F438738

General Info

Members Datasets Scaffolds Average Seq Length
416 198 832 195

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10016409|Ga0070681_100164092
Length 215
Sequence MLSFAAPTFARRGRVASGVQTGTPLQRIVREHRRVIVPLAIVFGINVVVYAALVYPLAQRVANIEQRDRTAEDQLRGAQRDFSQANGTLTGKDRATAELATFYKDVLPPDLAGARRLTHLRLAQLARDANLQFVRATFESVPPKDGTLAQLKIEMALSGSYTNVRAFIHQLETAPEFVVIDNIELGQGADAGPLAVTLHLSTYYRETGPGRDVAQ

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
147 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
153 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
154 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
157 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
158 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
159 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
160 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
161 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
162 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
163 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
164 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
165 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
166 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
167 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
168 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
169 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
170 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
171 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
172 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
173 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
174 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
175 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
176 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
177 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
181 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
182 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
183 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
184 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
185 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
186 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
187 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
188 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
189 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
190 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
193 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
194 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
195 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
196 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
197 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
198 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.4
Nodule 0
Rhizoplane 0.48
Rhizosphere 97.12
Stem 0
Stem Tuber 0
Unclassified 28.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10016409 3300005458 Bacteria 7393
2 MBSR1b_contig_10200774 2162886012 Bacteria 1195
3 JGI24743J22301_10075159 3300001991 Bacteria 708
4 JGI25406J46586_10004563 3300003203 Bacteria 6447
5 JGI25406J46586_10012231 3300003203 Bacteria 3732
6 Ga0065704_10078543 3300005289 Bacteria 4398
7 Ga0065704_10101379 3300005289 Bacteria 2239
8 Ga0065712_10292820 3300005290 Bacteria 874
9 Ga0065715_10003369 3300005293 Bacteria 4076
10 Ga0065707_10000580 3300005295 Bacteria 18810
11 Ga0065707_10156956 3300005295 Unclassified 1599
12 Ga0070658_10218043 3300005327 Bacteria 1613
13 Ga0070658_10601382 3300005327 Unclassified 953
14 Ga0070676_10035005 3300005328 Bacteria 2886
15 Ga0070683_100018356 3300005329 Bacteria 6194
16 Ga0070683_100097299 3300005329 Bacteria 2769
17 Ga0070683_100287190 3300005329 Bacteria 1565
18 Ga0070690_100183040 3300005330 Bacteria 1449
19 Ga0070670_100006308 3300005331 Bacteria 10038
20 Ga0070670_100243107 3300005331 Bacteria 1567
21 Ga0070670_100256540 3300005331 Bacteria 1524
22 Ga0070670_100264069 3300005331 Bacteria 1501
23 Ga0070670_100646925 3300005331 Unclassified 948
24 Ga0070670_100829552 3300005331 Unclassified 836
25 Ga0070677_10108460 3300005333 Bacteria 1236
26 Ga0068869_100205559 3300005334 Bacteria 1555
27 Ga0070666_10548165 3300005335 Unclassified 841
