F438580

General Info

Members Datasets Scaffolds Average Seq Length
415 184 412 238

Family's Representative Sequence

Representative Sequence 3300017792|Ga0163161_10077849|Ga0163161_100778493
Length 276
Sequence VRHPLARRGDGVLHRVVNLVLDRAVASPTACDIASPLRQNIGLAMEFRNIVILTGAGISADSGLATFRGADGLWEGHHVEDVATPEAFRRDPALVHQFYDARRARLSEVEPNAAHHALARLDAEWPGDLLIVTQNVDDLHERAGAKRLLHMHGELTSGWCLACDQRFGWSGPMGEGASCPSCQAAGRVRPDIVWFGEMPYDMERIDAALRNADLFVSIGTSGAVYPAAGFVQSARYCGAHCVEMNLEPSQGSIFFNETRLGRAKDLVPAWVEELLA

Samples

Sample ID Description Type Environment
1 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
2 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
3 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
78 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
127 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
147 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
148 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
149 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
150 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
151 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
152 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
153 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
154 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
155 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
158 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
159 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
160 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
161 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
162 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
165 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
166 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
179 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
180 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
181 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
182 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0
Isolates 0.72

Biome Distribution

Category Percentage (%)
Aerial Root 0.48
Bulb 0
Endosphere 0.72
Nodule 0
Rhizoplane 3.37
Rhizosphere 95.18
Stem 0
Stem Tuber 0
Unclassified 0.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10000293 3300001990 Bacteria 16594
2 JGI24738J21930_10000814 3300002075 Bacteria 8931
3 Ga0070658_10000001 3300005327 Bacteria 856789
4 Ga0070658_10000891 3300005327 Bacteria 25556
5 Ga0070658_10042298 3300005327 Bacteria 3679
6 Ga0070658_10091850 3300005327 Bacteria 2502
7 Ga0070658_10242316 3300005327 Bacteria 1528
8 Ga0070658_10242801 3300005327 Bacteria 1527
9 Ga0070676_10004996 3300005328 Bacteria 7025
10 Ga0070670_100168798 3300005331 Bacteria 1898
11 Ga0070677_10089095 3300005333 Bacteria 1338
12 Ga0070677_10191319 3300005333 Bacteria 981
13 Ga0068869_100000094 3300005334 Bacteria 41359
14 Ga0068869_100054716 3300005334 Bacteria 2906
15 Ga0070666_10118718 3300005335 Bacteria 1833
16 Ga0070680_100101052 3300005336 Bacteria 2394
17 Ga0070680_100758159 3300005336 Bacteria 836
18 Ga0068868_100000113 3300005338 Bacteria 50799
19 Ga0070660_100001519 3300005339 Bacteria 15915
20 Ga0070660_100001877 3300005339 Bacteria 14470
21 Ga0070660_100020164 3300005339 Bacteria 4895
22 Ga0070660_100038646 3300005339 Bacteria 3624
23 Ga0070660_100041201 3300005339 Bacteria 3519
24 Ga0070689_100219498 3300005340 Bacteria 1559
25 Ga0070687_100240747 3300005343 Bacteria 1119
26 Ga0070661_100016841 3300005344 Bacteria 5174
27 Ga0070692_10003730 3300005345 Bacteria 6253
28 Ga0070668_100002775 3300005347 Bacteria 12873
29 Ga0070669_100000155 3300005353 Bacteria 61710
30 Ga0070669_100020276 3300005353 Bacteria 4749
31 Ga0070669_100044965 3300005353 Bacteria 3217
32 Ga0070675_100022533 3300005354 Bacteria 5034
33 Ga0070671_100013050 3300005355 Bacteria 6697
34 Ga0070671_100090107 3300005355 Bacteria 2567
35 Ga0070674_100019554 3300005356 Bacteria 4304
36 Ga0070673_100001756 3300005364 Bacteria 12927
37 Ga0070673_100171098 3300005364 Bacteria 1854
38 Ga0070659_100000305 3300005366 Bacteria 38108
39 Ga0070659_100003359 3300005366 Bacteria 11387
40 Ga0070659_100004185 3300005366 Bacteria 10295
41 Ga0070659_100007380 3300005366 Bacteria 7987
42 Ga0070659_100126912 3300005366 Bacteria 2070
43 Ga0070659_100273680 3300005366 Bacteria 1403
44 Ga0070659_100360289 3300005366 Bacteria 1222
45 Ga0070667_100003284 3300005367 Bacteria 13815
46 Ga0070667_100005549 3300005367 Bacteria 10525
47 Ga0070667_100020175 3300005367 Bacteria 5533
48 Ga0070667_100486246 3300005367 Bacteria 1130
49 Ga0070694_100009908 3300005444 Bacteria 5855
50 Ga0070663_100078026 3300005455 Bacteria 2426
51 Ga0070662_100012344 3300005457 Bacteria 5664
52 Ga0070662_100017631 3300005457 Bacteria 4818
