F438754

General Info

Members Datasets Scaffolds Average Seq Length
416 241 832 438

Family's Representative Sequence

Representative Sequence 3300005842|Ga0068858_100004438|Ga0068858_1000044389
Length 432
Sequence MAVTYLKKAQKTPETESGNAQAVASAMIAEIEKRGEEAVREYASKLDRWDGDIVVPPAEIERRARLVPDTVRADIEFATAQVRRFARAQRESIEEFQVEVHPGLVAGQRLVPVNTAGCYVPTGRYAHIASAYMSIGTAKEAGVPVVVACSTPYKGEGIHPYVLYAMKVAGADHVMTLGGVQAIATLAFGLFGAPPADIIVGPGNKYVAEAKRLLFGRVGIPSEVAVIADDSADPMMVATDLVGQAEHGHESPAWLFTDSPKLAERVIELVPELIEALPPTARDAAGAAWRDYGEVIVCDTREEVARVSDLHASEHLEVHARDLDWWLANLTNYGSLFLGEETTVAFGDKASGPNHILPTKGAARYSGGLSVHKFVKTLTWQRMTRDANRQIGQVTARISRLEGMEAHARTADDRLEKYFPQEQFRLGEPVKA

Samples

Sample ID Description Type Environment
1 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
94 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
151 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
154 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
155 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
156 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
163 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
164 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
165 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
166 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
167 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
168 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
169 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
170 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
171 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
172 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
175 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
176 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
179 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
196 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
197 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
202 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
205 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
206 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
207 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
208 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
209 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
210 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
213 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
215 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
216 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
217 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
224 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
225 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
226 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
227 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
228 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
229 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
230 2643221621 Achromobacter sp. Root83 Isolate Unclassified
231 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
232 2643221736 Bosea sp. Root483D1 Isolate Unclassified
233 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
234 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
235 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
236 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
237 2858950400 Achromobacter sp. K91 Isolate Unclassified
238 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
239 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
240 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
241 3007803356 Pseudomonas sp. CM27 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.88
Metatranscriptomes 0
Isolates 3.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.68
Nodule 0.24
Rhizoplane 6.01
Rhizosphere 88.22
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068858_100004438 3300005842 Bacteria 13763
2 Ga0065715_10106663 3300005293 Bacteria 2816
3 Ga0070658_10050460 3300005327 Bacteria 3373
4 Ga0070658_10066576 3300005327 Bacteria 2943
5 Ga0070683_100012869 3300005329 Bacteria 7281
6 Ga0070683_100016877 3300005329 Bacteria 6442
7 Ga0070683_100176147 3300005329 Bacteria 2030
8 Ga0070690_100021784 3300005330 Bacteria 3916
9 Ga0070670_100000356 3300005331 Bacteria 38360
10 Ga0070670_100001266 3300005331 Bacteria 20137
11 Ga0070670_100025913 3300005331 Bacteria 5045
12 Ga0070670_100199535 3300005331 Bacteria 1738
13 Ga0068869_100124547 3300005334 Bacteria 1975