28 Ga0070680_100513990 3300005336 Unclassified 1025
29 Ga0070682_100948683 3300005337 Bacteria 710
30 Ga0068868_100110791 3300005338 Unclassified 2230
31 Ga0068868_100493548 3300005338 Unclassified 1071
32 Ga0070687_100030336 3300005343 Bacteria 2643
33 Ga0070661_100058003 3300005344 Bacteria 2837
34 Ga0070692_10062482 3300005345 Unclassified 1965
35 Ga0070668_100072155 3300005347 Bacteria 2690
36 Ga0070668_100494178 3300005347 Unclassified 1058
37 Ga0070669_100001509 3300005353 Bacteria 16808
38 Ga0070669_100003689 3300005353 Bacteria 11045
39 Ga0070675_100000418 3300005354 Bacteria 28967
40 Ga0070675_100231726 3300005354 Unclassified 1611
41 Ga0070675_100323410 3300005354 Bacteria 1363
42 Ga0070675_100324578 3300005354 Unclassified 1360
43 Ga0070675_100390516 3300005354 Bacteria 1240
44 Ga0070675_100492920 3300005354 Bacteria 1103
45 Ga0070675_100721625 3300005354 Unclassified 908
46 Ga0070671_100007700 3300005355 Bacteria 8605
47 Ga0070671_100009898 3300005355 Bacteria 7657
48 Ga0070671_100408656 3300005355 Bacteria 1162
49 Ga0070674_100007443 3300005356 Bacteria 6459
50 Ga0070674_100471345 3300005356 Unclassified 1040
51 Ga0070673_100681399 3300005364 Unclassified 943
52 Ga0070688_100018329 3300005365 Bacteria 4038
53 Ga0070688_100067543 3300005365 Bacteria 2278
54 Ga0070659_100292346 3300005366 Unclassified 1357
55 Ga0070703_10155809 3300005406 Unclassified 862
56 Ga0070701_10007362 3300005438 Bacteria 4696
57 Ga0070701_10014117 3300005438 Bacteria 3654
58 Ga0070705_100002911 3300005440 Bacteria 8466
59 Ga0070705_100017639 3300005440 Bacteria 3729
60 Ga0070705_100156138 3300005440 Bacteria 1520
61 Ga0070700_100090417 3300005441 Bacteria 1996
62 Ga0070700_100748360 3300005441 Unclassified 782
63 Ga0070694_100003844 3300005444 Bacteria 8971
64 Ga0070694_100021850 3300005444 Bacteria 4094
65 Ga0070694_100035035 3300005444 Bacteria 3315
66 Ga0070694_100050592 3300005444 Bacteria 2802
67 Ga0070694_100057068 3300005444 Bacteria 2654
68 Ga0070694_100329145 3300005444 Bacteria 1178
69 Ga0070663_100244779 3300005455 Unclassified 1417
70 Ga0070678_100767371 3300005456 Unclassified 873
71 Ga0070662_100068933 3300005457 Bacteria 2601
72 Ga0070662_100176646 3300005457 Unclassified 1681
73 Ga0070662_100403333 3300005457 Bacteria 1129
74 Ga0070681_11137244 3300005458 Unclassified 702
75 Ga0068867_100095228 3300005459 Bacteria 2265
76 Ga0070685_10119966 3300005466 Unclassified 1632
77 Ga0070706_100096272 3300005467 Unclassified 2748
78 Ga0070707_100039465 3300005468 Bacteria 4512
79 Ga0070707_100117623 3300005468 Bacteria 2580
80 Ga0070698_100004727 3300005471 Bacteria 14954
81 Ga0070698_100008860 3300005471 Bacteria 10816
82 Ga0070698_100037394 3300005471 Bacteria 5005
83 Ga0070698_100220234 3300005471 Unclassified 1831
84 Ga0070698_100260594 3300005471 Unclassified 1666
85 Ga0070698_100298403 3300005471 Bacteria 1542
86 Ga0070699_100001775 3300005518 Bacteria 19647
87 Ga0070699_100015376 3300005518 Bacteria 6576
88 Ga0070699_100348671 3300005518 Bacteria 1333
89 Ga0070679_100084088 3300005530 Bacteria 3170
90 Ga0070684_100029957 3300005535 Bacteria 4619
91 Ga0070684_100544911 3300005535 Unclassified 1076
92 Ga0070684_100671288 3300005535 Bacteria 965
93 Ga0070697_100035251 3300005536 Unclassified 4035
94 Ga0070697_100229055 3300005536 Bacteria 1585
95 Ga0070697_100244888 3300005536 Bacteria 1532
96 Ga0070672_100080543 3300005543 Bacteria 2609
97 Ga0070672_100085990 3300005543 Unclassified 2528
98 Ga0070672_100105124 3300005543 Bacteria 2295
99 Ga0070672_100120750 3300005543 Bacteria 2145
100 Ga0070672_100244817 3300005543 Bacteria 1509
101 Ga0070672_100960498 3300005543 Unclassified 756
102 Ga0070686_100208879 3300005544 Unclassified 1404
103 Ga0070695_100000733 3300005545 Bacteria 17565
104 Ga0070695_100382342 3300005545 Unclassified 1063
105 Ga0070696_100000876 3300005546 Bacteria 19481
106 Ga0070696_100031971 3300005546 Bacteria 3609
107 Ga0070696_100038434 3300005546 Bacteria 3303
108 Ga0070696_100543268 3300005546 Unclassified 930
109 Ga0070704_100000507 3300005549 Bacteria 18528
110 Ga0070704_100018952 3300005549 Bacteria 4414
111 Ga0070704_100154049 3300005549 Bacteria 1810
112 Ga0070704_100486501 3300005549 Unclassified 1069
