F438758

General Info

Members Datasets Scaffolds Average Seq Length
416 211 832 238

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10009699|Ga0081539_100096999
Length 283
Sequence MDLPYRGAIALPVASREGRERFDAEWAGRYATRLRASCDNQTNTGIRLRNNMHPIKKAARIAGAIYLTMVFTAPFSLLYVPGKLIVRGNATATADNILAHETMFQLSIFGDLIGQVIFICLAIALYRLLSNVNKTWAALMVALVLVSAAVGFLNTLNNIAALILFQGNELLTVFDKPQRDALAMLFLRLHTHGIFIDELFWGLWLYPFGLLVFRSGFLPRWIGVWLMINCFGYVILSAIALFAPDYYGAAFKYSQPVLFGELATMLYLLIRGANVKALPSKVG

Samples

Sample ID Description Type Environment
1 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
151 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
152 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
153 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
156 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
157 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
163 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
164 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
165 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
168 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
169 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
170 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
171 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
172 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
173 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
174 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
177 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
178 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
179 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
180 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
181 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
183 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
184 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
185 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
186 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
187 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
188 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
189 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
192 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
193 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
209 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
210 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
211 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.05
Rhizosphere 94.95
Stem 0
Stem Tuber 0
Unclassified 33.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081539_10009699 3300005985 Bacteria 7973
2 JGI24737J22298_10024962 3300001990 Unclassified 1891
3 JGI24035J26624_1001332 3300002126 Bacteria 2341
4 JGI24035J26624_1012018 3300002126 Bacteria 870
5 JGI25404J52841_10017214 3300003659 Bacteria 1568
6 JGI25405J52794_10000111 3300003911 Bacteria 9453
7 Ga0065714_10170044 3300005288 Unclassified 1009
8 Ga0065712_10004570 3300005290 Bacteria 4287
9 Ga0065712_10006466 3300005290 Unclassified 3675
10 Ga0065712_10098394 3300005290 Bacteria 2120
11 Ga0065712_10151630 3300005290 Unclassified 1347
12 Ga0065712_10292611 3300005290 Bacteria 874
13 Ga0065715_10006498 3300005293 Bacteria 9969
14 Ga0065715_10009934 3300005293 Bacteria 5271
15 Ga0065715_10010446 3300005293 Bacteria 2820
16 Ga0065715_10139503 3300005293 Bacteria 1818
17 Ga0065715_10175736 3300005293 Bacteria 1513
18 Ga0065707_10181001 3300005295 Bacteria 1406
19 Ga0070658_10691766 3300005327 Bacteria 885
20 Ga0070676_10033463 3300005328 Unclassified 2949
21 Ga0070683_100125062 3300005329 Bacteria 2431
22 Ga0070683_100431756 3300005329 Bacteria 1257
23 Ga0070690_100012328 3300005330 Bacteria 5028
24 Ga0070670_100066491 3300005331 Bacteria 3093
25 Ga0070670_100379269 3300005331 Unclassified 1246
26 Ga0068869_100065611 3300005334 Unclassified 2673
27 Ga0070666_10073979 3300005335 Unclassified 2321
28 Ga0070666_10178679 3300005335 Bacteria 1488
29 Ga0070666_10214080 3300005335 Unclassified 1358
30 Ga0070680_100640763 3300005336 Bacteria 913
31 Ga0070682_100041639 3300005337 Unclassified 2832
32 Ga0068868_100007349 3300005338 Bacteria 7844
33 Ga0068868_100464853 3300005338 Unclassified 1103
34 Ga0070660_100043663 3300005339 Unclassified 3427
35 Ga0070689_100052291 3300005340 Bacteria 3159
36 Ga0070689_100119775 3300005340 Bacteria 2101