14 Ga0070680_100026078 3300005336 Bacteria 4674
15 Ga0070680_100030547 3300005336 Bacteria 4328
16 Ga0070660_100015356 3300005339 Bacteria 5526
17 Ga0070660_100119042 3300005339 Bacteria 2106
18 Ga0070691_10058689 3300005341 Bacteria 1848
19 Ga0070661_100115837 3300005344 Bacteria 2004
20 Ga0070692_10030568 3300005345 Bacteria 2694
21 Ga0070669_100007412 3300005353 Bacteria 7861
22 Ga0070669_100045432 3300005353 Bacteria 3201
23 Ga0070675_100044425 3300005354 Bacteria 3634
24 Ga0070675_100067438 3300005354 Bacteria 2961
25 Ga0070671_100093261 3300005355 Bacteria 2523
26 Ga0070674_100047688 3300005356 Bacteria 2937
27 Ga0070673_100032260 3300005364 Bacteria 3942
28 Ga0070659_100067271 3300005366 Bacteria 2841
29 Ga0070667_100010142 3300005367 Bacteria 7793
30 Ga0070714_100081222 3300005435 Bacteria 2822
31 Ga0070714_100113707 3300005435 Bacteria 2400
32 Ga0070714_100119116 3300005435 Bacteria 2346
33 Ga0070714_100133210 3300005435 Bacteria 2222
34 Ga0070713_100000020 3300005436 Bacteria 108930
35 Ga0070713_100003263 3300005436 Bacteria 10702
36 Ga0070710_10009281 3300005437 Bacteria 4808
37 Ga0070710_10040891 3300005437 Bacteria 2557
38 Ga0070701_10081255 3300005438 Bacteria 1755
39 Ga0070711_100070694 3300005439 Bacteria 2458
40 Ga0070711_100179649 3300005439 Bacteria 1619
41 Ga0070711_100182838 3300005439 Bacteria 1606
42 Ga0070705_100077806 3300005440 Bacteria 2027
43 Ga0070700_100026686 3300005441 Bacteria 3415
44 Ga0070663_100002716 3300005455 Bacteria 10014
45 Ga0070663_100026491 3300005455 Bacteria 3928
46 Ga0070662_100004974 3300005457 Bacteria 8445
47 Ga0070681_10001413 3300005458 Bacteria 21075
48 Ga0070681_10019331 3300005458 Bacteria 6818
49 Ga0070685_10008968 3300005466 Bacteria 5157
50 Ga0070706_100094437 3300005467 Bacteria 2775
51 Ga0070698_100083937 3300005471 Bacteria 3174
52 Ga0070699_100024944 3300005518 Bacteria 5155
53 Ga0070679_100013769 3300005530 Bacteria 7750
54 Ga0070684_100001471 3300005535 Bacteria 16986
55 Ga0070684_100031513 3300005535 Bacteria 4514
56 Ga0070697_100015809 3300005536 Bacteria 5928
57 Ga0068853_100006794 3300005539 Bacteria 9122
58 Ga0068853_100024063 3300005539 Bacteria 5105
59 Ga0068853_100042712 3300005539 Bacteria 3877
60 Ga0068853_100129669 3300005539 Bacteria 2256
61 Ga0070672_100045612 3300005543 Bacteria 3392
62 Ga0070672_100045616 3300005543 Bacteria 3392
63 Ga0070695_100007615 3300005545 Bacteria 6416
64 Ga0070695_100068662 3300005545 Bacteria 2315
65 Ga0070696_100001787 3300005546 Bacteria 14090
66 Ga0070693_100008902 3300005547 Bacteria 4979
67 Ga0070665_100051846 3300005548 Bacteria 4115
68 Ga0070665_100107217 3300005548 Bacteria 2796
69 Ga0070665_100181114 3300005548 Bacteria 2108
70 Ga0070704_100002501 3300005549 Bacteria 10340
71 Ga0070704_100002572 3300005549 Bacteria 10232
72 Ga0070704_100125266 3300005549 Bacteria 1981
73 Ga0068855_100011783 3300005563 Bacteria 10574
74 Ga0068855_100150464 3300005563 Bacteria 2647
75 Ga0068855_100157691 3300005563 Bacteria 2578
76 Ga0070664_100005099 3300005564 Bacteria 10539
77 Ga0070664_100005713 3300005564 Bacteria 10021
78 Ga0070664_100071809 3300005564 Bacteria 2967
79 Ga0068857_100003353 3300005577 Bacteria 13334
80 Ga0068854_100014298 3300005578 Bacteria 5230
81 Ga0068856_100000656 3300005614 Bacteria 37454
82 Ga0068856_100011933 3300005614 Bacteria 8414
83 Ga0068856_100053086 3300005614 Bacteria 3997
84 Ga0068856_100094856 3300005614 Bacteria 2971
85 Ga0068856_100149841 3300005614 Bacteria 2341
86 Ga0068856_100157228 3300005614 Bacteria 2283
87 Ga0068856_100313307 3300005614 Bacteria 1587
88 Ga0070702_100048233 3300005615 Bacteria 2423
89 Ga0068852_100004918 3300005616 Bacteria 9484
90 Ga0068852_100048755 3300005616 Bacteria 3620
91 Ga0068859_100022726 3300005617 Bacteria 6288
92 Ga0068859_100287646 3300005617 Bacteria 1736
93 Ga0068864_100001742 3300005618 Bacteria 17878
94 Ga0068864_100010464 3300005618 Bacteria 7665
95 Ga0068864_100034336 3300005618 Bacteria 4314
96 Ga0068866_10012160 3300005718 Bacteria 3746
97 Ga0068851_10001069 3300005834 Bacteria 11854
98 Ga0068851_10010775 3300005834 Bacteria 4273
99 Ga0068851_10012396 3300005834 Bacteria 4018
100 Ga0068870_10020504 3300005840 Bacteria 3220
101 Ga0068863_100066455 3300005841 Bacteria 3411
102 Ga0068863_100115008 3300005841 Bacteria 2563
103 Ga0068863_100137034 3300005841 Bacteria 2339
104 Ga0068858_100116177 3300005842 Bacteria 2501
105 Ga0068860_100017688 3300005843 Bacteria 6944