113 Ga0070664_100016721 3300005564 Bacteria 6016
114 Ga0070664_100018959 3300005564 Bacteria 5657
115 Ga0070664_100176119 3300005564 Unclassified 1899
116 Ga0068857_100006747 3300005577 Bacteria 9871
117 Ga0068857_100173154 3300005577 Bacteria 1962
118 Ga0068857_100210739 3300005577 Unclassified 1773
119 Ga0068854_100205860 3300005578 Unclassified 1549
120 Ga0070702_100078243 3300005615 Bacteria 1974
121 Ga0070702_100122211 3300005615 Unclassified 1632
122 Ga0068859_100005628 3300005617 Bacteria 12772
123 Ga0068859_100031941 3300005617 Bacteria 5289
124 Ga0068859_100174785 3300005617 Unclassified 2229
125 Ga0068859_101771729 3300005617 Bacteria 682
126 Ga0068864_100003019 3300005618 Bacteria 13911
127 Ga0068864_100260464 3300005618 Bacteria 1613
128 Ga0068864_100288997 3300005618 Unclassified 1532
129 Ga0068861_100004765 3300005719 Bacteria 9119
130 Ga0068861_100701221 3300005719 Bacteria 941
131 Ga0068870_10038919 3300005840 Bacteria 2458
132 Ga0068863_100020710 3300005841 Bacteria 6281
133 Ga0068858_100192884 3300005842 Unclassified 1925
134 Ga0068860_100058371 3300005843 Bacteria 3668
135 Ga0068862_100000802 3300005844 Bacteria 31167
136 Ga0068862_100287258 3300005844 Bacteria 1509
137 Ga0081455_10348136 3300005937 Bacteria 1046
138 Ga0081539_10000056 3300005985 Bacteria 256522
139 Ga0081539_10000460 3300005985 Bacteria 86291
140 Ga0075368_10100918 3300006042 Unclassified 1185
141 Ga0075364_10022836 3300006051 Bacteria 3957
142 Ga0075367_10049676 3300006178 Bacteria 2473
143 Ga0075366_10057834 3300006195 Unclassified 2304
144 Ga0097621_100864270 3300006237 Unclassified 841
145 Ga0068871_100112652 3300006358 Unclassified 2290
146 Ga0075428_100001053 3300006844 Bacteria 29306
147 Ga0075428_100131836 3300006844 Bacteria 2718
148 Ga0075428_100864276 3300006844 Bacteria 960
149 Ga0075430_100056627 3300006846 Unclassified 3297
150 Ga0075431_100050487 3300006847 Unclassified 4289
151 Ga0075431_100750004 3300006847 Bacteria 952
152 Ga0075433_10032060 3300006852 Unclassified 4498
153 Ga0075433_10034745 3300006852 Bacteria 4332
154 Ga0075433_10172910 3300006852 Bacteria 1922
155 Ga0075433_10195675 3300006852 Unclassified 1798
156 Ga0075433_10288186 3300006852 Bacteria 1454
157 Ga0075434_100000605 3300006871 Bacteria 27797
158 Ga0075434_100029718 3300006871 Bacteria 5379
159 Ga0075434_100031917 3300006871 Bacteria 5193
160 Ga0075434_100124704 3300006871 Bacteria 2593
161 Ga0075434_100335770 3300006871 Bacteria 1532
162 Ga0075434_100470785 3300006871 Bacteria 1278
163 Ga0075434_100537542 3300006871 Bacteria 1189
164 Ga0075429_100429533 3300006880 Bacteria 1157
165 Ga0075429_100606084 3300006880 Bacteria 959
166 Ga0068865_100240460 3300006881 Unclassified 1424
167 Ga0068865_100592569 3300006881 Bacteria 936
168 Ga0075436_100125738 3300006914 Bacteria 1796
169 Ga0097620_100005628 3300006931 Bacteria 12772
170 Ga0097620_100031943 3300006931 Bacteria 5289
171 Ga0097620_100174780 3300006931 Unclassified 2229
172 Ga0097620_101770889 3300006931 Bacteria 682
173 Ga0075435_100007369 3300007076 Bacteria 7835
174 Ga0075435_100118509 3300007076 Unclassified 2207
175 Ga0075435_100173091 3300007076 Bacteria 1822
176 Ga0075435_100298254 3300007076 Bacteria 1378
177 Ga0075435_100795551 3300007076 Bacteria 823
178 Ga0111539_10003053 3300009094 Bacteria 22182
179 Ga0111539_10004393 3300009094 Bacteria 18443
180 Ga0111539_10026887 3300009094 Bacteria 7029
181 Ga0111539_10035018 3300009094 Bacteria 6080
182 Ga0111539_10220555 3300009094 Unclassified 2209
183 Ga0111539_12203791 3300009094 Unclassified 639
184 Ga0114129_10002240 3300009147 Bacteria 26690
185 Ga0114129_10017216 3300009147 Bacteria 10294
186 Ga0114129_10045581 3300009147 Bacteria 6163
187 Ga0114129_10045881 3300009147 Bacteria 6142
188 Ga0114129_10088026 3300009147 Bacteria 4306
189 Ga0114129_10148758 3300009147 Unclassified 3206
190 Ga0114129_10191702 3300009147 Unclassified 2775
191 Ga0114129_11216667 3300009147 Bacteria 937
192 Ga0105243_10245433 3300009148 Bacteria 1596
193 Ga0105243_10289122 3300009148 Bacteria 1480
194 Ga0105243_10608313 3300009148 Bacteria 1053
195 Ga0105242_10093728 3300009176 Bacteria 2532
196 Ga0105249_10001329 3300009553 Bacteria 21642