53 Ga0070662_100024764 3300005457 Bacteria 4138
54 Ga0070681_10023242 3300005458 Bacteria 6233
55 Ga0070681_10062150 3300005458 Bacteria 3708
56 Ga0070681_10435679 3300005458 Bacteria 1223
57 Ga0068867_100001817 3300005459 Bacteria 14865
58 Ga0068867_100010918 3300005459 Bacteria 6405
59 Ga0070699_100517718 3300005518 Bacteria 1084
60 Ga0070679_100088459 3300005530 Bacteria 3085
61 Ga0070679_100225898 3300005530 Bacteria 1832
62 Ga0070679_100266073 3300005530 Bacteria 1669
63 Ga0068853_100005924 3300005539 Bacteria 9651
64 Ga0068853_100022599 3300005539 Bacteria 5254
65 Ga0068853_100025469 3300005539 Bacteria 4964
66 Ga0068853_100220368 3300005539 Bacteria 1732
67 Ga0070672_100000710 3300005543 Bacteria 19719
68 Ga0070672_100013761 3300005543 Bacteria 5721
69 Ga0070695_100152172 3300005545 Bacteria 1616
70 Ga0070693_100108366 3300005547 Bacteria 1704
71 Ga0070693_100394780 3300005547 Bacteria 957
72 Ga0070665_100000995 3300005548 Bacteria 35932
73 Ga0070665_100171238 3300005548 Bacteria 2172
74 Ga0068855_100038147 3300005563 Bacteria 5709
75 Ga0070664_100032263 3300005564 Bacteria 4380
76 Ga0070664_100169064 3300005564 Bacteria 1939
77 Ga0068857_100004853 3300005577 Bacteria 11402
78 Ga0068857_100018433 3300005577 Bacteria 6123
79 Ga0068857_100188831 3300005577 Bacteria 1876
80 Ga0068854_100000206 3300005578 Bacteria 39747
81 Ga0068854_100000236 3300005578 Bacteria 37598
82 Ga0068854_100079015 3300005578 Bacteria 2425
83 Ga0068854_100281297 3300005578 Bacteria 1340
84 Ga0068856_100017069 3300005614 Bacteria 7036
85 Ga0068856_100116421 3300005614 Bacteria 2673
86 Ga0068852_100002924 3300005616 Bacteria 11864
87 Ga0068852_100086851 3300005616 Bacteria 2789
88 Ga0068852_100142460 3300005616 Bacteria 2220
89 Ga0068859_100001691 3300005617 Bacteria 22476
90 Ga0068859_100007995 3300005617 Bacteria 10722
91 Ga0068859_100148071 3300005617 Bacteria 2423
92 Ga0068859_100152907 3300005617 Bacteria 2383
93 Ga0068864_100000428 3300005618 Bacteria 36392
94 Ga0068864_100019569 3300005618 Bacteria 5662
95 Ga0068864_100102796 3300005618 Bacteria 2536
96 Ga0068866_10082265 3300005718 Bacteria 1732
97 Ga0068866_10227022 3300005718 Bacteria 1130
98 Ga0068861_100341256 3300005719 Bacteria 1311
99 Ga0068851_10133079 3300005834 Bacteria 1346
100 Ga0068863_100000634 3300005841 Bacteria 35566
101 Ga0068858_100000874 3300005842 Bacteria 31179
102 Ga0068858_100001980 3300005842 Bacteria 20919
103 Ga0068858_100012384 3300005842 Bacteria 8041
104 Ga0068858_100103599 3300005842 Bacteria 2655
105 Ga0068860_100003691 3300005843 Bacteria 15765
106 Ga0068860_100006399 3300005843 Bacteria 11822
107 Ga0068860_100019107 3300005843 Bacteria 6654
108 Ga0068860_100051191 3300005843 Bacteria 3930
109 Ga0068860_100541909 3300005843 Bacteria 1165
110 Ga0068862_100036890 3300005844 Bacteria 4143
111 Ga0068862_100112537 3300005844 Bacteria 2391
112 Ga0097621_100003334 3300006237 Bacteria 11047
113 Ga0097621_100042600 3300006237 Bacteria 3657
114 Ga0068871_100023392 3300006358 Bacteria 4779
115 Ga0068871_100058543 3300006358 Bacteria 3137
116 Ga0097620_100001691 3300006931 Bacteria 22476
117 Ga0097620_100007995 3300006931 Bacteria 10722
118 Ga0097620_100148071 3300006931 Bacteria 2423
119 Ga0097620_100152919 3300006931 Bacteria 2383
120 Ga0105240_10021921 3300009093 Bacteria 8485
121 Ga0105240_10116117 3300009093 Bacteria 3230
122 Ga0111539_10568261 3300009094 Bacteria 1321
123 Ga0105245_10038702 3300009098 Bacteria 4243
124 Ga0105245_10096984 3300009098 Bacteria 2722
125 Ga0105247_10119637 3300009101 Bacteria 1705
126 Ga0105243_10235632 3300009148 Bacteria 1626
127 Ga0105241_10049745 3300009174 Bacteria 3193
128 Ga0105241_10151503 3300009174 Bacteria 1898
129 Ga0105241_10713948 3300009174 Bacteria 916
130 Ga0105248_10000413 3300009177 Bacteria 49136
131 Ga0105248_10001472 3300009177 Bacteria 26219
132 Ga0105248_10004409 3300009177 Bacteria 15579
133 Ga0105248_10034243 3300009177 Bacteria 5678
134 Ga0105248_11004701 3300009177 Bacteria 942
135 Ga0105238_10031422 3300009551 Bacteria 5405
136 Ga0105238_10065235 3300009551 Bacteria 3642
137 Ga0105249_10015864 3300009553 Bacteria 6676
138 Ga0105249_10728972 3300009553 Bacteria 1053
139 Ga0105239_10006320 3300010375 Bacteria 13785
140 Ga0105239_10068720 3300010375 Bacteria 3893
141 Ga0157373_10002262 3300013100 Bacteria 14594
142 Ga0157373_10107348 3300013100 Bacteria 1963
143 Ga0157373_10281149 3300013100 Bacteria 1179
144 Ga0157371_10002300 3300013102 Bacteria 18396
145 Ga0157371_10030739 3300013102 Bacteria 3872
146 Ga0157371_10243502 3300013102 Bacteria 1294
147 Ga0157369_10189836 3300013105 Bacteria 2159
148 Ga0157369_10231244 3300013105 Bacteria 1933
149 Ga0157378_10001977 3300013297 Bacteria 18333
150 Ga0163162_10023769 3300013306 Bacteria 6049