106 Ga0068862_100065218 3300005844 Bacteria 3136
107 Ga0068862_100081223 3300005844 Bacteria 2812
108 Ga0075368_10002296 3300006042 Bacteria 6208
109 Ga0075363_100003449 3300006048 Bacteria 6723
110 Ga0075367_10003337 3300006178 Bacteria 7626
111 Ga0075428_100009931 3300006844 Bacteria 10572
112 Ga0075428_100046581 3300006844 Bacteria 4762
113 Ga0075430_100006602 3300006846 Bacteria 9776
114 Ga0075431_100006357 3300006847 Bacteria 11731
115 Ga0075431_100016340 3300006847 Bacteria 7528
116 Ga0075431_100063575 3300006847 Bacteria 3809
117 Ga0075434_100024419 3300006871 Bacteria 5909
118 Ga0075434_100062125 3300006871 Bacteria 3718
119 Ga0075429_100002389 3300006880 Bacteria 15821
120 Ga0075436_100004768 3300006914 Bacteria 9314
121 Ga0075436_100052296 3300006914 Bacteria 2819
122 Ga0097620_100022724 3300006931 Bacteria 6288
123 Ga0097620_100287660 3300006931 Bacteria 1736
124 Ga0075435_100085171 3300007076 Bacteria 2601
125 Ga0105240_10003496 3300009093 Bacteria 24362
126 Ga0105240_10006636 3300009093 Bacteria 16984
127 Ga0105240_10018471 3300009093 Bacteria 9360
128 Ga0111539_10046138 3300009094 Bacteria 5214
129 Ga0111539_10056040 3300009094 Bacteria 4686
130 Ga0111539_10065171 3300009094 Bacteria 4306
131 Ga0105245_10046935 3300009098 Bacteria 3860
132 Ga0114129_10017574 3300009147 Bacteria 10180
133 Ga0114129_10546575 3300009147 Bacteria 1507
134 Ga0105243_10076912 3300009148 Bacteria 2713
135 Ga0105242_10004690 3300009176 Bacteria 10583
136 Ga0105242_10120488 3300009176 Bacteria 2251
137 Ga0105248_10002682 3300009177 Bacteria 19764
138 Ga0105237_10028787 3300009545 Bacteria 5653
139 Ga0105237_10094761 3300009545 Bacteria 2974
140 Ga0105249_10030521 3300009553 Bacteria 4873
141 Ga0105239_10006811 3300010375 Bacteria 13183
142 Ga0157373_10003612 3300013100 Bacteria 11682
143 Ga0157370_10010656 3300013104 Bacteria 9676
144 Ga0157370_10012637 3300013104 Bacteria 8746
145 Ga0157370_10034755 3300013104 Bacteria 4904
146 Ga0157369_10002279 3300013105 Bacteria 23079
147 Ga0157369_10023799 3300013105 Bacteria 6819
148 Ga0157369_10057816 3300013105 Bacteria 4183
149 Ga0157369_10158711 3300013105 Bacteria 2388
150 Ga0157378_10063596 3300013297 Bacteria 3297
151 Ga0163162_10026179 3300013306 Bacteria 5765
152 Ga0163162_10052403 3300013306 Bacteria 4098
153 Ga0163162_10069470 3300013306 Bacteria 3574
154 Ga0163162_10086045 3300013306 Bacteria 3221
155 Ga0157372_10005089 3300013307 Bacteria 13979
156 Ga0157372_10006487 3300013307 Bacteria 12450
157 Ga0157372_10038114 3300013307 Bacteria 5303
158 Ga0157372_10107960 3300013307 Bacteria 3185
159 Ga0157375_10254486 3300013308 Bacteria 1917
160 Ga0157375_10335173 3300013308 Bacteria 1678
161 Ga0163163_10049561 3300014325 Bacteria 4134
162 Ga0163163_10050625 3300014325 Bacteria 4091
163 Ga0157380_10023155 3300014326 Bacteria 4684
164 Ga0157380_10197988 3300014326 Bacteria 1780
165 Ga0157377_10024687 3300014745 Bacteria 3197
166 Ga0157379_10043680 3300014968 Bacteria 4001
167 Ga0157379_10109790 3300014968 Bacteria 2477
168 Ga0163161_10073176 3300017792 Bacteria 2511
169 Ga0213876_10001158 3300021384 Bacteria 16663
170 Ga0213875_10021546 3300021388 Bacteria 3086
171 Ga0207673_1001588 3300025290 Bacteria 2506
172 Ga0207697_10000185 3300025315 Bacteria 32415
173 Ga0207656_10004338 3300025321 Bacteria 4946
174 Ga0207656_10006140 3300025321 Bacteria 4301
175 Ga0207656_10009158 3300025321 Bacteria 3670
176 Ga0207682_10007335 3300025893 Bacteria 4397
177 Ga0207642_10036924 3300025899 Bacteria 2101
178 Ga0207688_10001770 3300025901 Bacteria 11469
179 Ga0207645_10032187 3300025907 Bacteria 3371
180 Ga0207643_10000211 3300025908 Bacteria 40799
181 Ga0207705_10002981 3300025909 Bacteria 12927
182 Ga0207705_10013129 3300025909 Bacteria 5979
183 Ga0207705_10055569 3300025909 Bacteria 2854
184 Ga0207707_10005204 3300025912 Bacteria 11398
185 Ga0207707_10013002 3300025912 Bacteria 7246
186 Ga0207707_10089823 3300025912 Bacteria 2685
187 Ga0207695_10034719 3300025913 Bacteria 5480
188 Ga0207695_10069718 3300025913 Bacteria 3597
189 Ga0207695_10094776 3300025913 Bacteria 2991
190 Ga0207695_10122819 3300025913 Bacteria 2563
191 Ga0207663_10130605 3300025916 Bacteria 1735
192 Ga0207660_10045920 3300025917 Bacteria 3080
193 Ga0207660_10097781 3300025917 Bacteria 2188
194 Ga0207657_10000315 3300025919 Bacteria 51211
195 Ga0207657_10004155 3300025919 Bacteria 15351
196 Ga0207657_10052071 3300025919 Bacteria 3555