197 Ga0105249_10010483 3300009553 Bacteria 8143
198 Ga0105249_11476489 3300009553 Unclassified 752
199 Ga0157378_10160587 3300013297 Unclassified 2101
200 Ga0163162_10079673 3300013306 Bacteria 3341
201 Ga0157375_10006655 3300013308 Bacteria 10060
202 Ga0157375_10956906 3300013308 Unclassified 998
203 Ga0157380_10061348 3300014326 Bacteria 3008
204 Ga0157380_10516401 3300014326 Bacteria 1164
205 Ga0157380_10854249 3300014326 Unclassified 932
206 Ga0157377_10042564 3300014745 Bacteria 2523
207 Ga0157377_10572786 3300014745 Unclassified 801
208 Ga0157379_10127905 3300014968 Bacteria 2286
209 Ga0157376_10125109 3300014969 Bacteria 2285
210 Ga0207673_1003929 3300025290 Bacteria 1757
211 Ga0207697_10002039 3300025315 Bacteria 10663
212 Ga0207697_10295603 3300025315 Unclassified 718
213 Ga0207682_10015070 3300025893 Unclassified 3010
214 Ga0207688_10040484 3300025901 Bacteria 2590
215 Ga0207680_10157941 3300025903 Bacteria 1518
216 Ga0207680_10261794 3300025903 Unclassified 1197
217 Ga0207643_10015626 3300025908 Bacteria 4132
218 Ga0207684_10397990 3300025910 Unclassified 1184
219 Ga0207662_10005764 3300025918 Bacteria 6630
220 Ga0207662_10022870 3300025918 Bacteria 3588
221 Ga0207649_10248025 3300025920 Bacteria 1281
222 Ga0207649_10340253 3300025920 Bacteria 1108
223 Ga0207649_10691547 3300025920 Unclassified 790
224 Ga0207646_10052244 3300025922 Unclassified 3657
225 Ga0207646_10119536 3300025922 Unclassified 2367
226 Ga0207646_10374597 3300025922 Bacteria 1286
227 Ga0207681_10001159 3300025923 Bacteria 17016
228 Ga0207681_10450650 3300025923 Bacteria 1047
229 Ga0207681_10935974 3300025923 Bacteria 726
230 Ga0207650_10066924 3300025925 Unclassified 2695
231 Ga0207650_10100300 3300025925 Bacteria 2227
232 Ga0207650_10226693 3300025925 Bacteria 1506
233 Ga0207659_10015975 3300025926 Bacteria 4877
234 Ga0207659_10160372 3300025926 Bacteria 1765
235 Ga0207659_10176535 3300025926 Bacteria 1689
236 Ga0207644_10058467 3300025931 Bacteria 2787
237 Ga0207644_10063099 3300025931 Bacteria 2689
238 Ga0207706_10130384 3300025933 Unclassified 2211
239 Ga0207706_10135752 3300025933 Bacteria 2164
240 Ga0207686_10088283 3300025934 Bacteria 2041
241 Ga0207709_10053948 3300025935 Bacteria 2476
242 Ga0207670_10042820 3300025936 Bacteria 2986
243 Ga0207670_10391396 3300025936 Unclassified 1109
244 Ga0207669_10416622 3300025937 Unclassified 1056
245 Ga0207704_10192459 3300025938 Unclassified 1485
246 Ga0207691_10082996 3300025940 Bacteria 2877
247 Ga0207691_10085913 3300025940 Bacteria 2823
248 Ga0207691_10104133 3300025940 Unclassified 2529
249 Ga0207691_10157455 3300025940 Bacteria 1994
250 Ga0207661_10041123 3300025944 Bacteria 3638
251 Ga0207661_10247427 3300025944 Bacteria 1584
252 Ga0207661_10684555 3300025944 Bacteria 943
253 Ga0207679_10010058 3300025945 Bacteria 6078
254 Ga0207679_10417083 3300025945 Bacteria 1184
255 Ga0207651_10037100 3300025960 Unclassified 3190
256 Ga0207651_10274816 3300025960 Bacteria 1389
257 Ga0207651_10327707 3300025960 Unclassified 1282
258 Ga0207712_10004447 3300025961 Bacteria 8854
259 Ga0207712_10008142 3300025961 Bacteria 6631
260 Ga0207668_10020138 3300025972 Bacteria 4232
261 Ga0207668_10539486 3300025972 Unclassified 1009
262 Ga0207668_10658473 3300025972 Unclassified 917
263 Ga0207640_10545200 3300025981 Bacteria 973
264 Ga0207703_10110007 3300026035 Bacteria 2350
265 Ga0207678_10263976 3300026067 Unclassified 1476
266 Ga0207641_10314625 3300026088 Unclassified 1483
267 Ga0207648_10004352 3300026089 Bacteria 14568
268 Ga0207676_10141951 3300026095 Bacteria 2057
269 Ga0207674_10073864 3300026116 Bacteria 3423
270 Ga0207674_10176269 3300026116 Bacteria 2090
271 Ga0207675_100002112 3300026118 Bacteria 19689
272 Ga0207675_100068265 3300026118 Bacteria 3323
273 Ga0207683_10675156 3300026121 Unclassified 957
274 Ga0207698_10671499 3300026142 Unclassified 1028
275 Ga0207428_10004368 3300027907 Bacteria 13487
276 Ga0207428_10006273 3300027907 Bacteria 10991
277 Ga0268265_10000611 3300028380 Bacteria 35660
278 Ga0268265_10006376 3300028380 Bacteria 7997
279 Ga0268264_10009154 3300028381 Bacteria 8209
280 Ga0307408_100188444 3300031548 Bacteria 1660
281 Ga0307408_100891884 3300031548 Unclassified 813