151 Ga0163162_10024015 3300013306 Bacteria 6016
152 Ga0163162_10672053 3300013306 Bacteria 1159
153 Ga0157375_10310731 3300013308 Bacteria 1740
154 Ga0157375_10343690 3300013308 Bacteria 1657
155 Ga0157375_10745616 3300013308 Bacteria 1131
156 Ga0163163_10082441 3300014325 Bacteria 3219
157 Ga0157380_10002756 3300014326 Bacteria 11931
158 Ga0157380_10273140 3300014326 Bacteria 1542
159 Ga0157380_10494552 3300014326 Bacteria 1186
160 Ga0157379_10006729 3300014968 Bacteria 9931
161 Ga0163161_10077849 3300017792 Bacteria 2436
162 Ga0163161_10192997 3300017792 Bacteria 1567
163 Ga0213872_10086519 3300021361 Bacteria 1404
164 Ga0209148_1000074 3300025254 Bacteria 314356
165 Ga0207697_10000109 3300025315 Bacteria 38398
166 Ga0207656_10090302 3300025321 Bacteria 1390
167 Ga0207682_10146201 3300025893 Bacteria 1063
168 Ga0207688_10000437 3300025901 Bacteria 19709
169 Ga0207647_10000446 3300025904 Bacteria 33539
170 Ga0207647_10008195 3300025904 Bacteria 7507
171 Ga0207647_10009611 3300025904 Bacteria 6867
172 Ga0207647_10017636 3300025904 Bacteria 4851
173 Ga0207645_10022319 3300025907 Bacteria 4120
174 Ga0207705_10000002 3300025909 Bacteria 2046852
175 Ga0207705_10001285 3300025909 Bacteria 20149
176 Ga0207705_10007155 3300025909 Bacteria 8226
177 Ga0207705_10194527 3300025909 Bacteria 1535
178 Ga0207707_10241931 3300025912 Bacteria 1569
179 Ga0207707_10358770 3300025912 Bacteria 1255
180 Ga0207695_10086491 3300025913 Bacteria 3161
181 Ga0207695_10442823 3300025913 Bacteria 1182
182 Ga0207660_10005689 3300025917 Bacteria 8089
183 Ga0207657_10000082 3300025919 Bacteria 89667
184 Ga0207657_10000143 3300025919 Bacteria 72146
185 Ga0207657_10002328 3300025919 Bacteria 20592
186 Ga0207657_10002553 3300025919 Bacteria 19693
187 Ga0207657_10006836 3300025919 Bacteria 11768
188 Ga0207649_10045802 3300025920 Bacteria 2683
189 Ga0207649_10077898 3300025920 Bacteria 2137
190 Ga0207649_10280471 3300025920 Bacteria 1211
191 Ga0207652_10001433 3300025921 Bacteria 21127
192 Ga0207652_10018615 3300025921 Bacteria 5698
193 Ga0207652_10186783 3300025921 Bacteria 1864
194 Ga0207681_10001626 3300025923 Bacteria 14490
195 Ga0207681_10061428 3300025923 Bacteria 2583
196 Ga0207681_10168032 3300025923 Bacteria 1660
197 Ga0207694_10005716 3300025924 Bacteria 9531
198 Ga0207694_10107887 3300025924 Bacteria 2212
199 Ga0207650_10036868 3300025925 Bacteria 3559
200 Ga0207659_10017980 3300025926 Bacteria 4626
201 Ga0207687_10020101 3300025927 Bacteria 4429
202 Ga0207687_10375316 3300025927 Bacteria 1164
203 Ga0207644_10016794 3300025931 Bacteria 4929
204 Ga0207644_10088267 3300025931 Bacteria 2306
205 Ga0207644_10142711 3300025931 Bacteria 1846
206 Ga0207644_10417107 3300025931 Bacteria 1099
207 Ga0207690_10004216 3300025932 Bacteria 8496
208 Ga0207690_10007000 3300025932 Bacteria 6686
209 Ga0207690_10009895 3300025932 Bacteria 5663
210 Ga0207690_10016590 3300025932 Bacteria 4485
211 Ga0207690_10086720 3300025932 Bacteria 2201
212 Ga0207690_10260500 3300025932 Bacteria 1343
213 Ga0207706_10000300 3300025933 Bacteria 53727
214 Ga0207706_10003071 3300025933 Bacteria 16064
215 Ga0207706_10016261 3300025933 Bacteria 6720
216 Ga0207706_10043528 3300025933 Bacteria 3978
217 Ga0207706_10081224 3300025933 Bacteria 2849
218 Ga0207706_10187578 3300025933 Bacteria 1815
219 Ga0207706_10220227 3300025933 Bacteria 1662
220 Ga0207670_10015979 3300025936 Bacteria 4498
221 Ga0207691_10000294 3300025940 Bacteria 49457
222 Ga0207691_10094196 3300025940 Bacteria 2680
223 Ga0207711_10000218 3300025941 Bacteria 61467
224 Ga0207711_10003143 3300025941 Bacteria 14401
225 Ga0207711_10415184 3300025941 Bacteria 1251
226 Ga0207689_10000064 3300025942 Bacteria 84222
227 Ga0207689_10064262 3300025942 Bacteria 3020
228 Ga0207679_10186785 3300025945 Bacteria 1719
229 Ga0207667_10020043 3300025949 Bacteria 7447
230 Ga0207667_10538884 3300025949 Bacteria 1181
231 Ga0207651_10000355 3300025960 Bacteria 19400
232 Ga0207712_10002447 3300025961 Bacteria 11986
233 Ga0207668_10040684 3300025972 Bacteria 3138
234 Ga0207668_10453983 3300025972 Bacteria 1094
235 Ga0207668_10657151 3300025972 Bacteria 918
236 Ga0207640_10000067 3300025981 Bacteria 85026
237 Ga0207640_10001142 3300025981 Bacteria 14572
238 Ga0207640_10023138 3300025981 Bacteria 3731
239 Ga0207640_10132746 3300025981 Bacteria 1802
240 Ga0207658_10004040 3300025986 Bacteria 10259
241 Ga0207658_10183280 3300025986 Bacteria 1734
242 Ga0207677_10006963 3300026023 Bacteria 6218
243 Ga0207703_10008809 3300026035 Bacteria 7955
244 Ga0207639_10004582 3300026041 Bacteria 9303
245 Ga0207639_10065848 3300026041 Bacteria 2814
246 Ga0207639_10113515 3300026041 Bacteria 2213
247 Ga0207678_10031885 3300026067 Bacteria 4594