197 Ga0207657_10064844 3300025919 Bacteria 3116
198 Ga0207649_10033830 3300025920 Bacteria 3057
199 Ga0207649_10034438 3300025920 Bacteria 3035
200 Ga0207652_10071066 3300025921 Bacteria 3024
201 Ga0207652_10089743 3300025921 Bacteria 2699
202 Ga0207652_10119841 3300025921 Bacteria 2340
203 Ga0207646_10007250 3300025922 Bacteria 11306
204 Ga0207694_10050461 3300025924 Bacteria 3222
205 Ga0207650_10000755 3300025925 Bacteria 24847
206 Ga0207650_10011283 3300025925 Bacteria 6148
207 Ga0207650_10027242 3300025925 Bacteria 4089
208 Ga0207650_10049561 3300025925 Bacteria 3101
209 Ga0207650_10102976 3300025925 Bacteria 2200
210 Ga0207650_10110725 3300025925 Bacteria 2125
211 Ga0207659_10030898 3300025926 Bacteria 3663
212 Ga0207659_10145099 3300025926 Bacteria 1847
213 Ga0207700_10000086 3300025928 Bacteria 58118
214 Ga0207700_10028545 3300025928 Bacteria 3924
215 Ga0207700_10112407 3300025928 Bacteria 2194
216 Ga0207664_10000505 3300025929 Bacteria 27821
217 Ga0207644_10075553 3300025931 Bacteria 2476
218 Ga0207644_10153542 3300025931 Bacteria 1783
219 Ga0207690_10082382 3300025932 Bacteria 2250
220 Ga0207706_10006941 3300025933 Bacteria 10471
221 Ga0207706_10007859 3300025933 Bacteria 9845
222 Ga0207706_10047687 3300025933 Bacteria 3790
223 Ga0207686_10011125 3300025934 Bacteria 4919
224 Ga0207686_10060097 3300025934 Bacteria 2404
225 Ga0207670_10157709 3300025936 Bacteria 1691
226 Ga0207669_10008539 3300025937 Bacteria 4815
227 Ga0207669_10076348 3300025937 Bacteria 2127
228 Ga0207704_10004379 3300025938 Bacteria 6461
229 Ga0207691_10000111 3300025940 Bacteria 72961
230 Ga0207691_10025749 3300025940 Bacteria 5521
231 Ga0207691_10045706 3300025940 Bacteria 4024
232 Ga0207711_10001814 3300025941 Bacteria 19514
233 Ga0207689_10000526 3300025942 Bacteria 36327
234 Ga0207689_10002758 3300025942 Bacteria 16247
235 Ga0207689_10118372 3300025942 Bacteria 2178
236 Ga0207661_10021524 3300025944 Bacteria 4832
237 Ga0207679_10003930 3300025945 Bacteria 9232
238 Ga0207679_10062235 3300025945 Bacteria 2780
239 Ga0207679_10216348 3300025945 Bacteria 1610
240 Ga0207667_10007162 3300025949 Bacteria 13464
241 Ga0207667_10014392 3300025949 Bacteria 9022
242 Ga0207667_10078829 3300025949 Bacteria 3413
243 Ga0207667_10103455 3300025949 Bacteria 2937
244 Ga0207667_10285897 3300025949 Bacteria 1685
245 Ga0207668_10066378 3300025972 Bacteria 2557
246 Ga0207668_10142362 3300025972 Bacteria 1846
247 Ga0207658_10023644 3300025986 Bacteria 4292
248 Ga0207703_10007318 3300026035 Bacteria 8776
249 Ga0207703_10009917 3300026035 Bacteria 7473
250 Ga0207703_10022328 3300026035 Bacteria 4962
251 Ga0207703_10109021 3300026035 Bacteria 2359
252 Ga0207639_10008409 3300026041 Bacteria 7071
253 Ga0207639_10060263 3300026041 Bacteria 2928
254 Ga0207639_10305273 3300026041 Bacteria 1408
255 Ga0207678_10002744 3300026067 Bacteria 15937
256 Ga0207678_10003412 3300026067 Bacteria 14301
257 Ga0207708_10000359 3300026075 Bacteria 35755
258 Ga0207702_10000127 3300026078 Bacteria 89755
259 Ga0207702_10095023 3300026078 Bacteria 2618
260 Ga0207702_10100106 3300026078 Bacteria 2556
261 Ga0207702_10206674 3300026078 Bacteria 1823
262 Ga0207648_10008702 3300026089 Bacteria 9790
263 Ga0207648_10016543 3300026089 Bacteria 6736
264 Ga0207648_10117575 3300026089 Bacteria 2336
265 Ga0207648_10138016 3300026089 Bacteria 2148
266 Ga0207648_10145935 3300026089 Bacteria 2087
267 Ga0207676_10009418 3300026095 Bacteria 6951
268 Ga0207676_10045052 3300026095 Bacteria 3406
269 Ga0207674_10000446 3300026116 Bacteria 53731
270 Ga0207674_10002872 3300026116 Bacteria 21404
271 Ga0207674_10007003 3300026116 Bacteria 13180
272 Ga0207675_100009035 3300026118 Bacteria 9349
273 Ga0207683_10033842 3300026121 Bacteria 4440
274 Ga0207683_10080392 3300026121 Bacteria 2892
275 Ga0207698_10056244 3300026142 Bacteria 3037
276 Ga0207698_10215573 3300026142 Bacteria 1730
277 Ga0209967_1000719 3300027364 Bacteria 4253
278 Ga0210000_1001125 3300027462 Bacteria 3744
279 Ga0209813_10008483 3300027866 Bacteria 2599
280 Ga0207428_10202801 3300027907 Bacteria 1492
281 Ga0268266_10058686 3300028379 Bacteria 3314
282 Ga0268266_10098764 3300028379 Bacteria 2569
283 Ga0268266_10210536 3300028379 Bacteria 1783
284 Ga0268265_10034423 3300028380 Bacteria 3692
285 Ga0268265_10120198 3300028380 Bacteria 2163
286 Ga0268265_10145292 3300028380 Bacteria 1992
287 Ga0268264_10009637 3300028381 Bacteria 8001
288 Ga0268264_10036018 3300028381 Bacteria 4075