282 Ga0307408_100894439 3300031548 Unclassified 812
283 Ga0307405_10001810 3300031731 Bacteria 9152
284 Ga0307405_10072586 3300031731 Bacteria 2219
285 Ga0307405_10140721 3300031731 Bacteria 1682
286 Ga0307413_10017867 3300031824 Bacteria 3705
287 Ga0307413_10220838 3300031824 Unclassified 1384
288 Ga0307413_10675302 3300031824 Unclassified 855
289 Ga0307410_10005259 3300031852 Bacteria 6823
290 Ga0307410_10279385 3300031852 Unclassified 1309
291 Ga0307410_10416139 3300031852 Bacteria 1089
292 Ga0307410_10428666 3300031852 Bacteria 1074
293 Ga0307406_10014572 3300031901 Bacteria 4527
294 Ga0307406_10367908 3300031901 Bacteria 1129
295 Ga0307407_10002168 3300031903 Bacteria 7557
296 Ga0307407_10006681 3300031903 Bacteria 5156
297 Ga0307412_10004131 3300031911 Bacteria 8091
298 Ga0307412_10787449 3300031911 Unclassified 824
299 Ga0307409_100010088 3300031995 Bacteria 5846
300 Ga0307409_100031760 3300031995 Bacteria 3817
301 Ga0307409_100062695 3300031995 Unclassified 2911
302 Ga0307409_100369513 3300031995 Bacteria 1360
303 Ga0307409_100480180 3300031995 Unclassified 1206
304 Ga0307409_100648862 3300031995 Bacteria 1049
305 Ga0307416_100092045 3300032002 Unclassified 2606
306 Ga0307416_100099610 3300032002 Bacteria 2524
307 Ga0307416_100319780 3300032002 Bacteria 1553
308 Ga0307416_100393948 3300032002 Bacteria 1420
309 Ga0307416_101162313 3300032002 Bacteria 877
310 Ga0307414_10045920 3300032004 Unclassified 2994
311 Ga0307411_10161180 3300032005 Unclassified 1680
312 Ga0307411_10289440 3300032005 Bacteria 1308
313 Ga0307411_10692540 3300032005 Unclassified 887
314 Ga0307411_10833356 3300032005 Bacteria 815
315 Ga0307411_10984354 3300032005 Bacteria 754
316 Ga0307415_100009708 3300032126 Bacteria 5414
317 Ga0373949_0051736 3300035090 Bacteria 1036
318 Ga0373960_0022440 3300035121 Unclassified 1690
319 Ga0373931_0197502 3300035691 Bacteria 1200
320 Ga0373935_0119921 3300035692 Bacteria 1756
321 Ga0373935_0293428 3300035692 Bacteria 1148
322 Ga0373937_0091955 3300036401 Unclassified 2812
323 Ga0373925_0498558 3300037068 Bacteria 1000
324 Ga0439457_024969 3300042014 Bacteria 1323
325 Ga0450908_010861 3300042184 Unclassified 1674
326 Ga0451577_0524060 3300042876 Bacteria 1076
327 Ga0451577_0733496 3300042876 Bacteria 894
328 Ga0451576_0003716 3300045051 Bacteria 20635
329 Ga0451576_0009898 3300045051 Bacteria 11008
330 Ga0451576_0049496 3300045051 Bacteria 4410
331 Ga0451576_0101895 3300045051 Unclassified 2986
332 Ga0495603_0010704 3300046455 Bacteria 5563
333 Ga0495603_0144911 3300046455 Bacteria 1381
334 Ga0495629_0104623 3300046459 Bacteria 1974
335 Ga0495638_0249817 3300046460 Bacteria 978
336 Ga0495641_0038069 3300046461 Unclassified 2249
337 Ga0495584_0028186 3300046491 Unclassified 2845
338 Ga0495594_0009157 3300046499 Bacteria 5109
339 Ga0495643_0011804 3300046522 Bacteria 5299
340 Ga0495644_0265302 3300046523 Unclassified 668
341 Ga0495642_0031700 3300046528 Bacteria 2120
342 Ga0495598_0011348 3300046537 Bacteria 2158
343 Ga0495598_0277702 3300046537 Bacteria 628
344 Ga0495609_0075811 3300046538 Bacteria 1474
345 Ga0495609_0198389 3300046538 Bacteria 840
346 Ga0495621_0006253 3300046539 Bacteria 3465
347 Ga0495621_0010527 3300046539 Bacteria 2832
348 Ga0495621_0025423 3300046539 Bacteria 1989
349 Ga0495659_0001879 3300046664 Bacteria 6936
350 Ga0495659_0004112 3300046664 Bacteria 4596
351 Ga0495659_0044518 3300046664 Bacteria 1596
352 Ga0495659_0073561 3300046664 Bacteria 1285
353 Ga0495659_0096072 3300046664 Bacteria 1143
354 Ga0495599_0542883 3300046678 Bacteria 681
355 Ga0495623_0159796 3300046679 Bacteria 1325
356 Ga0495658_0063292 3300046683 Unclassified 2128
357 Ga0495658_0295803 3300046683 Bacteria 1023
358 Ga0495669_0064909 3300046684 Bacteria 1657
359 Ga0495669_0204261 3300046684 Bacteria 945
360 Ga0495581_0403944 3300047315 Unclassified 797
361 Ga0495636_0013340 3300047318 Bacteria 3261
362 Ga0495676_0065060 3300047321 Bacteria 2832
363 Ga0495677_0098195 3300047445 Bacteria 1107
364 Ga0495685_052494 3300047447 Bacteria 1381
365 Ga0496108_0790213 3300048911 Unclassified 819
366 Ga0496109_0332576 3300048912 Unclassified 1434
367 Ga0501075_0192026 3300049591 Unclassified 1558
368 Ga0501076_0220914 3300049592 Unclassified 1549