248 Ga0207678_10032650 3300026067 Bacteria 4537
249 Ga0207678_10133243 3300026067 Bacteria 2120
250 Ga0207678_10227004 3300026067 Bacteria 1599
251 Ga0207702_10011713 3300026078 Bacteria 7306
252 Ga0207702_10015844 3300026078 Bacteria 6241
253 Ga0207641_10000573 3300026088 Bacteria 40695
254 Ga0207641_10016059 3300026088 Bacteria 6132
255 Ga0207641_10034128 3300026088 Bacteria 4230
256 Ga0207648_10001537 3300026089 Bacteria 25401
257 Ga0207648_10008749 3300026089 Bacteria 9757
258 Ga0207676_10004949 3300026095 Bacteria 9443
259 Ga0207676_10006684 3300026095 Bacteria 8158
260 Ga0207674_10002909 3300026116 Bacteria 21260
261 Ga0207674_10008433 3300026116 Bacteria 11906
262 Ga0207674_10169228 3300026116 Bacteria 2139
263 Ga0207675_100262336 3300026118 Bacteria 1675
264 Ga0207683_10013889 3300026121 Bacteria 6867
265 Ga0207698_10010153 3300026142 Bacteria 6033
266 Ga0207698_10036238 3300026142 Bacteria 3618
267 Ga0207698_10090233 3300026142 Bacteria 2506
268 Ga0207698_10139382 3300026142 Bacteria 2087
269 Ga0268266_10000318 3300028379 Bacteria 76400
270 Ga0268265_10026131 3300028380 Bacteria 4151
271 Ga0268265_10096033 3300028380 Bacteria 2381
272 Ga0268264_10001863 3300028381 Bacteria 19178
273 Ga0268264_10002999 3300028381 Bacteria 14637
274 Ga0268264_10018939 3300028381 Bacteria 5628
275 Ga0268264_10058563 3300028381 Bacteria 3226
276 Ga0268264_10461026 3300028381 Bacteria 1233
277 Ga0316183_1061051 3300030742 Bacteria 2173
278 Ga0265327_10023757 3300031251 Bacteria 3620
279 Ga0307408_100047500 3300031548 Bacteria 3075
280 Ga0307408_100148701 3300031548 Bacteria 1847
281 Ga0307408_100214561 3300031548 Bacteria 1566
282 Ga0307408_100216804 3300031548 Bacteria 1559
283 Ga0307408_100368993 3300031548 Bacteria 1223
284 Ga0307408_100507824 3300031548 Bacteria 1056
285 Ga0265314_10018124 3300031711 Bacteria 5501
286 Ga0307405_10054247 3300031731 Bacteria 2501
287 Ga0307405_10097097 3300031731 Bacteria 1966
288 Ga0307405_10187833 3300031731 Bacteria 1489
289 Ga0307405_10558429 3300031731 Bacteria 928
290 Ga0307413_10001145 3300031824 Bacteria 9730
291 Ga0307413_10001359 3300031824 Bacteria 9168
292 Ga0307413_10010607 3300031824 Bacteria 4482
293 Ga0307413_10047109 3300031824 Bacteria 2568
294 Ga0307413_10248855 3300031824 Bacteria 1317
295 Ga0307410_10009384 3300031852 Bacteria 5485
296 Ga0307410_10059913 3300031852 Bacteria 2600
297 Ga0307410_10065164 3300031852 Bacteria 2505
298 Ga0307410_10101130 3300031852 Bacteria 2066
299 Ga0307410_10387152 3300031852 Bacteria 1126
300 Ga0307410_10786151 3300031852 Bacteria 808
301 Ga0307406_10038716 3300031901 Bacteria 2953
302 Ga0307406_10057012 3300031901 Bacteria 2504
303 Ga0307407_10042853 3300031903 Bacteria 2541
304 Ga0307407_10087000 3300031903 Bacteria 1905
305 Ga0307407_10131287 3300031903 Bacteria 1603
306 Ga0307412_10069189 3300031911 Bacteria 2402
307 Ga0307412_10109231 3300031911 Bacteria 1971
308 Ga0307412_10360100 3300031911 Bacteria 1171
309 Ga0307409_100003478 3300031995 Bacteria 8561
310 Ga0307409_100016750 3300031995 Bacteria 4862
311 Ga0307409_100020353 3300031995 Bacteria 4519
312 Ga0307409_100036139 3300031995 Bacteria 3627
313 Ga0307409_100039057 3300031995 Bacteria 3518
314 Ga0307409_100051326 3300031995 Bacteria 3155
315 Ga0307409_100051586 3300031995 Bacteria 3149
316 Ga0307409_100311707 3300031995 Bacteria 1469
317 Ga0307409_100617600 3300031995 Bacteria 1073
318 Ga0307409_100704721 3300031995 Bacteria 1009
319 Ga0307416_100025848 3300032002 Bacteria 4314
320 Ga0307416_100237593 3300032002 Bacteria 1762
321 Ga0307416_101239744 3300032002 Bacteria 851
322 Ga0307414_10001327 3300032004 Bacteria 12783
323 Ga0307414_10007990 3300032004 Bacteria 5978
324 Ga0307414_10014045 3300032004 Bacteria 4786
325 Ga0307414_10027263 3300032004 Bacteria 3690
326 Ga0307414_10041379 3300032004 Bacteria 3121
327 Ga0307414_10048367 3300032004 Bacteria 2933
328 Ga0307414_10065036 3300032004 Bacteria 2600
329 Ga0307414_10100102 3300032004 Bacteria 2179
330 Ga0307414_10303816 3300032004 Bacteria 1351
331 Ga0307411_10001262 3300032005 Bacteria 10114
332 Ga0307411_10055267 3300032005 Bacteria 2611
333 Ga0307411_10172896 3300032005 Bacteria 1631
334 Ga0307411_10243488 3300032005 Bacteria 1409
335 Ga0307411_10504791 3300032005 Bacteria 1023
336 Ga0307415_100045133 3300032126 Bacteria 2952
337 Ga0307415_100053610 3300032126 Bacteria 2749
338 Ga0307415_100271334 3300032126 Bacteria 1390
339 Ga0307415_100323770 3300032126 Bacteria 1286
340 Ga0307415_100552835 3300032126 Bacteria 1016
341 Ga0395899_0001090 3300037312 Bacteria 24379
342 Ga0395899_0004210 3300037312 Bacteria 11284
343 Ga0395899_0036210 3300037312 Bacteria 3702
344 Ga0395899_0219254 3300037312 Bacteria 1318
345 Ga0395900_0046909 3300037418 Bacteria 4448