289 Ga0265338_10000341 3300028800 Bacteria 84990
290 Ga0316575_10005515 3300031665 Bacteria 4518
291 Ga0316579_10000544 3300031691 Bacteria 12455
292 Ga0307416_100078806 3300032002 Bacteria 2774
293 Ga0307416_100192129 3300032002 Bacteria 1927
294 Ga0316583_10010694 3300032133 Bacteria 3308
295 Ga0373956_0035810 3300035119 Bacteria 2190
296 Ga0373927_0043107 3300035695 Bacteria 2922
297 Ga0316582_0008042 3300036647 Bacteria 5642
298 Ga0373925_0226362 3300037068 Bacteria 1494
299 Ga0395899_0060596 3300037312 Bacteria 2788
300 Ga0395905_0016901 3300037471 Bacteria 6931
301 Ga0436364_0719886 3300037853 Bacteria 9346
302 Ga0436364_1503970 3300037853 Bacteria 2521
303 Ga0395901_0029112 3300038443 Bacteria 5684
304 Ga0395901_0095876 3300038443 Bacteria 3109
305 Ga0436365_0468913 3300039437 Bacteria 24014
306 Ga0436363_0695344 3300039450 Bacteria 3403
307 Ga0436363_1507929 3300039450 Bacteria 12431
308 Ga0436362_0458969 3300039453 Bacteria 15466
309 Ga0439434_0011381 3300042435 Bacteria 2630
310 Ga0439435_0016116 3300042436 Bacteria 1869
311 Ga0451577_0009112 3300042876 Bacteria 9578
312 Ga0451577_0034786 3300042876 Bacteria 4541
313 Ga0451577_0063671 3300042876 Bacteria 3289
314 Ga0466963_0058356 3300044694 Bacteria 2573
315 Ga0466959_0033088 3300045049 Bacteria 3826
316 Ga0451576_0023293 3300045051 Bacteria 6705
317 Ga0495580_0040119 3300046472 Bacteria 3347
318 Ga0495630_0009364 3300046517 Bacteria 7041
319 Ga0495652_0017261 3300046529 Bacteria 6445
320 Ga0495665_0002932 3300046531 Bacteria 9216
321 Ga0495669_0036111 3300046684 Bacteria 2184
322 Ga0495649_0055513 3300046694 Bacteria 2140
323 Ga0495674_0012993 3300047319 Bacteria 7838
324 Ga0495674_0172962 3300047319 Bacteria 1801
325 Ga0495680_0109910 3300047322 Bacteria 2044
326 Ga0495687_008154 3300047443 Bacteria 6041
327 Ga0496100_0040452 3300048903 Bacteria 2966
328 Ga0496101_0188073 3300048904 Bacteria 1593
329 Ga0496102_0130932 3300048905 Bacteria 2348
330 Ga0496104_0001524 3300048907 Bacteria 19975
331 Ga0496104_0015910 3300048907 Bacteria 6827
332 Ga0496105_0028879 3300048908 Bacteria 4538
333 Ga0496106_0000009 3300048909 Bacteria 238601
334 Ga0496106_0015317 3300048909 Bacteria 5673
335 Ga0496107_0048697 3300048910 Bacteria 3054
336 Ga0496108_0003428 3300048911 Bacteria 12717
337 Ga0496108_0004093 3300048911 Bacteria 11705
338 Ga0496108_0096409 3300048911 Bacteria 2519
339 Ga0496109_0009837 3300048912 Bacteria 8161
340 Ga0496110_0008678 3300048913 Bacteria 8187
341 Ga0496110_0012401 3300048913 Bacteria 7007
342 Ga0496110_0018442 3300048913 Bacteria 5852
343 Ga0496111_0026517 3300048914 Bacteria 4093
344 Ga0496111_0057496 3300048914 Bacteria 2816
345 Ga0496111_0057647 3300048914 Bacteria 2812
346 Ga0496112_0015791 3300048915 Bacteria 7055
347 Ga0496112_0054718 3300048915 Bacteria 3922
348 Ga0496112_0157088 3300048915 Bacteria 2241
349 Ga0496113_0026370 3300048916 Bacteria 4154
350 Ga0496114_0120339 3300048917 Bacteria 2257
351 Ga0496115_0033772 3300048918 Bacteria 4041
352 Ga0496121_0001357 3300048924 Bacteria 41844
353 Ga0496125_0000482 3300048928 Bacteria 70413
354 Ga0501032_0041708 3300049569 Bacteria 3116
355 Ga0501034_0082496 3300049571 Bacteria 3216
356 Ga0501038_0019454 3300049574 Bacteria 6120
357 Ga0501047_0035431 3300049581 Bacteria 4821
358 Ga0501047_0059156 3300049581 Bacteria 3700
359 Ga0501047_0141709 3300049581 Bacteria 2282
360 Ga0501067_0092518 3300049583 Bacteria 1679
361 Ga0501069_0001265 3300049585 Bacteria 12401
362 Ga0501069_0086967 3300049585 Bacteria 1765
363 Ga0501070_0062002 3300049586 Bacteria 3097
364 Ga0501071_0180116 3300049587 Bacteria 1583
365 Ga0501072_0007021 3300049588 Bacteria 8551
366 Ga0501072_0030616 3300049588 Bacteria 4210
367 Ga0501073_0002754 3300049589 Bacteria 13173
368 Ga0501073_0010326 3300049589 Bacteria 6854
369 Ga0501073_0029001 3300049589 Bacteria 3954
370 Ga0501074_0002933 3300049590 Bacteria 11982
371 Ga0501074_0023546 3300049590 Bacteria 4476
372 Ga0501074_0063577 3300049590 Bacteria 2658
373 Ga0501075_0043416 3300049591 Bacteria 3372
374 Ga0501076_0034562 3300049592 Bacteria 3952
375 Ga0501079_0023198 3300049741 Bacteria 4764
376 Ga0501079_0135245 3300049741 Bacteria 1919
377 Ga0501080_0005824 3300049742 Bacteria 11033
378 Ga0501080_0088584 3300049742 Bacteria 2875
379 Ga0501083_0016214 3300049744 Bacteria 5219
380 Ga0501083_0025763 3300049744 Bacteria 4071
381 Ga0501044_0198757 3300049823 Bacteria 1964