37 Ga0070689_100823375 3300005340 Bacteria 817
38 Ga0070687_100009612 3300005343 Bacteria 4150
39 Ga0070661_100095367 3300005344 Bacteria 2206
40 Ga0070661_100350320 3300005344 Bacteria 1158
41 Ga0070668_100200152 3300005347 Unclassified 1639
42 Ga0070668_100213369 3300005347 Bacteria 1589
43 Ga0070668_100618449 3300005347 Unclassified 949
44 Ga0070669_100202390 3300005353 Bacteria 1563
45 Ga0070669_100514162 3300005353 Bacteria 995
46 Ga0070675_100011574 3300005354 Bacteria 6910
47 Ga0070675_100031973 3300005354 Bacteria 4256
48 Ga0070675_100059644 3300005354 Unclassified 3148
49 Ga0070675_100131805 3300005354 Unclassified 2131
50 Ga0070671_100155046 3300005355 Bacteria 1935
51 Ga0070671_100351712 3300005355 Bacteria 1257
52 Ga0070671_100480497 3300005355 Bacteria 1067
53 Ga0070674_100122160 3300005356 Unclassified 1929
54 Ga0070673_100063221 3300005364 Bacteria 2944
55 Ga0070673_100328975 3300005364 Bacteria 1351
56 Ga0070673_100492244 3300005364 Unclassified 1108
57 Ga0070688_100005363 3300005365 Bacteria 6743
58 Ga0070688_100057588 3300005365 Bacteria 2443
59 Ga0070688_100180462 3300005365 Bacteria 1464
60 Ga0070688_100603298 3300005365 Unclassified 840
61 Ga0070659_100005281 3300005366 Bacteria 9270
62 Ga0070667_100078092 3300005367 Bacteria 2828
63 Ga0070667_100113704 3300005367 Bacteria 2350
64 Ga0070709_10319825 3300005434 Bacteria 1138
65 Ga0070709_10452457 3300005434 Bacteria 968
66 Ga0070714_100403348 3300005435 Bacteria 1293
67 Ga0070713_100639441 3300005436 Bacteria 1013
68 Ga0070710_10056406 3300005437 Bacteria 2222
69 Ga0070710_10174279 3300005437 Bacteria 1342
70 Ga0070701_10098730 3300005438 Unclassified 1613
71 Ga0070711_100040968 3300005439 Bacteria 3126
72 Ga0070711_100099055 3300005439 Bacteria 2117
73 Ga0070711_100158154 3300005439 Bacteria 1715
74 Ga0070711_100166368 3300005439 Unclassified 1677
75 Ga0070705_100044227 3300005440 Bacteria 2557
76 Ga0070705_100111686 3300005440 Bacteria 1748
77 Ga0070700_100006653 3300005441 Bacteria 6191
78 Ga0070694_100166500 3300005444 Unclassified 1621
79 Ga0070708_100061425 3300005445 Bacteria 3357
80 Ga0070708_100178082 3300005445 Unclassified 1987
81 Ga0070708_100225478 3300005445 Bacteria 1758
82 Ga0070708_100317054 3300005445 Bacteria 1469
83 Ga0070708_100368688 3300005445 Unclassified 1354
84 Ga0070708_100690025 3300005445 Unclassified 961
85 Ga0070663_100021881 3300005455 Bacteria 4262
86 Ga0070663_100439875 3300005455 Unclassified 1073
87 Ga0070678_100051937 3300005456 Bacteria 2974
88 Ga0070678_100091693 3300005456 Bacteria 2332
89 Ga0070678_100695301 3300005456 Bacteria 916
90 Ga0070662_100289038 3300005457 Bacteria 1329
91 Ga0070662_100355919 3300005457 Bacteria 1200
92 Ga0070662_100531451 3300005457 Bacteria 984
93 Ga0068867_100567463 3300005459 Bacteria 985
94 Ga0068867_100675708 3300005459 Bacteria 909
95 Ga0070685_10027962 3300005466 Unclassified 3122
96 Ga0070685_10101126 3300005466 Bacteria 1761
97 Ga0070685_10143354 3300005466 Bacteria 1507
98 Ga0070706_100011488 3300005467 Bacteria 8231
99 Ga0070706_100029583 3300005467 Bacteria 5046
100 Ga0070706_100081998 3300005467 Bacteria 2988
101 Ga0070706_100262791 3300005467 Unclassified 1611
102 Ga0070706_100328615 3300005467 Unclassified 1426
103 Ga0070706_100339885 3300005467 Unclassified 1400
104 Ga0070707_100134017 3300005468 Unclassified 2410
105 Ga0070707_100297008 3300005468 Unclassified 1570
106 Ga0070707_100392588 3300005468 Bacteria 1348
107 Ga0070699_100152192 3300005518 Unclassified 2047
108 Ga0070679_100405017 3300005530 Bacteria 1310
109 Ga0070684_100002361 3300005535 Bacteria 13918
110 Ga0070684_100061129 3300005535 Bacteria 3296
111 Ga0070684_100070672 3300005535 Bacteria 3072
112 Ga0070697_100026397 3300005536 Bacteria 4639
113 Ga0070697_100045950 3300005536 Bacteria 3539
114 Ga0070697_100585985 3300005536 Unclassified 979
115 Ga0070672_100189515 3300005543 Bacteria 1716
116 Ga0070672_100234186 3300005543 Bacteria 1543
117 Ga0070695_100217235 3300005545 Bacteria 1376
118 Ga0070695_100674262 3300005545 Bacteria 818
119 Ga0070696_100242690 3300005546 Bacteria 1360
120 Ga0070696_100303860 3300005546 Unclassified 1223
121 Ga0070693_100138470 3300005547 Unclassified 1529
122 Ga0070665_100021348 3300005548 Bacteria 6513
123 Ga0070665_100065140 3300005548 Unclassified 3655
124 Ga0070665_100097449 3300005548 Unclassified 2946