369 Ga0501076_1166292 3300049592 Archaea 634
370 Ga0501081_0533702 3300049743 Bacteria 876
371 nmdc:mga03683_134808_c1 3300050489 Unclassified 1107
372 nmdc:mga00v17_8372_c1 3300050491 Bacteria 5564
373 nmdc:mga0k408_149501_c1 3300050493 Unclassified 1391
374 nmdc:mga06z11_184772_c1 3300050494 Unclassified 1204
375 nmdc:mga06z11_26658_c1 3300050494 Bacteria 2753
376 nmdc:mga05p37_11871_c1 3300050507 Bacteria 10386
377 nmdc:mga05p37_178042_c1 3300050507 Bacteria 2589
378 nmdc:mga05p37_25206_c1 3300050507 Bacteria 7232
379 nmdc:mga05p37_26671_c1 3300050507 Bacteria 7026
380 nmdc:mga05p37_43580_c1 3300050507 Bacteria 5520
381 nmdc:mga05p37_82730_c1 3300050507 Bacteria 3956
382 nmdc:mga09592_111217_c1 3300050508 Bacteria 2350
383 nmdc:mga09592_129190_c1 3300050508 Bacteria 2173
384 nmdc:mga09592_1670_c1 3300050508 Bacteria 17897
385 nmdc:mga09592_71651_c1 3300050508 Unclassified 2941
386 nmdc:mga0qj67_168769_c1 3300050509 Unclassified 1777
387 nmdc:mga0qj67_56771_c1 3300050509 Unclassified 3104
388 nmdc:mga06r32_13201_c1 3300050510 Bacteria 7481
389 nmdc:mga06r32_31303_c1 3300050510 Unclassified 4995
390 nmdc:mga06r32_453854_c1 3300050510 Unclassified 1261
391 nmdc:mga08y16_11133_c1 3300050511 Bacteria 9446
392 nmdc:mga08y16_17720_c1 3300050511 Bacteria 7500
393 nmdc:mga08y16_211446_c1 3300050511 Bacteria 2009
394 nmdc:mga08y16_356386_c1 3300050511 Unclassified 1502
395 nmdc:mga08y16_6853_c1 3300050511 Bacteria 11946
396 nmdc:mga0n895_11787_c1 3300050512 Bacteria 7816
397 nmdc:mga0n895_1341_c1 3300050512 Bacteria 18242
398 nmdc:mga0n895_25034_c1 3300050512 Bacteria 5634
399 nmdc:mga0n895_40297_c1 3300050512 Unclassified 4537
400 nmdc:mga0n895_439474_c1 3300050512 Bacteria 1318
401 nmdc:mga0n895_480081_c1 3300050512 Bacteria 1254
402 nmdc:mga0n895_496467_c1 3300050512 Bacteria 1230
403 nmdc:mga0rr50_11143_c1 3300050513 Bacteria 5737
404 nmdc:mga0rr50_37603_c1 3300050513 Bacteria 3495
405 nmdc:mga0rr50_518425_c1 3300050513 Bacteria 1014
406 nmdc:mga0rr50_766898_c1 3300050513 Bacteria 823
407 nmdc:mga0rr50_82382_c1 3300050513 Bacteria 2485
408 nmdc:mga0a205_205288_c1 3300050515 Bacteria 1860
409 nmdc:mga0a205_458374_c1 3300050515 Bacteria 1134
410 nmdc:mga0a205_608448_c1 3300050515 Bacteria 946
411 nmdc:mga0a205_6140_c1 3300050515 Bacteria 10839
412 nmdc:mga0a205_8131_c1 3300050515 Bacteria 7567
413 Ga0500568_0001330 3300053139 Bacteria 16198
414 Ga0590071_003295 3300059421 Bacteria 3975
415 Ga0590075_000972 3300059424 Bacteria 7438
416 Ga0590077_000623 3300059426 Bacteria 9517
417 Ga0070681_10016409
418 MBSR1b_contig_10200774
419 JGI24743J22301_10075159
420 JGI25406J46586_10004563
421 JGI25406J46586_10012231
422 Ga0065704_10078543
423 Ga0065704_10101379
424 Ga0065712_10292820
425 Ga0065715_10003369
426 Ga0065707_10000580
427 Ga0065707_10156956
428 Ga0070658_10218043
429 Ga0070658_10601382
430 Ga0070676_10035005
431 Ga0070683_100018356
432 Ga0070683_100097299
433 Ga0070683_100287190
434 Ga0070690_100183040
435 Ga0070670_100006308
436 Ga0070670_100243107
437 Ga0070670_100256540
438 Ga0070670_100264069
439 Ga0070670_100646925
440 Ga0070670_100829552
441 Ga0070677_10108460
442 Ga0068869_100205559
443 Ga0070666_10548165
444 Ga0070680_100513990
445 Ga0070682_100948683
446 Ga0068868_100110791
447 Ga0068868_100493548
448 Ga0070687_100030336
449 Ga0070661_100058003
450 Ga0070692_10062482
451 Ga0070668_100072155
452 Ga0070668_100494178
453 Ga0070669_100001509
454 Ga0070669_100003689
455 Ga0070675_100000418
456 Ga0070675_100231726
457 Ga0070675_100323410
458 Ga0070675_100324578
459 Ga0070675_100390516
460 Ga0070675_100492920
461 Ga0070675_100721625
462 Ga0070671_100007700
463 Ga0070671_100009898
464 Ga0070671_100408656
465 Ga0070674_100007443
466 Ga0070674_100471345
467 Ga0070673_100681399
468 Ga0070688_100018329
469 Ga0070688_100067543
470 Ga0070659_100292346
471 Ga0070703_10155809
472 Ga0070701_10007362
473 Ga0070701_10014117
474 Ga0070705_100002911
475 Ga0070705_100017639
476 Ga0070705_100156138
477 Ga0070700_100090417
478 Ga0070700_100748360
479 Ga0070694_100003844
480 Ga0070694_100021850
481 Ga0070694_100035035
482 Ga0070694_100050592
483 Ga0070694_100057068
484 Ga0070694_100329145
485 Ga0070663_100244779
486 Ga0070678_100767371
