035375
706 Ga0495676_0056408
707 Ga0495680_0057800
708 Ga0495680_0057805
709 Ga0495687_029648
710 Ga0495675_0008003
711 Ga0495675_0010902
712 Ga0495675_0021636
713 Ga0495675_0026146
714 Ga0495675_0051267
715 Ga0495677_0057035
716 Ga0495685_014889
717 Ga0495593_0000423
718 Ga0495602_0020289
719 Ga0495602_0025450
720 Ga0495602_0045612
721 Ga0495602_0049799
722 Ga0496102_0163061
723 Ga0496103_0031921
724 Ga0496105_0075947
725 Ga0496106_0196259
726 Ga0496109_0003785
727 Ga0496110_0005661
728 Ga0496112_0066081
729 Ga0496112_0212339
730 Ga0496115_0015627
731 Ga0496119_0000022
732 Ga0496119_0020175
733 Ga0496120_0011184
734 Ga0496120_0017507
735 Ga0496122_0064798
736 Ga0496126_0000026
737 Ga0501032_0045799
738 Ga0501033_0005854
739 Ga0501033_0006016
740 Ga0501033_0228852
741 Ga0501034_0009984
742 Ga0501034_0012184
743 Ga0501034_0062363
744 Ga0501036_0008092
745 Ga0501037_0000167
746 Ga0501038_0003744
747 Ga0501038_0008456
748 Ga0501038_0011637
749 Ga0501038_0108590
750 Ga0501039_0001120
751 Ga0501043_0009105
752 Ga0501043_0012202
753 Ga0501043_0033361
754 Ga0501043_0073253
755 Ga0501047_0008226
756 Ga0501047_0009854
757 Ga0501070_0002952
758 Ga0501070_0008490
759 Ga0501073_0025319
760 Ga0501035_0022555
761 Ga0501035_0022732
762 Ga0501035_0055143
763 Ga0501035_0075390
764 Ga0501035_0086196
765 Ga0501044_0008716
766 Ga0501044_0060804
767 Ga0501044_0095233
768 Ga0501045_0186722
769 Ga0501045_0197155
770 nmdc:mga06z11_24239_c1
771 Ga0495601_0016663
772 Ga0495601_0019775
773 Ga0495601_0023564
774 Ga0495612_0000466
775 Ga0495619_0067377
776 Ga0495619_0076198
777 Ga0500640_003236
778 Ga0500572_008402
779 Ga0500559_0053679
780 Ga0500568_0000050
781 Ga0500573_0014364
782 Ga0500616_0000755
783 Ga0466962_0017012
784 Ga0466962_0031081
785 2506866995
786 2528205008
787 2528215251
788 2546950347
789 2548697826
790 2579748689
791 2585305910
792 2585312506
793 2616693272
794 2644182063
795 2644270189
796 2686542258
797 2689961259
798 2710603924
799 2774866185
800 2774903654
801 2785373833
802 2786667299
803 2812360907
804 2819743388
805 2819745983
806 2842139279
807 2844844148
808 2862182156
809 2862283502
810 2877677025
811 2899370819
812 2912728311
813 2917737931
814 2917742260
815 2917743690
816 2919056090
817 2919715987
818 2928154230
819 2946064963
820 2947232464
821 2954389513
822 2954682387
823 2954690537
824 2954700290
825 2954701939
826 2995470329
827 2995471332
828 637880727
829 8003317065
830 8054165411
831 8054165597
832 8056834783

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04261

Dyp_perox_N

Dyp-type peroxidase, N-terminal

98

250

0.97

PF20628

Dyp_perox_C

Dyp-type peroxidase, C-terminal

258

441

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2y4f-assembly1.cif.gz_B x-ray crystallographic structure of e. coli heme-efeb 0.9533 60 412
3o72-assembly2.cif.gz_D crystal structure of efeb in complex with heme 0.9463 55 410
6jbn-assembly2.cif.gz_B crystal structure of sphingomonas sp. a1 peroxidase efeb responsible for import of iron 0.9371 56 411
2y4d-assembly1.cif.gz_B x-ray crystallographic structure of e. coli apo-efeb 0.929 56 412
8rgy-assembly1.cif.gz_B serial synchrotron in plate room temperature structure of dye type peroxidase aa, 8 drops merged 0.9133 59 410
ID Description Score Start End Superfamily
af_Q58127_5_119_3.90.1170.40 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.8434 169 194 3.90.1170.40
3f56B01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;BMC (bacterial microcompartment) domain 0.7747 169 193 3.30.70.1710
af_Q7ZUW8_47_325_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.7618 169 194 3.40.640.10
5loqB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Apc35880; domain 1 0.7065 77 208 3.30.70.1030
1vdhA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Apc35880; domain 1 0.6832 73 206 3.30.70.1030
ID Description Score Start End GO Terms
AF-A0A6B2VFJ8-F1-model_v4 Dyp-type peroxidase 0.9816 123 410 GO:0004601
GO:0005829
GO:0020037
GO:0046872
AF-A0A1X0MLJ8-F1-model_v4 Peroxidase 0.9813 249 411 GO:0004601
GO:0005829
GO:0020037
GO:0046872
AF-A0A6N8NM79-F1-model_v4 Dyp-type peroxidase 0.9767 261 410 GO:0004601
GO:0005829
GO:0020037
GO:0046872
AF-W1EYV2-F1-model_v4 Ferrous iron transport peroxidase EfeB 0.9759 241 410 GO:0004601
GO:0005829
GO:0020037
GO:0046872
AF-A0A1H6ANK1-F1-model_v4 Deferrochelatase/peroxidase EfeB 0.9757 297 410 GO:0004601
GO:0005829
GO:0020037
GO:0046872

Map