125 Ga0070665_100146118 3300005548 Unclassified 2367
126 Ga0070665_100425839 3300005548 Unclassified 1336
127 Ga0070664_100048860 3300005564 Bacteria 3577
128 Ga0070664_100221008 3300005564 Bacteria 1695
129 Ga0070664_100290578 3300005564 Unclassified 1476
130 Ga0070664_100370569 3300005564 Unclassified 1305
131 Ga0068856_100606666 3300005614 Bacteria 1115
132 Ga0070702_100220019 3300005615 Unclassified 1269
133 Ga0068859_100424476 3300005617 Unclassified 1426
134 Ga0068864_100056642 3300005618 Bacteria 3386
135 Ga0068864_100441516 3300005618 Bacteria 1243
136 Ga0068861_100661301 3300005719 Unclassified 966
137 Ga0068863_100268655 3300005841 Unclassified 1650
138 Ga0068858_100308593 3300005842 Unclassified 1510
139 Ga0068860_100017567 3300005843 Bacteria 6970
140 Ga0068860_100371331 3300005843 Bacteria 1411
141 Ga0081455_10001366 3300005937 Bacteria 30129
142 Ga0081455_10004364 3300005937 Bacteria 15925
143 Ga0081455_10017429 3300005937 Bacteria 6886
144 Ga0081455_10041902 3300005937 Bacteria 4022
145 Ga0081455_10108670 3300005937 Bacteria 2208
146 Ga0081455_10157431 3300005937 Unclassified 1744
147 Ga0081455_10340664 3300005937 Bacteria 1061
148 Ga0081540_1130133 3300005983 Unclassified 1029
149 Ga0081539_10004703 3300005985 Bacteria 14799
150 Ga0081539_10075116 3300005985 Bacteria 1797
151 Ga0081539_10084484 3300005985 Bacteria 1659
152 Ga0070717_10118166 3300006028 Bacteria 2268
153 Ga0070717_10228259 3300006028 Bacteria 1638
154 Ga0070717_10444798 3300006028 Bacteria 1167
155 Ga0070717_10651977 3300006028 Bacteria 956
156 Ga0070715_10039118 3300006163 Bacteria 1973
157 Ga0070715_10046725 3300006163 Unclassified 1842
158 Ga0070716_100072857 3300006173 Bacteria 2024
159 Ga0070716_100074168 3300006173 Bacteria 2009
160 Ga0070712_100030073 3300006175 Bacteria 3646
161 Ga0070712_100126438 3300006175 Unclassified 1931
162 Ga0070712_100317819 3300006175 Bacteria 1265
163 Ga0097621_100056566 3300006237 Bacteria 3205
164 Ga0097621_100187142 3300006237 Bacteria 1791
165 Ga0068871_100098531 3300006358 Bacteria 2446
166 Ga0075428_100166016 3300006844 Unclassified 2395
167 Ga0075434_100330187 3300006871 Bacteria 1546
168 Ga0068865_100329778 3300006881 Bacteria 1230
169 Ga0097620_100424474 3300006931 Unclassified 1426
170 Ga0075435_100277435 3300007076 Bacteria 1430
171 Ga0105240_10268257 3300009093 Bacteria 1966
172 Ga0111539_10706297 3300009094 Bacteria 1174
173 Ga0111539_11160509 3300009094 Unclassified 897
174 Ga0105245_10545210 3300009098 Unclassified 1181
175 Ga0105245_10558353 3300009098 Bacteria 1167
176 Ga0105245_10621825 3300009098 Bacteria 1108
177 Ga0105247_10271070 3300009101 Unclassified 1167
178 Ga0114129_10002187 3300009147 Bacteria 26922
179 Ga0114129_10377909 3300009147 Bacteria 1872
180 Ga0114129_10486961 3300009147 Unclassified 1613
181 Ga0105243_10025239 3300009148 Bacteria 4539
182 Ga0105242_10415303 3300009176 Bacteria 1259
183 Ga0105248_10230852 3300009177 Unclassified 2083
184 Ga0105248_10357486 3300009177 Bacteria 1644
185 Ga0105237_10079682 3300009545 Unclassified 3265
186 Ga0105249_10072348 3300009553 Bacteria 3187
187 Ga0105249_10475421 3300009553 Bacteria 1292
188 Ga0157369_10101441 3300013105 Bacteria 3067
189 Ga0157374_10034120 3300013296 Bacteria 4646
190 Ga0157374_10091673 3300013296 Unclassified 2898
191 Ga0157374_10167954 3300013296 Bacteria 2139
192 Ga0157374_10200939 3300013296 Unclassified 1952
193 Ga0157374_10280657 3300013296 Bacteria 1644
194 Ga0157374_10417758 3300013296 Unclassified 1340
195 Ga0157374_10881305 3300013296 Bacteria 912
196 Ga0157378_10011822 3300013297 Bacteria 7641
197 Ga0157378_10107671 3300013297 Bacteria 2551
198 Ga0157378_10141336 3300013297 Bacteria 2235
199 Ga0157378_10168710 3300013297 Bacteria 2051
200 Ga0157378_10245581 3300013297 Bacteria 1712
201 Ga0157378_10350464 3300013297 Unclassified 1442
202 Ga0157378_10407432 3300013297 Unclassified 1341
203 Ga0163162_10051806 3300013306 Bacteria 4120
204 Ga0163162_10062776 3300013306 Bacteria 3756
205 Ga0163162_10161949 3300013306 Unclassified 2359
206 Ga0163162_10239794 3300013306 Unclassified 1944
207 Ga0163162_10329492 3300013306 Bacteria 1659
208 Ga0157372_10173506 3300013307 Unclassified 2495
209 Ga0157372_10280888 3300013307 Unclassified 1936
210 Ga0157375_10083932 3300013308 Unclassified 3232
211 Ga0157375_10418773 3300013308 Unclassified 1505