382 Ga0501045_0067141 3300049824 Bacteria 2634
383 nmdc:mga03n38_28218_c1 3300050490 Bacteria 2337
384 nmdc:mga06z11_2329_c1 3300050494 Bacteria 7230
385 nmdc:mga04h51_9422_c1 3300050495 Bacteria 2648
386 nmdc:mga05p37_50527_c1 3300050507 Bacteria 5114
387 nmdc:mga09592_57407_c1 3300050508 Bacteria 3290
388 nmdc:mga09592_61_c1 3300050508 Bacteria 60866
389 nmdc:mga09592_8319_c1 3300050508 Bacteria 8437
390 nmdc:mga0qj67_149949_c1 3300050509 Bacteria 1892
391 nmdc:mga0qj67_852_c1 3300050509 Bacteria 20929
392 nmdc:mga06r32_121391_c1 3300050510 Bacteria 2578
393 nmdc:mga06r32_18272_c1 3300050510 Bacteria 6417
394 nmdc:mga06r32_55885_c1 3300050510 Bacteria 3787
395 nmdc:mga0n895_914_c1 3300050512 Bacteria 21245
396 nmdc:mga0rr50_16737_c1 3300050513 Bacteria 4878
397 nmdc:mga0rr50_25744_c1 3300050513 Bacteria 4095
398 nmdc:mga08x19_104378_c1 3300050514 Bacteria 1883
399 nmdc:mga08x19_3389_c1 3300050514 Bacteria 9508
400 Ga0495619_0099365 3300053085 Bacteria 1979
401 Ga0501084_0063045 3300054114 Bacteria 3103
402 Ga0501082_0295190 3300060353 Bacteria 1411
403 Ga0530510_0105889 3300061734 Bacteria 2058
404 2512345966 2512047030 Bacteria 9031815
405 2644122007 2643221621 Bacteria 6212786
406 2644301471 2643221654 Bacteria 5273570
407 2644742725 2643221736 Bacteria 6608466
408 2712469912 2711768156 Bacteria 4471618
409 2723876287 2721755763 Bacteria 4464185
410 2840882303 2840878972 Bacteria 5483153
411 2857542091 2857537821 Bacteria 5248181
412 2858951000 2858950400 Bacteria 6783797
413 2889307411 2889306138 Bacteria 6358934
414 2894774603 2894772417 Bacteria 5305674
415 2908673456 2908669403 Bacteria 5740494
416 3007808840 3007803356 Bacteria 5931491
417 Ga0068858_100004438
418 Ga0065715_10106663
419 Ga0070658_10050460
420 Ga0070658_10066576
421 Ga0070683_100012869
422 Ga0070683_100016877
423 Ga0070683_100176147
424 Ga0070690_100021784
425 Ga0070670_100000356
426 Ga0070670_100001266
427 Ga0070670_100025913
428 Ga0070670_100199535
429 Ga0068869_100124547
430 Ga0070680_100026078
431 Ga0070680_100030547
432 Ga0070660_100015356
433 Ga0070660_100119042
434 Ga0070691_10058689
435 Ga0070661_100115837
436 Ga0070692_10030568
437 Ga0070669_100007412
438 Ga0070669_100045432
439 Ga0070675_100044425
440 Ga0070675_100067438
441 Ga0070671_100093261
442 Ga0070674_100047688
443 Ga0070673_100032260
444 Ga0070659_100067271
445 Ga0070667_100010142
446 Ga0070714_100081222
447 Ga0070714_100113707
448 Ga0070714_100119116
449 Ga0070714_100133210
450 Ga0070713_100000020
451 Ga0070713_100003263
452 Ga0070710_10009281
453 Ga0070710_10040891
454 Ga0070701_10081255
455 Ga0070711_100070694
456 Ga0070711_100179649
457 Ga0070711_100182838
458 Ga0070705_100077806
459 Ga0070700_100026686
460 Ga0070663_100002716
461 Ga0070663_100026491
462 Ga0070662_100004974
463 Ga0070681_10001413
464 Ga0070681_10019331
465 Ga0070685_10008968
466 Ga0070706_100094437
467 Ga0070698_100083937
468 Ga0070699_100024944
469 Ga0070679_100013769
470 Ga0070684_100001471
471 Ga0070684_100031513
472 Ga0070697_100015809
473 Ga0068853_100006794
474 Ga0068853_100024063
475 Ga0068853_100042712
476 Ga0068853_100129669
477 Ga0070672_100045612
478 Ga0070672_100045616
479 Ga0070695_100007615
480 Ga0070695_100068662
481 Ga0070696_100001787
482 Ga0070693_100008902
483 Ga0070665_100051846
484 Ga0070665_100107217
485 Ga0070665_100181114
486 Ga0070704_100002501
487 Ga0070704_100002572
488 Ga0070704_100125266
489 Ga0068855_100011783
490 Ga0068855_100150464
491 Ga0068855_100157691
492 Ga0070664_100005099
493 Ga0070664_100005713
494 Ga0070664_100071809
495 Ga0068857_100003353
496 Ga0068854_100014298
497 Ga0068856_100000656
498 Ga0068856_100011933
499 Ga0068856_100053086
500 Ga0068856_100094856
501 Ga0068856_100149841
502 Ga0068856_100157228
503 Ga0068856_100313307
504 Ga0070702_100048233
505 Ga0068852_100004918
506 Ga0068852_100048755
507 Ga0068859_100022726
508 Ga0068859_100287646
509 Ga0068864_100001742
510 Ga0068864_100010464
511 Ga0068864_100034336
512 Ga0068866_10012160
513 Ga0068851_10001069
514 Ga0068851_10010775
515 Ga0068851_10012396
516 Ga0068870_10020504
517 Ga0068863_100066455
518 Ga0068863_100115008
519 Ga0068863_100137034
520 Ga0068858_100116177
521 Ga0068860_100017688
522 Ga0068862_100065218
523 Ga0068862_100081223
524 Ga0075368_10002296
525 Ga0075363_100003449
526 Ga0075367_10003337
527 Ga0075428_100009931
528 Ga0075428_100046581
529 Ga0075430_100006602
530 Ga0075431_100006357
531 Ga0075431_100016340
532 Ga0075431_100063575