346 Ga0395900_0053036 3300037418 Bacteria 4174
347 Ga0395900_0097216 3300037418 Bacteria 3025
348 Ga0395900_0105672 3300037418 Bacteria 2892
349 Ga0395900_0122210 3300037418 Bacteria 2671
350 Ga0395900_0278227 3300037418 Bacteria 1666
351 Ga0395898_0051023 3300037466 Bacteria 4046
352 Ga0395898_0095341 3300037466 Bacteria 2858
353 Ga0395898_0405988 3300037466 Bacteria 1299
354 Ga0395898_0470903 3300037466 Bacteria 1195
355 Ga0395905_0011536 3300037471 Bacteria 8539
356 Ga0395905_0026975 3300037471 Bacteria 5417
357 Ga0395905_0055345 3300037471 Bacteria 3713
358 Ga0395905_0072001 3300037471 Bacteria 3240
359 Ga0395905_0081645 3300037471 Bacteria 3029
360 Ga0395905_0684796 3300037471 Bacteria 927
361 Ga0395901_0011458 3300038443 Bacteria 8984
362 Ga0395901_0054842 3300038443 Bacteria 4143
363 Ga0395901_0150745 3300038443 Bacteria 2443
364 Ga0395901_0365771 3300038443 Bacteria 1486
365 Ga0395901_0588303 3300038443 Bacteria 1123
366 Ga0439448_0004166 3300042005 Bacteria 4070
367 Ga0439455_0028707 3300042012 Bacteria 1371
368 Ga0439458_0000177 3300042157 Bacteria 14388
369 Ga0466966_0080827 3300044684 Bacteria 2024
370 Ga0466961_0229238 3300044693 Bacteria 1143
371 Ga0466971_0082799 3300044719 Bacteria 1465
372 Ga0466970_0335243 3300044765 Bacteria 857
373 Ga0466957_0010691 3300044842 Bacteria 5276
374 Ga0466960_0033135 3300044901 Bacteria 2399
375 Ga0466958_0110307 3300045836 Bacteria 1717
376 Ga0466967_0342704 3300045976 Bacteria 1445
377 Ga0495584_0072832 3300046491 Bacteria 1726
378 Ga0495596_0051185 3300046500 Bacteria 1618
379 Ga0495632_0000105 3300046519 Bacteria 85761
380 Ga0495663_0000009 3300046525 Bacteria 256308
381 Ga0495663_0000381 3300046525 Bacteria 16415
382 Ga0495663_0003568 3300046525 Bacteria 4474
383 Ga0495663_0025859 3300046525 Bacteria 1715
384 Ga0495621_0001871 3300046539 Bacteria 5527
385 Ga0495621_0012902 3300046539 Bacteria 2614
386 Ga0495633_0000546 3300046558 Bacteria 37303
387 Ga0495625_0000006 3300046660 Bacteria 578292
388 Ga0495659_0085818 3300046664 Bacteria 1202
389 Ga0495670_0006356 3300046691 Bacteria 5803
390 Ga0495677_0021191 3300047445 Bacteria 2356
391 Ga0496100_0014341 3300048903 Bacteria 4600
392 Ga0496102_0039069 3300048905 Bacteria 4286
393 Ga0496102_0189171 3300048905 Bacteria 1940
394 Ga0496103_0016684 3300048906 Bacteria 4386
395 Ga0496104_0555192 3300048907 Bacteria 1059
396 Ga0496106_0210182 3300048909 Bacteria 1550
397 Ga0496107_0026987 3300048910 Bacteria 4076
398 Ga0496107_0034070 3300048910 Bacteria 3645
399 Ga0496109_0078718 3300048912 Bacteria 3035
400 Ga0496111_0244087 3300048914 Bacteria 1333
401 Ga0496112_0056962 3300048915 Bacteria 3847
402 Ga0496114_0034446 3300048917 Bacteria 4178
403 Ga0496114_0076935 3300048917 Bacteria 2812
404 Ga0496115_0004538 3300048918 Bacteria 10045
405 Ga0496121_0002997 3300048924 Bacteria 24524
406 Ga0501069_0298963 3300049585 Bacteria 944
407 Ga0501249_000065 3300049679 Bacteria 38092
408 Ga0501249_008193 3300049679 Bacteria 2167
409 Ga0501268_008041 3300049765 Bacteria 1587
410 nmdc:mga07m45_82297_c1 3300050496 Bacteria 1838
411 nmdc:mga08y16_404379_c1 3300050511 Bacteria 1397
412 Ga0500562_048994 3300053108 Bacteria 1128

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044842 Ga0466957_0010691 Ga0466957_0010691_4355_4948 188
2 3300025933 Ga0207706_10187578 Ga0207706_101875782 214
3 3300028380 Ga0268265_10096033 Ga0268265_100960333 215
4 3300005614 Ga0068856_100017069 Ga0068856_1000170695 217
5 3300026078 Ga0207702_10011713 Ga0207702_100117132 217
6 3300031251 Ga0265327_10023757 Ga0265327_100237573 217
7 3300005366 Ga0070659_100360289 Ga0070659_1003602892 218
8 3300025932 Ga0207690_10086720 Ga0207690_100867202 218
9 3300042005 Ga0439448_0004166 Ga0439448_0004166_1088_1798 218
10 3300042012 Ga0439455_0028707 Ga0439455_0028707_341_1057 218
11 3300042157 Ga0439458_0000177 Ga0439458_0000177_1093_1803 218
12 3300050496 nmdc:mga07m45_82297_c1 nmdc:mga07m45_82297_c1_257_967 218
13 3300005327 Ga0070658_10242801 Ga0070658_102428011 222
14 3300005578 Ga0068854_100000236 Ga0068854_10000023633 222
15 3300006237 Ga0097621_100003334 Ga0097621_1000033342 222
16 3300006358 Ga0068871_100023392 Ga0068871_1000233924 222
17 3300009174 Ga0105241_10049745 Ga0105241_100497453 222
18 3300010375 Ga0105239_10006320 Ga0105239_100063203 222
19 3300025909 Ga0207705_10194527 Ga0207705_101945271 222
20 3300025981 Ga0207640_10000067 Ga0207640_100000679 222
21 3300026067 Ga0207678_10032650 Ga0207678_100326505 222
22 3300037312 Ga0395899_0001090 Ga0395899_0001090_23427_24158 222
23 3300037418 Ga0395900_0122210 Ga0395900_0122210_685_1416 222
24 3300037466 Ga0395898_0405988 Ga0395898_0405988_434_1165 222
25 3300037471 Ga0395905_0055345 Ga0395905_0055345_891_1595 222