212 Ga0157375_10525447 3300013308 Bacteria 1346
213 Ga0163163_10133022 3300014325 Bacteria 2527
214 Ga0163163_10249896 3300014325 Unclassified 1824
215 Ga0163163_10491968 3300014325 Unclassified 1288
216 Ga0157380_10556077 3300014326 Bacteria 1127
217 Ga0157377_10317914 3300014745 Unclassified 1033
218 Ga0157379_10005223 3300014968 Bacteria 11149
219 Ga0157376_10062461 3300014969 Bacteria 3134
220 Ga0157376_10139062 3300014969 Bacteria 2176
221 Ga0157376_10206838 3300014969 Bacteria 1809
222 Ga0157376_10225255 3300014969 Unclassified 1739
223 Ga0157376_10225540 3300014969 Bacteria 1738
224 Ga0157376_10434685 3300014969 Bacteria 1276
225 Ga0157376_10596350 3300014969 Unclassified 1099
226 Ga0163161_10389006 3300017792 Bacteria 1116
227 Ga0163161_10473237 3300017792 Bacteria 1016
228 Ga0207673_1006949 3300025290 Unclassified 1410
229 Ga0207673_1009071 3300025290 Unclassified 1266
230 Ga0207697_10000515 3300025315 Bacteria 21787
231 Ga0207697_10003228 3300025315 Bacteria 8107
232 Ga0207697_10015400 3300025315 Unclassified 3161
233 Ga0207697_10020073 3300025315 Bacteria 2737
234 Ga0207697_10052137 3300025315 Bacteria 1692
235 Ga0207697_10052387 3300025315 Bacteria 1688
236 Ga0207697_10129016 3300025315 Bacteria 1092
237 Ga0207653_10018959 3300025885 Bacteria 2168
238 Ga0207692_10078688 3300025898 Bacteria 1757
239 Ga0207692_10109642 3300025898 Bacteria 1529
240 Ga0207692_10213513 3300025898 Unclassified 1141
241 Ga0207680_10033013 3300025903 Bacteria 2948
242 Ga0207680_10192456 3300025903 Bacteria 1385
243 Ga0207680_10453327 3300025903 Unclassified 910
244 Ga0207680_10514820 3300025903 Unclassified 853
245 Ga0207647_10008375 3300025904 Bacteria 7418
246 Ga0207645_10009561 3300025907 Bacteria 6698
247 Ga0207645_10261270 3300025907 Unclassified 1147
248 Ga0207705_10656347 3300025909 Unclassified 816
249 Ga0207684_10004597 3300025910 Bacteria 12966
250 Ga0207684_10013804 3300025910 Bacteria 6977
251 Ga0207684_10240710 3300025910 Unclassified 1561
252 Ga0207707_10361330 3300025912 Unclassified 1250
253 Ga0207671_10079208 3300025914 Bacteria 2461
254 Ga0207693_10041132 3300025915 Unclassified 3640
255 Ga0207693_10041562 3300025915 Unclassified 3619
256 Ga0207693_10084880 3300025915 Bacteria 2481
257 Ga0207693_10176398 3300025915 Bacteria 1682
258 Ga0207693_10186210 3300025915 Bacteria 1634
259 Ga0207693_10301601 3300025915 Bacteria 1255
260 Ga0207663_10007359 3300025916 Bacteria 5705
261 Ga0207663_10070797 3300025916 Unclassified 2248
262 Ga0207663_10179569 3300025916 Bacteria 1510
263 Ga0207657_10073861 3300025919 Bacteria 2881
264 Ga0207649_10179634 3300025920 Bacteria 1480
265 Ga0207649_10211930 3300025920 Bacteria 1375
266 Ga0207646_10174601 3300025922 Unclassified 1941
267 Ga0207646_10414443 3300025922 Unclassified 1216
268 Ga0207646_10461701 3300025922 Bacteria 1145
269 Ga0207646_10503763 3300025922 Bacteria 1091
270 Ga0207681_10348894 3300025923 Bacteria 1184
271 Ga0207681_10510115 3300025923 Unclassified 986
272 Ga0207650_10058571 3300025925 Bacteria 2868
273 Ga0207659_10002522 3300025926 Bacteria 10902
274 Ga0207659_10053598 3300025926 Bacteria 2877
275 Ga0207659_10513539 3300025926 Bacteria 1015
276 Ga0207687_10524689 3300025927 Bacteria 991
277 Ga0207700_10187413 3300025928 Bacteria 1736
278 Ga0207700_10356093 3300025928 Bacteria 1275
279 Ga0207700_10482730 3300025928 Bacteria 1095
280 Ga0207664_10764612 3300025929 Unclassified 869
281 Ga0207644_10164870 3300025931 Bacteria 1725
282 Ga0207644_10171537 3300025931 Bacteria 1694
283 Ga0207644_10440477 3300025931 Bacteria 1069
284 Ga0207644_10471908 3300025931 Unclassified 1033
285 Ga0207690_10003906 3300025932 Bacteria 8814
286 Ga0207706_10091608 3300025933 Bacteria 2673
287 Ga0207706_10210847 3300025933 Bacteria 1703
288 Ga0207706_10344594 3300025933 Bacteria 1296
289 Ga0207706_10358967 3300025933 Bacteria 1266
290 Ga0207670_10044309 3300025936 Bacteria 2943
291 Ga0207670_10089510 3300025936 Bacteria 2172
292 Ga0207670_10351877 3300025936 Bacteria 1167
293 Ga0207665_10124298 3300025939 Bacteria 1826
294 Ga0207665_10213771 3300025939 Unclassified 1410
295 Ga0207665_10385625 3300025939 Unclassified 1064
296 Ga0207691_10124644 3300025940 Unclassified 2280
297 Ga0207691_10711568 3300025940 Bacteria 847
298 Ga0207711_10570754 3300025941 Bacteria 1055