533 Ga0075434_100024419
534 Ga0075434_100062125
535 Ga0075429_100002389
536 Ga0075436_100004768
537 Ga0075436_100052296
538 Ga0097620_100022724
539 Ga0097620_100287660
540 Ga0075435_100085171
541 Ga0105240_10003496
542 Ga0105240_10006636
543 Ga0105240_10018471
544 Ga0111539_10046138
545 Ga0111539_10056040
546 Ga0111539_10065171
547 Ga0105245_10046935
548 Ga0114129_10017574
549 Ga0114129_10546575
550 Ga0105243_10076912
551 Ga0105242_10004690
552 Ga0105242_10120488
553 Ga0105248_10002682
554 Ga0105237_10028787
555 Ga0105237_10094761
556 Ga0105249_10030521
557 Ga0105239_10006811
558 Ga0157373_10003612
559 Ga0157370_10010656
560 Ga0157370_10012637
561 Ga0157370_10034755
562 Ga0157369_10002279
563 Ga0157369_10023799
564 Ga0157369_10057816
565 Ga0157369_10158711
566 Ga0157378_10063596
567 Ga0163162_10026179
568 Ga0163162_10052403
569 Ga0163162_10069470
570 Ga0163162_10086045
571 Ga0157372_10005089
572 Ga0157372_10006487
573 Ga0157372_10038114
574 Ga0157372_10107960
575 Ga0157375_10254486
576 Ga0157375_10335173
577 Ga0163163_10049561
578 Ga0163163_10050625
579 Ga0157380_10023155
580 Ga0157380_10197988
581 Ga0157377_10024687
582 Ga0157379_10043680
583 Ga0157379_10109790
584 Ga0163161_10073176
585 Ga0213876_10001158
586 Ga0213875_10021546
587 Ga0207673_1001588
588 Ga0207697_10000185
589 Ga0207656_10004338
590 Ga0207656_10006140
591 Ga0207656_10009158
592 Ga0207682_10007335
593 Ga0207642_10036924
594 Ga0207688_10001770
595 Ga0207645_10032187
596 Ga0207643_10000211
597 Ga0207705_10002981
598 Ga0207705_10013129
599 Ga0207705_10055569
600 Ga0207707_10005204
601 Ga0207707_10013002
602 Ga0207707_10089823
603 Ga0207695_10034719
604 Ga0207695_10069718
605 Ga0207695_10094776
606 Ga0207695_10122819
607 Ga0207663_10130605
608 Ga0207660_10045920
609 Ga0207660_10097781
610 Ga0207657_10000315
611 Ga0207657_10004155
612 Ga0207657_10052071
613 Ga0207657_10064844
614 Ga0207649_10033830
615 Ga0207649_10034438
616 Ga0207652_10071066
617 Ga0207652_10089743
618 Ga0207652_10119841
619 Ga0207646_10007250
620 Ga0207694_10050461
621 Ga0207650_10000755
622 Ga0207650_10011283
623 Ga0207650_10027242
624 Ga0207650_10049561
625 Ga0207650_10102976
626 Ga0207650_10110725
627 Ga0207659_10030898
628 Ga0207659_10145099
629 Ga0207700_10000086
630 Ga0207700_10028545
631 Ga0207700_10112407
632 Ga0207664_10000505
633 Ga0207644_10075553
634 Ga0207644_10153542
635 Ga0207690_10082382
636 Ga0207706_10006941
637 Ga0207706_10007859
638 Ga0207706_10047687
639 Ga0207686_10011125
640 Ga0207686_10060097
641 Ga0207670_10157709
642 Ga0207669_10008539
643 Ga0207669_10076348
644 Ga0207704_10004379
645 Ga0207691_10000111
646 Ga0207691_10025749
647 Ga0207691_10045706
648 Ga0207711_10001814
649 Ga0207689_10000526
650 Ga0207689_10002758
651 Ga0207689_10118372
652 Ga0207661_10021524
653 Ga0207679_10003930
654 Ga0207679_10062235
655 Ga0207679_10216348
656 Ga0207667_10007162
657 Ga0207667_10014392
658 Ga0207667_10078829
659 Ga0207667_10103455
660 Ga0207667_10285897
661 Ga0207668_10066378
662 Ga0207668_10142362
663 Ga0207658_10023644
664 Ga0207703_10007318
665 Ga0207703_10009917
666 Ga0207703_10022328
667 Ga0207703_10109021
668 Ga0207639_10008409
669 Ga0207639_10060263
670 Ga0207639_10305273
671 Ga0207678_10002744
672 Ga0207678_10003412
673 Ga0207708_10000359
674 Ga0207702_10000127
675 Ga0207702_10095023
676 Ga0207702_10100106
677 Ga0207702_10206674
678 Ga0207648_10008702
679 Ga0207648_10016543
680 Ga0207648_10117575
681 Ga0207648_10138016
682 Ga0207648_10145935
683 Ga0207676_10009418
684 Ga0207676_10045052
685 Ga0207674_10000446
686 Ga0207674_10002872
687 Ga0207674_10007003
688 Ga0207675_100009035
689 Ga0207683_10033842
690 Ga0207683_10080392
691 Ga0207698_10056244
692 Ga0207698_10215573
693 Ga0209967_1000719
694 Ga0210000_1001125
695 Ga0209813_10008483
696 Ga0207428_10202801
697 Ga0268266_10058686
698 Ga0268266_10098764
699 Ga0268266_10210536
700 Ga0268265_10034423
701 Ga0268265_10120198
702 Ga0268265_10145292
703 Ga0268264_10009637
704 Ga0268264_10036018
705 Ga0265338_10000341
706 Ga0316575_10005515
707 Ga0316579_10000544
708 Ga0307416_100078806
709 Ga0307416_100192129
710 Ga0316583_10010694
711 Ga0373956_0035810
712 Ga0373927_0043107
713 Ga0316582_0008042
714 Ga0373925_0226362
715 Ga0395899_0060596
716 Ga0395905_0016901
717 Ga0436364_0719886
718 Ga0436364_1503970
719 Ga0395901_0029112
720 Ga0395901_0095876
721 Ga0436365_0468913
722 Ga0436363_0695344
723 Ga0436363_1507929
724 Ga0436362_0458969
725 Ga0439434_0011381