26 3300005327 Ga0070658_10000891 Ga0070658_1000089112 225
27 3300005339 Ga0070660_100001877 Ga0070660_10000187711 225
28 3300025909 Ga0207705_10001285 Ga0207705_100012859 225
29 3300025919 Ga0207657_10000143 Ga0207657_1000014315 225
30 3300031711 Ga0265314_10018124 Ga0265314_100181246 225
31 3300025254 Ga0209148_1000074 Ga0209148_100007465 226
32 3300048924 Ga0496121_0002997 Ga0496121_0002997_3729_4436 226
33 3300046660 Ga0495625_0000006 Ga0495625_0000006_185260_185976 227
34 3300005518 Ga0070699_100517718 Ga0070699_1005177181 229
35 iso_pu_bacteria 2984555340 2984557253 229
36 iso_pu_bacteria 2993356040 2993359431 229
37 3300005327 Ga0070658_10000001 Ga0070658_10000001387 230
38 3300005339 Ga0070660_100001519 Ga0070660_1000015198 230
39 3300005366 Ga0070659_100003359 Ga0070659_1000033596 230
40 3300014326 Ga0157380_10002756 Ga0157380_100027566 230
41 3300025909 Ga0207705_10000002 Ga0207705_100000021493 230
42 3300025919 Ga0207657_10000082 Ga0207657_1000008271 230
43 3300025932 Ga0207690_10009895 Ga0207690_100098956 230
44 3300031995 Ga0307409_100051586 Ga0307409_1000515864 230
45 3300044719 Ga0466971_0082799 Ga0466971_0082799_308_1012 230
46 3300045836 Ga0466958_0110307 Ga0466958_0110307_845_1549 230
47 3300046491 Ga0495584_0072832 Ga0495584_0072832_582_1280 230
48 3300046519 Ga0495632_0000105 Ga0495632_0000105_55779_56477 230
49 3300046525 Ga0495663_0000009 Ga0495663_0000009_224619_225317 230
50 3300046558 Ga0495633_0000546 Ga0495633_0000546_27164_27862 230
51 3300053108 Ga0500562_048994 Ga0500562_048994_49_771 230
52 3300005327 Ga0070658_10042298 Ga0070658_100422984 231
53 3300005327 Ga0070658_10242316 Ga0070658_102423162 231
54 3300005331 Ga0070670_100168798 Ga0070670_1001687982 231
55 3300005336 Ga0070680_100101052 Ga0070680_1001010524 231
56 3300005339 Ga0070660_100038646 Ga0070660_1000386463 231
57 3300005364 Ga0070673_100171098 Ga0070673_1001710982 231
58 3300005367 Ga0070667_100486246 Ga0070667_1004862462 231
59 3300005455 Ga0070663_100078026 Ga0070663_1000780264 231
60 3300005530 Ga0070679_100225898 Ga0070679_1002258982 231
61 3300005530 Ga0070679_100266073 Ga0070679_1002660732 231
62 3300005564 Ga0070664_100169064 Ga0070664_1001690642 231
63 3300005842 Ga0068858_100103599 Ga0068858_1001035993 231
64 3300009177 Ga0105248_10034243 Ga0105248_100342432 231
65 3300009177 Ga0105248_11004701 Ga0105248_110047011 231
66 3300013306 Ga0163162_10672053 Ga0163162_106720532 231
67 3300017792 Ga0163161_10077849 Ga0163161_100778493 231
68 3300021361 Ga0213872_10086519 Ga0213872_100865192 231
69 3300025909 Ga0207705_10007155 Ga0207705_100071553 231
70 3300025919 Ga0207657_10006836 Ga0207657_100068368 231
71 3300025920 Ga0207649_10045802 Ga0207649_100458023 231
72 3300025921 Ga0207652_10001433 Ga0207652_1000143311 231
73 3300025925 Ga0207650_10036868 Ga0207650_100368685 231
74 3300025931 Ga0207644_10417107 Ga0207644_104171072 231
75 3300025933 Ga0207706_10220227 Ga0207706_102202273 231
76 3300025941 Ga0207711_10415184 Ga0207711_104151842 231
77 3300026067 Ga0207678_10227004 Ga0207678_102270042 231
78 3300026142 Ga0207698_10139382 Ga0207698_101393823 231
79 3300031548 Ga0307408_100148701 Ga0307408_1001487013 231
80 3300031548 Ga0307408_100216804 Ga0307408_1002168043 231
81 3300031548 Ga0307408_100507824 Ga0307408_1005078242 231
82 3300031731 Ga0307405_10054247 Ga0307405_100542474 231
83 3300031731 Ga0307405_10558429 Ga0307405_105584292 231
84 3300031824 Ga0307413_10001145 Ga0307413_100011455 231
85 3300031824 Ga0307413_10001359 Ga0307413_100013598 231
86 3300031824 Ga0307413_10047109 Ga0307413_100471095 231
87 3300031852 Ga0307410_10065164 Ga0307410_100651642 231
88 3300031901 Ga0307406_10038716 Ga0307406_100387162 231
89 3300031903 Ga0307407_10087000 Ga0307407_100870004 231
90 3300031911 Ga0307412_10109231 Ga0307412_101092313 231
91 3300031911 Ga0307412_10360100 Ga0307412_103601002 231
92 3300031995 Ga0307409_100003478 Ga0307409_1000034785 231
93 3300031995 Ga0307409_100039057 Ga0307409_1000390573 231
94 3300031995 Ga0307409_100051326 Ga0307409_1000513262 231
95 3300031995 Ga0307409_100617600 Ga0307409_1006176002 231
96 3300032002 Ga0307416_100025848 Ga0307416_1000258486 231
97 3300032002 Ga0307416_100237593 Ga0307416_1002375933 231
98 3300032004 Ga0307414_10001327 Ga0307414_100013275 231
99 3300032004 Ga0307414_10007990 Ga0307414_100079907 231
100 3300032004 Ga0307414_10048367 Ga0307414_100483673 231
101 3300032005 Ga0307411_10001262 Ga0307411_100012625 231
102 3300032126 Ga0307415_100053610 Ga0307415_1000536104 231
103 3300032126 Ga0307415_100271334 Ga0307415_1002713342 231
104 3300044684 Ga0466966_0080827 Ga0466966_0080827_516_1214 231
105 3300044693 Ga0466961_0229238 Ga0466961_0229238_176_874 231