299 Ga0207689_10094973 3300025942 Unclassified 2449
300 Ga0207679_10135939 3300025945 Bacteria 1979
301 Ga0207651_10201855 3300025960 Unclassified 1594
302 Ga0207651_10437506 3300025960 Unclassified 1120
303 Ga0207651_10453744 3300025960 Bacteria 1100
304 Ga0207712_10231015 3300025961 Unclassified 1485
305 Ga0207712_10434808 3300025961 Bacteria 1110
306 Ga0207668_10044755 3300025972 Bacteria 3014
307 Ga0207658_10024657 3300025986 Bacteria 4210
308 Ga0207658_10299589 3300025986 Bacteria 1385
309 Ga0207677_10031280 3300026023 Bacteria 3408
310 Ga0207677_10133141 3300026023 Bacteria 1891
311 Ga0207677_10582442 3300026023 Unclassified 979
312 Ga0207678_10004960 3300026067 Bacteria 11944
313 Ga0207678_10204264 3300026067 Unclassified 1690
314 Ga0207678_10321710 3300026067 Bacteria 1331
315 Ga0207708_10008737 3300026075 Bacteria 7495
316 Ga0207702_10125320 3300026078 Bacteria 2305
317 Ga0207648_10239361 3300026089 Bacteria 1616
318 Ga0207676_10555078 3300026095 Bacteria 1098
319 Ga0207683_10021723 3300026121 Bacteria 5501
320 Ga0207683_10085628 3300026121 Bacteria 2801
321 Ga0207683_10264790 3300026121 Bacteria 1570
322 Ga0209998_10007012 3300027717 Unclassified 2337
323 Ga0209974_10044105 3300027876 Unclassified 1487
324 Ga0268266_10048129 3300028379 Bacteria 3654
325 Ga0268266_10176206 3300028379 Bacteria 1944
326 Ga0268266_10279297 3300028379 Bacteria 1552
327 Ga0268264_10096662 3300028381 Bacteria 2559
328 Ga0265338_10423233 3300028800 Bacteria 946
329 Ga0265314_10130765 3300031711 Bacteria 1566
330 Ga0373936_0202782 3300035113 Unclassified 876
331 Ga0373943_0040049 3300035170 Unclassified 2261
332 Ga0373943_0221935 3300035170 Bacteria 1053
333 Ga0373946_0283166 3300035171 Unclassified 816
334 Ga0373935_0047097 3300035692 Unclassified 2725
335 Ga0373935_0103432 3300035692 Unclassified 1881
336 Ga0373927_0176033 3300035695 Bacteria 1403
337 Ga0373933_0112203 3300035724 Bacteria 1702
338 Ga0373947_0196497 3300035725 Bacteria 1318
339 Ga0373925_0083706 3300037068 Bacteria 2430
340 Ga0373925_0577136 3300037068 Unclassified 926
341 Ga0395900_0019043 3300037418 Bacteria 6998
342 Ga0395900_0436428 3300037418 Bacteria 1268
343 Ga0395898_0005358 3300037466 Bacteria 13858
344 Ga0395901_0000785 3300038443 Bacteria 35426
345 Ga0439455_0021742 3300042012 Bacteria 1532
346 Ga0439455_0026586 3300042012 Bacteria 1414
347 Ga0439464_0006274 3300042439 Bacteria 3094
348 Ga0439464_0035619 3300042439 Unclassified 1406
349 Ga0495592_0027832 3300046454 Bacteria 4281
350 Ga0495592_0059582 3300046454 Bacteria 2811
351 Ga0495603_0192606 3300046455 Unclassified 1179
352 Ga0495629_0132642 3300046459 Bacteria 1735
353 Ga0495651_0023185 3300046462 Bacteria 4827
354 Ga0495653_0106242 3300046463 Bacteria 2025
355 Ga0495580_0097360 3300046472 Bacteria 2046
356 Ga0495582_0415978 3300046473 Unclassified 775
357 Ga0495639_0165538 3300046475 Unclassified 1072
358 Ga0495662_0048748 3300046476 Bacteria 2045
359 Ga0495664_0059295 3300046477 Unclassified 2278
360 Ga0495664_0163682 3300046477 Bacteria 1350
361 Ga0495594_0074905 3300046499 Unclassified 1886
362 Ga0495628_0009617 3300046516 Bacteria 8248
363 Ga0495666_0089506 3300046526 Unclassified 1453
364 Ga0495652_0037493 3300046529 Bacteria 4205
365 Ga0495665_0350097 3300046531 Unclassified 752
366 Ga0495640_0091061 3300046533 Unclassified 2012
367 Ga0495640_0151543 3300046533 Unclassified 1490
368 Ga0495586_0111184 3300046535 Bacteria 1525
369 Ga0495587_0183595 3300046536 Bacteria 1185
370 Ga0495645_0026542 3300046543 Bacteria 4205
371 Ga0495634_0162255 3300046642 Unclassified 1408
372 Ga0495634_0229474 3300046642 Unclassified 1143
373 Ga0495599_0062851 3300046678 Bacteria 2319
374 Ga0495646_0095025 3300046680 Unclassified 1716
375 Ga0495658_0206251 3300046683 Unclassified 1226
376 Ga0495669_0174178 3300046684 Bacteria 1024
377 Ga0495613_0038114 3300046689 Unclassified 3563
378 Ga0495613_0122263 3300046689 Unclassified 1869
379 Ga0495624_0267805 3300046690 Unclassified 1032
380 Ga0495674_0027991 3300047319 Bacteria 5146
381 Ga0495674_0059662 3300047319 Bacteria 3331
382 Ga0495674_0089220 3300047319 Bacteria 2636
383 Ga0495676_0075052 3300047321 Bacteria 2587
384 Ga0495675_0027275 3300047444 Bacteria 3639
385 Ga0495684_0031792 3300047471 Bacteria 4054
386 Ga0495684_0117134 3300047471 Bacteria 2008
387 Ga0496101_0073922 3300048904 Bacteria 2505