487 Ga0070662_100068933
488 Ga0070662_100176646
489 Ga0070662_100403333
490 Ga0070681_11137244
491 Ga0068867_100095228
492 Ga0070685_10119966
493 Ga0070706_100096272
494 Ga0070707_100039465
495 Ga0070707_100117623
496 Ga0070698_100004727
497 Ga0070698_100008860
498 Ga0070698_100037394
499 Ga0070698_100220234
500 Ga0070698_100260594
501 Ga0070698_100298403
502 Ga0070699_100001775
503 Ga0070699_100015376
504 Ga0070699_100348671
505 Ga0070679_100084088
506 Ga0070684_100029957
507 Ga0070684_100544911
508 Ga0070684_100671288
509 Ga0070697_100035251
510 Ga0070697_100229055
511 Ga0070697_100244888
512 Ga0070672_100080543
513 Ga0070672_100085990
514 Ga0070672_100105124
515 Ga0070672_100120750
516 Ga0070672_100244817
517 Ga0070672_100960498
518 Ga0070686_100208879
519 Ga0070695_100000733
520 Ga0070695_100382342
521 Ga0070696_100000876
522 Ga0070696_100031971
523 Ga0070696_100038434
524 Ga0070696_100543268
525 Ga0070704_100000507
526 Ga0070704_100018952
527 Ga0070704_100154049
528 Ga0070704_100486501
529 Ga0070664_100016721
530 Ga0070664_100018959
531 Ga0070664_100176119
532 Ga0068857_100006747
533 Ga0068857_100173154
534 Ga0068857_100210739
535 Ga0068854_100205860
536 Ga0070702_100078243
537 Ga0070702_100122211
538 Ga0068859_100005628
539 Ga0068859_100031941
540 Ga0068859_100174785
541 Ga0068859_101771729
542 Ga0068864_100003019
543 Ga0068864_100260464
544 Ga0068864_100288997
545 Ga0068861_100004765
546 Ga0068861_100701221
547 Ga0068870_10038919
548 Ga0068863_100020710
549 Ga0068858_100192884
550 Ga0068860_100058371
551 Ga0068862_100000802
552 Ga0068862_100287258
553 Ga0081455_10348136
554 Ga0081539_10000056
555 Ga0081539_10000460
556 Ga0075368_10100918
557 Ga0075364_10022836
558 Ga0075367_10049676
559 Ga0075366_10057834
560 Ga0097621_100864270
561 Ga0068871_100112652
562 Ga0075428_100001053
563 Ga0075428_100131836
564 Ga0075428_100864276
565 Ga0075430_100056627
566 Ga0075431_100050487
567 Ga0075431_100750004
568 Ga0075433_10032060
569 Ga0075433_10034745
570 Ga0075433_10172910
571 Ga0075433_10195675
572 Ga0075433_10288186
573 Ga0075434_100000605
574 Ga0075434_100029718
575 Ga0075434_100031917
576 Ga0075434_100124704
577 Ga0075434_100335770
578 Ga0075434_100470785
579 Ga0075434_100537542
580 Ga0075429_100429533
581 Ga0075429_100606084
582 Ga0068865_100240460
583 Ga0068865_100592569
584 Ga0075436_100125738
585 Ga0097620_100005628
586 Ga0097620_100031943
587 Ga0097620_100174780
588 Ga0097620_101770889
589 Ga0075435_100007369
590 Ga0075435_100118509
591 Ga0075435_100173091
592 Ga0075435_100298254
593 Ga0075435_100795551
594 Ga0111539_10003053
595 Ga0111539_10004393
596 Ga0111539_10026887
597 Ga0111539_10035018
598 Ga0111539_10220555
599 Ga0111539_12203791
600 Ga0114129_10002240
601 Ga0114129_10017216
602 Ga0114129_10045581
603 Ga0114129_10045881
604 Ga0114129_10088026
605 Ga0114129_10148758
606 Ga0114129_10191702
607 Ga0114129_11216667
608 Ga0105243_10245433
609 Ga0105243_10289122
610 Ga0105243_10608313
611 Ga0105242_10093728
612 Ga0105249_10001329
613 Ga0105249_10010483
614 Ga0105249_11476489
615 Ga0157378_10160587
616 Ga0163162_10079673
617 Ga0157375_10006655
618 Ga0157375_10956906
619 Ga0157380_10061348
620 Ga0157380_10516401
621 Ga0157380_10854249
622 Ga0157377_10042564
623 Ga0157377_10572786
624 Ga0157379_10127905
625 Ga0157376_10125109
626 Ga0207673_1003929
627 Ga0207697_10002039
628 Ga0207697_10295603
629 Ga0207682_10015070
630 Ga0207688_10040484
631 Ga0207680_10157941
632 Ga0207680_10261794
633 Ga0207643_10015626
634 Ga0207684_10397990
635 Ga0207662_10005764
636 Ga0207662_10022870
637 Ga0207649_10248025
638 Ga0207649_10340253
639 Ga0207649_10691547
640 Ga0207646_10052244
641 Ga0207646_10119536
642 Ga0207646_10374597
643 Ga0207681_10001159
644 Ga0207681_10450650
645 Ga0207681_10935974
646 Ga0207650_10066924
647 Ga0207650_10100300
648 Ga0207650_10226693
649 Ga0207659_10015975
650 Ga0207659_10160372
651 Ga0207659_10176535
652 Ga0207644_10058467
653 Ga0207644_10063099
654 Ga0207706_10130384
655 Ga0207706_10135752
656 Ga0207686_10088283
657 Ga0207709_10053948
658 Ga0207670_10042820
659 Ga0207670_10391396
660 Ga0207669_10416622
661 Ga0207704_10192459
662 Ga0207691_10082996
663 Ga0207691_10085913
664 Ga0207691_10104133