106 3300048917 Ga0496114_0076935 Ga0496114_0076935_2099_2797 231
107 3300049585 Ga0501069_0298963 Ga0501069_0298963_49_795 231
108 3300049679 Ga0501249_008193 Ga0501249_008193_1383_2081 231
109 3300005336 Ga0070680_100758159 Ga0070680_1007581591 232
110 3300005353 Ga0070669_100020276 Ga0070669_1000202763 232
111 3300005353 Ga0070669_100044965 Ga0070669_1000449654 232
112 3300005355 Ga0070671_100013050 Ga0070671_1000130506 232
113 3300005366 Ga0070659_100007380 Ga0070659_1000073805 232
114 3300005366 Ga0070659_100273680 Ga0070659_1002736802 232
115 3300005367 Ga0070667_100005549 Ga0070667_10000554911 232
116 3300005458 Ga0070681_10023242 Ga0070681_100232425 232
117 3300005458 Ga0070681_10435679 Ga0070681_104356791 232
118 3300005539 Ga0068853_100025469 Ga0068853_1000254693 232
119 3300005539 Ga0068853_100220368 Ga0068853_1002203683 232
120 3300005577 Ga0068857_100188831 Ga0068857_1001888312 232
121 3300005578 Ga0068854_100281297 Ga0068854_1002812971 232
122 3300005616 Ga0068852_100086851 Ga0068852_1000868514 232
123 3300005617 Ga0068859_100001691 Ga0068859_10000169111 232
124 3300005618 Ga0068864_100102796 Ga0068864_1001027963 232
125 3300005842 Ga0068858_100000874 Ga0068858_10000087412 232
126 3300005843 Ga0068860_100006399 Ga0068860_1000063996 232
127 3300005844 Ga0068862_100112537 Ga0068862_1001125373 232
128 3300006931 Ga0097620_100001691 Ga0097620_10000169111 232
129 3300009093 Ga0105240_10021921 Ga0105240_100219217 232
130 3300009094 Ga0111539_10568261 Ga0111539_105682612 232
131 3300009101 Ga0105247_10119637 Ga0105247_101196373 232
132 3300009177 Ga0105248_10000413 Ga0105248_1000041344 232
133 3300009551 Ga0105238_10065235 Ga0105238_100652353 232
134 3300009553 Ga0105249_10728972 Ga0105249_107289722 232
135 3300013100 Ga0157373_10107348 Ga0157373_101073482 232
136 3300013102 Ga0157371_10030739 Ga0157371_100307392 232
137 3300013105 Ga0157369_10189836 Ga0157369_101898363 232
138 3300013105 Ga0157369_10231244 Ga0157369_102312442 232
139 3300013308 Ga0157375_10310731 Ga0157375_103107312 232
140 3300013308 Ga0157375_10745616 Ga0157375_107456162 232
141 3300014326 Ga0157380_10494552 Ga0157380_104945521 232
142 3300014968 Ga0157379_10006729 Ga0157379_100067294 232
143 3300025904 Ga0207647_10008195 Ga0207647_100081956 232
144 3300025904 Ga0207647_10017636 Ga0207647_100176365 232
145 3300025912 Ga0207707_10358770 Ga0207707_103587702 232
146 3300025913 Ga0207695_10086491 Ga0207695_100864913 232
147 3300025920 Ga0207649_10077898 Ga0207649_100778981 232
148 3300025921 Ga0207652_10186783 Ga0207652_101867832 232
149 3300025923 Ga0207681_10061428 Ga0207681_100614282 232
150 3300025924 Ga0207694_10005716 Ga0207694_100057165 232
151 3300025931 Ga0207644_10016794 Ga0207644_100167942 232
152 3300025932 Ga0207690_10007000 Ga0207690_100070005 232
153 3300025941 Ga0207711_10000218 Ga0207711_1000021846 232
154 3300025949 Ga0207667_10538884 Ga0207667_105388842 232
155 3300025972 Ga0207668_10657151 Ga0207668_106571512 232
156 3300025981 Ga0207640_10132746 Ga0207640_101327462 232
157 3300025986 Ga0207658_10004040 Ga0207658_100040409 232
158 3300026041 Ga0207639_10004582 Ga0207639_100045822 232
159 3300026041 Ga0207639_10065848 Ga0207639_100658483 232
160 3300026067 Ga0207678_10031885 Ga0207678_100318854 232
161 3300026088 Ga0207641_10000573 Ga0207641_1000057312 232
162 3300026095 Ga0207676_10006684 Ga0207676_1000668411 232
163 3300026142 Ga0207698_10036238 Ga0207698_100362382 232
164 3300028381 Ga0268264_10002999 Ga0268264_1000299919 232
165 3300030742 Ga0316183_1061051 Ga0316183_10610514 232
166 3300031548 Ga0307408_100214561 Ga0307408_1002145612 232
167 3300031852 Ga0307410_10009384 Ga0307410_100093846 232
168 3300031852 Ga0307410_10101130 Ga0307410_101011302 232
169 3300031852 Ga0307410_10387152 Ga0307410_103871522 232
170 3300032004 Ga0307414_10027263 Ga0307414_100272632 232
171 3300032004 Ga0307414_10100102 Ga0307414_101001022 232
172 3300032004 Ga0307414_10303816 Ga0307414_103038161 232
173 3300032126 Ga0307415_100045133 Ga0307415_1000451333 232
174 3300032126 Ga0307415_100323770 Ga0307415_1003237702 232
175 3300037312 Ga0395899_0004210 Ga0395899_0004210_4943_5647 232
176 3300037312 Ga0395899_0036210 Ga0395899_0036210_1387_2094 232
177 3300037418 Ga0395900_0046909 Ga0395900_0046909_403_1107 232
178 3300037418 Ga0395900_0097216 Ga0395900_0097216_1962_2669 232
179 3300037418 Ga0395900_0105672 Ga0395900_0105672_2125_2874 232
180 3300037466 Ga0395898_0051023 Ga0395898_0051023_1306_2007 232
181 3300037466 Ga0395898_0095341 Ga0395898_0095341_1624_2328 232
182 3300037466 Ga0395898_0470903 Ga0395898_0470903_350_1057 232
183 3300037471 Ga0395905_0011536 Ga0395905_0011536_4785_5486 232
184 3300037471 Ga0395905_0081645 Ga0395905_0081645_1923_2627 232