388 Ga0496101_0088692 3300048904 Unclassified 2298
389 Ga0496101_0202545 3300048904 Unclassified 1535
390 Ga0496102_0079980 3300048905 Bacteria 3011
391 Ga0496102_0229257 3300048905 Bacteria 1751
392 Ga0496102_0426539 3300048905 Bacteria 1245
393 Ga0496103_0166393 3300048906 Bacteria 1415
394 Ga0496106_0052896 3300048909 Bacteria 3065
395 Ga0496106_0220428 3300048909 Unclassified 1513
396 Ga0496107_0135488 3300048910 Bacteria 1819
397 Ga0496108_0043594 3300048911 Bacteria 3747
398 Ga0496109_0074302 3300048912 Bacteria 3124
399 Ga0496110_0062037 3300048913 Bacteria 3301
400 Ga0496112_0213006 3300048915 Unclassified 1889
401 Ga0496113_0430086 3300048916 Unclassified 1060
402 Ga0496114_0131578 3300048917 Unclassified 2161
403 Ga0496114_0365077 3300048917 Bacteria 1277
404 Ga0496115_0000936 3300048918 Bacteria 21169
405 Ga0496115_0003158 3300048918 Bacteria 11845
406 Ga0496115_0085721 3300048918 Unclassified 2569
407 Ga0496115_0261402 3300048918 Unclassified 1423
408 nmdc:mga05p37_22449_c2 3300050507 Bacteria 5258
409 nmdc:mga05p37_519533_c1 3300050507 Unclassified 1362
410 nmdc:mga05p37_90749_c1 3300050507 Bacteria 3765
411 nmdc:mga05p37_97906_c1 3300050507 Bacteria 3613
412 nmdc:mga0n895_246377_c1 3300050512 Bacteria 1813
413 nmdc:mga0rr50_307822_c1 3300050513 Unclassified 1326
414 Ga0495601_0003545 3300053077 Bacteria 8972
415 Ga0495612_0034086 3300053078 Bacteria 2061
416 Ga0495619_0205718 3300053085 Unclassified 1363
417 Ga0081539_10009699
418 JGI24737J22298_10024962
419 JGI24035J26624_1001332
420 JGI24035J26624_1012018
421 JGI25404J52841_10017214
422 JGI25405J52794_10000111
423 Ga0065714_10170044
424 Ga0065712_10004570
425 Ga0065712_10006466
426 Ga0065712_10098394
427 Ga0065712_10151630
428 Ga0065712_10292611
429 Ga0065715_10006498
430 Ga0065715_10009934
431 Ga0065715_10010446
432 Ga0065715_10139503
433 Ga0065715_10175736
434 Ga0065707_10181001
435 Ga0070658_10691766
436 Ga0070676_10033463
437 Ga0070683_100125062
438 Ga0070683_100431756
439 Ga0070690_100012328
440 Ga0070670_100066491
441 Ga0070670_100379269
442 Ga0068869_100065611
443 Ga0070666_10073979
444 Ga0070666_10178679
445 Ga0070666_10214080
446 Ga0070680_100640763
447 Ga0070682_100041639
448 Ga0068868_100007349
449 Ga0068868_100464853
450 Ga0070660_100043663
451 Ga0070689_100052291
452 Ga0070689_100119775
453 Ga0070689_100823375
454 Ga0070687_100009612
455 Ga0070661_100095367
456 Ga0070661_100350320
457 Ga0070668_100200152
458 Ga0070668_100213369
459 Ga0070668_100618449
460 Ga0070669_100202390
461 Ga0070669_100514162
462 Ga0070675_100011574
463 Ga0070675_100031973
464 Ga0070675_100059644
465 Ga0070675_100131805
466 Ga0070671_100155046
467 Ga0070671_100351712
468 Ga0070671_100480497
469 Ga0070674_100122160
470 Ga0070673_100063221
471 Ga0070673_100328975
472 Ga0070673_100492244
473 Ga0070688_100005363
474 Ga0070688_100057588
475 Ga0070688_100180462
476 Ga0070688_100603298
477 Ga0070659_100005281
478 Ga0070667_100078092
479 Ga0070667_100113704
480 Ga0070709_10319825
481 Ga0070709_10452457
482 Ga0070714_100403348
483 Ga0070713_100639441
484 Ga0070710_10056406
485 Ga0070710_10174279
486 Ga0070701_10098730
487 Ga0070711_100040968
488 Ga0070711_100099055
489 Ga0070711_100158154
490 Ga0070711_100166368
491 Ga0070705_100044227
492 Ga0070705_100111686
493 Ga0070700_100006653
494 Ga0070694_100166500
495 Ga0070708_100061425
496 Ga0070708_100178082
497 Ga0070708_100225478
498 Ga0070708_100317054
499 Ga0070708_100368688
500 Ga0070708_100690025
501 Ga0070663_100021881
502 Ga0070663_100439875
503 Ga0070678_100051937
504 Ga0070678_100091693
505 Ga0070678_100695301
506 Ga0070662_100289038
507 Ga0070662_100355919
508 Ga0070662_100531451
509 Ga0068867_100567463
510 Ga0068867_100675708
511 Ga0070685_10027962
512 Ga0070685_10101126
513 Ga0070685_10143354
514 Ga0070706_100011488
515 Ga0070706_100029583
516 Ga0070706_100081998
517 Ga0070706_100262791
518 Ga0070706_100328615
519 Ga0070706_100339885
520 Ga0070707_100134017
521 Ga0070707_100297008
522 Ga0070707_100392588
523 Ga0070699_100152192
524 Ga0070679_100405017
525 Ga0070684_100002361
526 Ga0070684_100061129
527 Ga0070684_100070672
528 Ga0070697_100026397
529 Ga0070697_100045950
530 Ga0070697_100585985
531 Ga0070672_100189515
532 Ga0070672_100234186
533 Ga0070695_100217235
534 Ga0070695_100674262
535 Ga0070696_100242690
536 Ga0070696_100303860