726 Ga0439435_0016116
727 Ga0451577_0009112
728 Ga0451577_0034786
729 Ga0451577_0063671
730 Ga0466963_0058356
731 Ga0466959_0033088
732 Ga0451576_0023293
733 Ga0495580_0040119
734 Ga0495630_0009364
735 Ga0495652_0017261
736 Ga0495665_0002932
737 Ga0495669_0036111
738 Ga0495649_0055513
739 Ga0495674_0012993
740 Ga0495674_0172962
741 Ga0495680_0109910
742 Ga0495687_008154
743 Ga0496100_0040452
744 Ga0496101_0188073
745 Ga0496102_0130932
746 Ga0496104_0001524
747 Ga0496104_0015910
748 Ga0496105_0028879
749 Ga0496106_0000009
750 Ga0496106_0015317
751 Ga0496107_0048697
752 Ga0496108_0003428
753 Ga0496108_0004093
754 Ga0496108_0096409
755 Ga0496109_0009837
756 Ga0496110_0008678
757 Ga0496110_0012401
758 Ga0496110_0018442
759 Ga0496111_0026517
760 Ga0496111_0057496
761 Ga0496111_0057647
762 Ga0496112_0015791
763 Ga0496112_0054718
764 Ga0496112_0157088
765 Ga0496113_0026370
766 Ga0496114_0120339
767 Ga0496115_0033772
768 Ga0496121_0001357
769 Ga0496125_0000482
770 Ga0501032_0041708
771 Ga0501034_0082496
772 Ga0501038_0019454
773 Ga0501047_0035431
774 Ga0501047_0059156
775 Ga0501047_0141709
776 Ga0501067_0092518
777 Ga0501069_0001265
778 Ga0501069_0086967
779 Ga0501070_0062002
780 Ga0501071_0180116
781 Ga0501072_0007021
782 Ga0501072_0030616
783 Ga0501073_0002754
784 Ga0501073_0010326
785 Ga0501073_0029001
786 Ga0501074_0002933
787 Ga0501074_0023546
788 Ga0501074_0063577
789 Ga0501075_0043416
790 Ga0501076_0034562
791 Ga0501079_0023198
792 Ga0501079_0135245
793 Ga0501080_0005824
794 Ga0501080_0088584
795 Ga0501083_0016214
796 Ga0501083_0025763
797 Ga0501044_0198757
798 Ga0501045_0067141
799 nmdc:mga03n38_28218_c1
800 nmdc:mga06z11_2329_c1
801 nmdc:mga04h51_9422_c1
802 nmdc:mga05p37_50527_c1
803 nmdc:mga09592_57407_c1
804 nmdc:mga09592_61_c1
805 nmdc:mga09592_8319_c1
806 nmdc:mga0qj67_149949_c1
807 nmdc:mga0qj67_852_c1
808 nmdc:mga06r32_121391_c1
809 nmdc:mga06r32_18272_c1
810 nmdc:mga06r32_55885_c1
811 nmdc:mga0n895_914_c1
812 nmdc:mga0rr50_16737_c1
813 nmdc:mga0rr50_25744_c1
814 nmdc:mga08x19_104378_c1
815 nmdc:mga08x19_3389_c1
816 Ga0495619_0099365
817 Ga0501084_0063045
818 Ga0501082_0295190
819 Ga0530510_0105889
820 2512345966
821 2644122007
822 2644301471
823 2644742725
824 2712469912
825 2723876287
826 2840882303
827 2857542091
828 2858951000
829 2889307411
830 2894774603
831 2908673456
832 3007808840

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00815

Histidinol_dh

Histidinol dehydrogenase

10

415

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vld-assembly1.cif.gz_B crystal structure of medicago truncatula l-histidinol dehydrogenase in complex with l-histidine and nad+ 0.9138 20 423
4g09-assembly1.cif.gz_A-2 the crystal structure of the c366s mutant of hdh from brucella suis in complex with a substituted benzyl ketone 0.9096 15 423
1kar-assembly1.cif.gz_B l-histidinol dehydrogenase (hisd) structure complexed with histamine (inhibitor), zinc and nad (cofactor) 0.9093 17 428
5vlc-assembly2.cif.gz_D crystal structure of medicago truncatula l-histidinol dehydrogenase in complex with l-histidinol 0.9068 11 423
5vlc-assembly3.cif.gz_E crystal structure of medicago truncatula l-histidinol dehydrogenase in complex with l-histidinol 0.9041 11 428
ID Description Score Start End Superfamily
af_Q2FUT8_220_366_3.40.50.1980 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9559 224 372 3.40.50.1980
5vlbA03 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.9525 386 423 1.20.5.1300
af_Q2FUT8_220_366_3.40.50.1980 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9497 224 372 3.40.50.1980
6an0A03 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.948 386 423 1.20.5.1300
4g07A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9474 226 372 3.40.50.1980
ID Description Score Start End GO Terms
AF-A0A4R5J7Z8-F1-model_v4 Histidinol dehydrogenase (EC 1.1.1.23) 0.9834 43 382 GO:0000105
GO:0004399
GO:0005829
GO:0046872
GO:0051287
AF-A0A2D7VL41-F1-model_v4 Histidinol dehydrogenase 0.9781 29 433 GO:0000105
GO:0004399
GO:0005829
GO:0046872
GO:0051287
AF-A0A2D4QVB1-F1-model_v4 Histidinol dehydrogenase 0.978 4 376 GO:0000105
GO:0004399
GO:0005829
GO:0046872
GO:0051287
AF-A0A4R5J7Z8-F1-model_v4 Histidinol dehydrogenase (EC 1.1.1.23) 0.9777 43 382 GO:0000105
GO:0004399
GO:0005829
GO:0046872
GO:0051287
AF-A0A4Q3ISW6-F1-model_v4 Histidinol dehydrogenase (EC 1.1.1.23) 0.9777 48 438 GO:0000105
GO:0004399
GO:0005829
GO:0046872
GO:0051287

Map