665 Ga0207691_10157455
666 Ga0207661_10041123
667 Ga0207661_10247427
668 Ga0207661_10684555
669 Ga0207679_10010058
670 Ga0207679_10417083
671 Ga0207651_10037100
672 Ga0207651_10274816
673 Ga0207651_10327707
674 Ga0207712_10004447
675 Ga0207712_10008142
676 Ga0207668_10020138
677 Ga0207668_10539486
678 Ga0207668_10658473
679 Ga0207640_10545200
680 Ga0207703_10110007
681 Ga0207678_10263976
682 Ga0207641_10314625
683 Ga0207648_10004352
684 Ga0207676_10141951
685 Ga0207674_10073864
686 Ga0207674_10176269
687 Ga0207675_100002112
688 Ga0207675_100068265
689 Ga0207683_10675156
690 Ga0207698_10671499
691 Ga0207428_10004368
692 Ga0207428_10006273
693 Ga0268265_10000611
694 Ga0268265_10006376
695 Ga0268264_10009154
696 Ga0307408_100188444
697 Ga0307408_100891884
698 Ga0307408_100894439
699 Ga0307405_10001810
700 Ga0307405_10072586
701 Ga0307405_10140721
702 Ga0307413_10017867
703 Ga0307413_10220838
704 Ga0307413_10675302
705 Ga0307410_10005259
706 Ga0307410_10279385
707 Ga0307410_10416139
708 Ga0307410_10428666
709 Ga0307406_10014572
710 Ga0307406_10367908
711 Ga0307407_10002168
712 Ga0307407_10006681
713 Ga0307412_10004131
714 Ga0307412_10787449
715 Ga0307409_100010088
716 Ga0307409_100031760
717 Ga0307409_100062695
718 Ga0307409_100369513
719 Ga0307409_100480180
720 Ga0307409_100648862
721 Ga0307416_100092045
722 Ga0307416_100099610
723 Ga0307416_100319780
724 Ga0307416_100393948
725 Ga0307416_101162313
726 Ga0307414_10045920
727 Ga0307411_10161180
728 Ga0307411_10289440
729 Ga0307411_10692540
730 Ga0307411_10833356
731 Ga0307411_10984354
732 Ga0307415_100009708
733 Ga0373949_0051736
734 Ga0373960_0022440
735 Ga0373931_0197502
736 Ga0373935_0119921
737 Ga0373935_0293428
738 Ga0373937_0091955
739 Ga0373925_0498558
740 Ga0439457_024969
741 Ga0450908_010861
742 Ga0451577_0524060
743 Ga0451577_0733496
744 Ga0451576_0003716
745 Ga0451576_0009898
746 Ga0451576_0049496
747 Ga0451576_0101895
748 Ga0495603_0010704
749 Ga0495603_0144911
750 Ga0495629_0104623
751 Ga0495638_0249817
752 Ga0495641_0038069
753 Ga0495584_0028186
754 Ga0495594_0009157
755 Ga0495643_0011804
756 Ga0495644_0265302
757 Ga0495642_0031700
758 Ga0495598_0011348
759 Ga0495598_0277702
760 Ga0495609_0075811
761 Ga0495609_0198389
762 Ga0495621_0006253
763 Ga0495621_0010527
764 Ga0495621_0025423
765 Ga0495659_0001879
766 Ga0495659_0004112
767 Ga0495659_0044518
768 Ga0495659_0073561
769 Ga0495659_0096072
770 Ga0495599_0542883
771 Ga0495623_0159796
772 Ga0495658_0063292
773 Ga0495658_0295803
774 Ga0495669_0064909
775 Ga0495669_0204261
776 Ga0495581_0403944
777 Ga0495636_0013340
778 Ga0495676_0065060
779 Ga0495677_0098195
780 Ga0495685_052494
781 Ga0496108_0790213
782 Ga0496109_0332576
783 Ga0501075_0192026
784 Ga0501076_0220914
785 Ga0501076_1166292
786 Ga0501081_0533702
787 nmdc:mga03683_134808_c1
788 nmdc:mga00v17_8372_c1
789 nmdc:mga0k408_149501_c1
790 nmdc:mga06z11_184772_c1
791 nmdc:mga06z11_26658_c1
792 nmdc:mga05p37_11871_c1
793 nmdc:mga05p37_178042_c1
794 nmdc:mga05p37_25206_c1
795 nmdc:mga05p37_26671_c1
796 nmdc:mga05p37_43580_c1
797 nmdc:mga05p37_82730_c1
798 nmdc:mga09592_111217_c1
799 nmdc:mga09592_129190_c1
800 nmdc:mga09592_1670_c1
801 nmdc:mga09592_71651_c1
802 nmdc:mga0qj67_168769_c1
803 nmdc:mga0qj67_56771_c1
804 nmdc:mga06r32_13201_c1
805 nmdc:mga06r32_31303_c1
806 nmdc:mga06r32_453854_c1
807 nmdc:mga08y16_11133_c1
808 nmdc:mga08y16_17720_c1
809 nmdc:mga08y16_211446_c1
810 nmdc:mga08y16_356386_c1
811 nmdc:mga08y16_6853_c1
812 nmdc:mga0n895_11787_c1
813 nmdc:mga0n895_1341_c1
814 nmdc:mga0n895_25034_c1
815 nmdc:mga0n895_40297_c1
816 nmdc:mga0n895_439474_c1
817 nmdc:mga0n895_480081_c1
818 nmdc:mga0n895_496467_c1
819 nmdc:mga0rr50_11143_c1
820 nmdc:mga0rr50_37603_c1
821 nmdc:mga0rr50_518425_c1
822 nmdc:mga0rr50_766898_c1
823 nmdc:mga0rr50_82382_c1
824 nmdc:mga0a205_205288_c1
825 nmdc:mga0a205_458374_c1
826 nmdc:mga0a205_608448_c1
827 nmdc:mga0a205_6140_c1
828 nmdc:mga0a205_8131_c1
829 Ga0500568_0001330
830 Ga0590071_003295
831 Ga0590075_000972
832 Ga0590077_000623

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04350

PilO

Pilus assembly protein, PilO

63

206

0.89

PF10741

T2SSM_b

Type II secretion system (T2SS), protein M subtype b

101

204

0.79

Map