537 Ga0070693_100138470
538 Ga0070665_100021348
539 Ga0070665_100065140
540 Ga0070665_100097449
541 Ga0070665_100146118
542 Ga0070665_100425839
543 Ga0070664_100048860
544 Ga0070664_100221008
545 Ga0070664_100290578
546 Ga0070664_100370569
547 Ga0068856_100606666
548 Ga0070702_100220019
549 Ga0068859_100424476
550 Ga0068864_100056642
551 Ga0068864_100441516
552 Ga0068861_100661301
553 Ga0068863_100268655
554 Ga0068858_100308593
555 Ga0068860_100017567
556 Ga0068860_100371331
557 Ga0081455_10001366
558 Ga0081455_10004364
559 Ga0081455_10017429
560 Ga0081455_10041902
561 Ga0081455_10108670
562 Ga0081455_10157431
563 Ga0081455_10340664
564 Ga0081540_1130133
565 Ga0081539_10004703
566 Ga0081539_10075116
567 Ga0081539_10084484
568 Ga0070717_10118166
569 Ga0070717_10228259
570 Ga0070717_10444798
571 Ga0070717_10651977
572 Ga0070715_10039118
573 Ga0070715_10046725
574 Ga0070716_100072857
575 Ga0070716_100074168
576 Ga0070712_100030073
577 Ga0070712_100126438
578 Ga0070712_100317819
579 Ga0097621_100056566
580 Ga0097621_100187142
581 Ga0068871_100098531
582 Ga0075428_100166016
583 Ga0075434_100330187
584 Ga0068865_100329778
585 Ga0097620_100424474
586 Ga0075435_100277435
587 Ga0105240_10268257
588 Ga0111539_10706297
589 Ga0111539_11160509
590 Ga0105245_10545210
591 Ga0105245_10558353
592 Ga0105245_10621825
593 Ga0105247_10271070
594 Ga0114129_10002187
595 Ga0114129_10377909
596 Ga0114129_10486961
597 Ga0105243_10025239
598 Ga0105242_10415303
599 Ga0105248_10230852
600 Ga0105248_10357486
601 Ga0105237_10079682
602 Ga0105249_10072348
603 Ga0105249_10475421
604 Ga0157369_10101441
605 Ga0157374_10034120
606 Ga0157374_10091673
607 Ga0157374_10167954
608 Ga0157374_10200939
609 Ga0157374_10280657
610 Ga0157374_10417758
611 Ga0157374_10881305
612 Ga0157378_10011822
613 Ga0157378_10107671
614 Ga0157378_10141336
615 Ga0157378_10168710
616 Ga0157378_10245581
617 Ga0157378_10350464
618 Ga0157378_10407432
619 Ga0163162_10051806
620 Ga0163162_10062776
621 Ga0163162_10161949
622 Ga0163162_10239794
623 Ga0163162_10329492
624 Ga0157372_10173506
625 Ga0157372_10280888
626 Ga0157375_10083932
627 Ga0157375_10418773
628 Ga0157375_10525447
629 Ga0163163_10133022
630 Ga0163163_10249896
631 Ga0163163_10491968
632 Ga0157380_10556077
633 Ga0157377_10317914
634 Ga0157379_10005223
635 Ga0157376_10062461
636 Ga0157376_10139062
637 Ga0157376_10206838
638 Ga0157376_10225255
639 Ga0157376_10225540
640 Ga0157376_10434685
641 Ga0157376_10596350
642 Ga0163161_10389006
643 Ga0163161_10473237
644 Ga0207673_1006949
645 Ga0207673_1009071
646 Ga0207697_10000515
647 Ga0207697_10003228
648 Ga0207697_10015400
649 Ga0207697_10020073
650 Ga0207697_10052137
651 Ga0207697_10052387
652 Ga0207697_10129016
653 Ga0207653_10018959
654 Ga0207692_10078688
655 Ga0207692_10109642
656 Ga0207692_10213513
657 Ga0207680_10033013
658 Ga0207680_10192456
659 Ga0207680_10453327
660 Ga0207680_10514820
661 Ga0207647_10008375
662 Ga0207645_10009561
663 Ga0207645_10261270
664 Ga0207705_10656347
665 Ga0207684_10004597
666 Ga0207684_10013804
667 Ga0207684_10240710
668 Ga0207707_10361330
669 Ga0207671_10079208
670 Ga0207693_10041132
671 Ga0207693_10041562
672 Ga0207693_10084880
673 Ga0207693_10176398
674 Ga0207693_10186210
675 Ga0207693_10301601
676 Ga0207663_10007359
677 Ga0207663_10070797
678 Ga0207663_10179569
679 Ga0207657_10073861
680 Ga0207649_10179634
681 Ga0207649_10211930
682 Ga0207646_10174601
683 Ga0207646_10414443
684 Ga0207646_10461701
685 Ga0207646_10503763
686 Ga0207681_10348894
687 Ga0207681_10510115
688 Ga0207650_10058571
689 Ga0207659_10002522
690 Ga0207659_10053598
691 Ga0207659_10513539
692 Ga0207687_10524689
693 Ga0207700_10187413
694 Ga0207700_10356093
695 Ga0207700_10482730
696 Ga0207664_10764612
697 Ga0207644_10164870
698 Ga0207644_10171537
699 Ga0207644_10440477
700 Ga0207644_10471908
701 Ga0207690_10003906
702 Ga0207706_10091608
703 Ga0207706_10210847
704 Ga0207706_10344594
705 Ga0207706_10358967
706 Ga0207670_10044309
707 Ga0207670_10089510
708 Ga0207670_10351877
709 Ga0207665_10124298
710 Ga0207665_10213771
711 Ga0207665_10385625
712 Ga0207691_10124644
713 Ga0207691_10711568
714 Ga0207711_10570754
715 Ga0207689_10094973
716 Ga0207679_10135939
717 Ga0207651_10201855
718 Ga0207651_10437506
719 Ga0207651_10453744
720 Ga0207712_10231015
721 Ga0207712_10434808
722 Ga0207668_10044755
723 Ga0207658_10024657
724 Ga0207658_10299589
725 Ga0207677_10031280
726 Ga0207677_10133141
727 Ga0207677_10582442
728 Ga0207678_10004960
729 Ga0207678_10204264
730 Ga0207678_10321710
731 Ga0207708_10008737
732 Ga0207702_10125320
733 Ga0207648_10239361
734 Ga0207676_10555078
735 Ga0207683_10021723
736 Ga0207683_10085628
737 Ga0207683_10264790
738 Ga0209998_10007012
739 Ga0209974_10044105
740 Ga0268266_10048129
741 Ga0268266_10176206
742 Ga0268266_10279297
743 Ga0268264_10096662
744 Ga0265338_10423233
745 Ga0265314_10130765
746 Ga0373936_0202782
747 Ga0373943_0040049
748 Ga0373943_0221935
749 Ga0373946_0283166
750 Ga0373935_0047097
751 Ga0373935_0103432
752 Ga0373927_0176033
753 Ga0373933_0112203
754 Ga0373947_0196497
755 Ga0373925_0083706
756 Ga0373925_0577136
757 Ga0395900_0019043
758 Ga0395900_0436428
759 Ga0395898_0005358
760 Ga0395901_0000785
761 Ga0439455_0021742
762 Ga0439455_0026586
763 Ga0439464_0006274
764 Ga0439464_0035619
765 Ga0495592_0027832
766 Ga0495592_0059582
767 Ga0495603_0192606
768 Ga0495629_0132642
769 Ga0495651_0023185
770 Ga0495653_0106242
771 Ga0495580_0097360
772 Ga0495582_0415978
773 Ga0495639_0165538
774 Ga0495662_0048748
775 Ga0495664_0059295
776 Ga0495664_0163682
777 Ga0495594_0074905
778 Ga0495628_0009617
779 Ga0495666_0089506
780 Ga0495652_0037493
781 Ga0495665_0350097
782 Ga0495640_0091061
783 Ga0495640_0151543
784 Ga0495586_0111184
785 Ga0495587_0183595
786 Ga0495645_0026542
787 Ga0495634_0162255
788 Ga0495634_0229474
789 Ga0495599_0062851
790 Ga0495646_0095025
791 Ga0495658_0206251
792 Ga0495669_0174178
793 Ga0495613_0038114
794 Ga0495613_0122263
795 Ga0495624_0267805
796 Ga0495674_0027991
797 Ga0495674_0059662
798 Ga0495674_0089220
799 Ga0495676_0075052
800 Ga0495675_0027275
801 Ga0495684_0031792
802 Ga0495684_0117134
803 Ga0496101_0073922
804 Ga0496101_0088692
805 Ga0496101_0202545
806 Ga0496102_0079980
807 Ga0496102_0229257
808 Ga0496102_0426539
809 Ga0496103_0166393
810 Ga0496106_0052896
811 Ga0496106_0220428
812 Ga0496107_0135488
813 Ga0496108_0043594
814 Ga0496109_0074302
815 Ga0496110_0062037
816 Ga0496112_0213006
817 Ga0496113_0430086
818 Ga0496114_0131578
819 Ga0496114_0365077
820 Ga0496115_0000936
821 Ga0496115_0003158
822 Ga0496115_0085721
823 Ga0496115_0261402
824 nmdc:mga05p37_22449_c2
825 nmdc:mga05p37_519533_c1
826 nmdc:mga05p37_90749_c1
827 nmdc:mga05p37_97906_c1
828 nmdc:mga0n895_246377_c1
829 nmdc:mga0rr50_307822_c1
830 Ga0495601_0003545
831 Ga0495612_0034086
832 Ga0495619_0205718

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14329

DUF4386

Domain of unknown function (DUF4386)

61

272

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kl9-assembly1.cif.gz_E structure of the sars-cov-2 s 6p trimer in complex with the ace2 protein decoy, ctc-445.2 (state 4) 0.4916 6 139
4uxz-assembly1.cif.gz_C structure of delta7-dgka-syn in 7.9 mag to 2.18 angstrom resolution 0.4604 64 154
4ffx-assembly1.cif.gz_C structural and biochemical characterization of human adenylosuccinate lyase (adsl) and the r303c adsl deficiency associated mutation 0.43 93 223
4uxz-assembly1.cif.gz_C structure of delta7-dgka-syn in 7.9 mag to 2.18 angstrom resolution 0.4296 64 154
6z0c-assembly1.cif.gz_A structure of in silico modelled artificial maquette-3 protein 0.424 35 216
ID Description Score Start End Superfamily
af_A0A2R8Q5Z1_5_176_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5908 54 218 1.20.1070.10
af_Q9XVM9_1_119_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.5512 130 221 1.20.140.150
af_Q8BH10_37_249_1.20.140.140 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Calcium release-activated calcium channel protein Orai 0.5211 41 215 1.20.140.140
af_B8A6A2_3_228_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5119 5 223 1.20.1070.10
af_A0A2R8Q5Z1_5_176_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5097 54 218 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A2V5YFL3-F1-model_v4 DUF4386 domain-containing protein 0.9705 66 226 GO:0016020
AF-A0A538TW86-F1-model_v4 DUF4386 domain-containing protein 0.9562 71 227 GO:0016020
AF-A0A1Q7T9W4-F1-model_v4 DUF4386 domain-containing protein 0.9523 1 225 GO:0016020
AF-A0A2Z5G656-F1-model_v4 DUF4386 domain-containing protein 0.9487 1 228 GO:0016020
AF-A0A2W5YN28-F1-model_v4 DUF4386 domain-containing protein 0.9464 1 233 GO:0016020

Map