185 3300038443 Ga0395901_0011458 Ga0395901_0011458_6747_7448 232
186 3300038443 Ga0395901_0054842 Ga0395901_0054842_403_1107 232
187 3300038443 Ga0395901_0150745 Ga0395901_0150745_1552_2259 232
188 3300038443 Ga0395901_0365771 Ga0395901_0365771_480_1235 232
189 3300044765 Ga0466970_0335243 Ga0466970_0335243_37_753 232
190 3300045976 Ga0466967_0342704 Ga0466967_0342704_431_1162 232
191 3300046500 Ga0495596_0051185 Ga0495596_0051185_636_1346 232
192 3300046525 Ga0495663_0000381 Ga0495663_0000381_306_1016 232
193 3300046525 Ga0495663_0025859 Ga0495663_0025859_994_1698 232
194 3300046539 Ga0495621_0001871 Ga0495621_0001871_3444_4154 232
195 3300046539 Ga0495621_0012902 Ga0495621_0012902_1829_2539 232
196 3300046691 Ga0495670_0006356 Ga0495670_0006356_1483_2193 232
197 3300047445 Ga0495677_0021191 Ga0495677_0021191_22_732 232
198 3300048905 Ga0496102_0189171 Ga0496102_0189171_1205_1912 232
199 3300048918 Ga0496115_0004538 Ga0496115_0004538_4255_5007 232
200 3300049679 Ga0501249_000065 Ga0501249_000065_24793_25497 232
201 3300049765 Ga0501268_008041 Ga0501268_008041_588_1292 232
202 3300050511 nmdc:mga08y16_404379_c1 nmdc:mga08y16_404379_c1_419_1129 232
203 3300005335 Ga0070666_10118718 Ga0070666_101187182 233
204 3300005355 Ga0070671_100090107 Ga0070671_1000901072 233
205 3300005548 Ga0070665_100000995 Ga0070665_10000099523 233
206 3300006237 Ga0097621_100042600 Ga0097621_1000426004 233
207 3300009177 Ga0105248_10004409 Ga0105248_1000440913 233
208 3300025931 Ga0207644_10088267 Ga0207644_100882672 233
209 3300028379 Ga0268266_10000318 Ga0268266_1000031819 233
210 3300031548 Ga0307408_100368993 Ga0307408_1003689932 233
211 3300031731 Ga0307405_10097097 Ga0307405_100970972 233
212 3300031852 Ga0307410_10786151 Ga0307410_107861511 233
213 3300031903 Ga0307407_10131287 Ga0307407_101312872 233
214 3300031995 Ga0307409_100020353 Ga0307409_1000203535 233
215 3300032002 Ga0307416_101239744 Ga0307416_1012397441 233
216 3300032005 Ga0307411_10172896 Ga0307411_101728962 233
217 3300048903 Ga0496100_0014341 Ga0496100_0014341_3864_4577 233
218 3300048909 Ga0496106_0210182 Ga0496106_0210182_137_850 233
219 3300048910 Ga0496107_0034070 Ga0496107_0034070_1090_1803 233
220 3300048917 Ga0496114_0034446 Ga0496114_0034446_3315_4028 233
221 3300031548 Ga0307408_100047500 Ga0307408_1000475002 234
222 3300031852 Ga0307410_10059913 Ga0307410_100599135 234
223 3300031901 Ga0307406_10057012 Ga0307406_100570122 234
224 3300031911 Ga0307412_10069189 Ga0307412_100691892 234
225 3300031995 Ga0307409_100311707 Ga0307409_1003117072 234
226 3300032004 Ga0307414_10065036 Ga0307414_100650362 234
227 3300032005 Ga0307411_10243488 Ga0307411_102434881 234
228 3300005333 Ga0070677_10191319 Ga0070677_101913191 236
229 3300005339 Ga0070660_100020164 Ga0070660_1000201643 236
230 3300005345 Ga0070692_10003730 Ga0070692_100037303 236
231 3300005366 Ga0070659_100004185 Ga0070659_1000041858 236
232 3300005444 Ga0070694_100009908 Ga0070694_1000099084 236
233 3300005457 Ga0070662_100012344 Ga0070662_1000123446 236
234 3300005539 Ga0068853_100022599 Ga0068853_1000225996 236
235 3300005543 Ga0070672_100013761 Ga0070672_1000137612 236
236 3300005547 Ga0070693_100394780 Ga0070693_1003947801 236
237 3300005616 Ga0068852_100142460 Ga0068852_1001424601 236
238 3300005843 Ga0068860_100019107 Ga0068860_1000191073 236
239 3300009093 Ga0105240_10116117 Ga0105240_101161172 236
240 3300009148 Ga0105243_10235632 Ga0105243_102356322 236
241 3300009174 Ga0105241_10151503 Ga0105241_101515032 236
242 3300009553 Ga0105249_10015864 Ga0105249_100158646 236
243 3300010375 Ga0105239_10068720 Ga0105239_100687204 236
244 3300013100 Ga0157373_10281149 Ga0157373_102811491 236
245 3300013102 Ga0157371_10243502 Ga0157371_102435022 236
246 3300025904 Ga0207647_10009611 Ga0207647_100096115 236
247 3300025913 Ga0207695_10442823 Ga0207695_104428232 236
248 3300025919 Ga0207657_10002328 Ga0207657_100023285 236
249 3300025923 Ga0207681_10168032 Ga0207681_101680321 236
250 3300025932 Ga0207690_10004216 Ga0207690_100042164 236
251 3300025933 Ga0207706_10016261 Ga0207706_100162613 236
252 3300025933 Ga0207706_10081224 Ga0207706_100812242 236
253 3300025961 Ga0207712_10002447 Ga0207712_100024477 236
254 3300025972 Ga0207668_10040684 Ga0207668_100406843 236
255 3300026041 Ga0207639_10113515 Ga0207639_101135153 236
256 3300026116 Ga0207674_10169228 Ga0207674_101692282 236
257 3300026142 Ga0207698_10090233 Ga0207698_100902332 236
258 3300028381 Ga0268264_10001863 Ga0268264_100018636 236
259 3300031824 Ga0307413_10248855 Ga0307413_102488551 236
260 3300037312 Ga0395899_0219254 Ga0395899_0219254_128_844 236
261 3300037418 Ga0395900_0278227 Ga0395900_0278227_761_1477 236
262 3300037471 Ga0395905_0684796 Ga0395905_0684796_162_878 236
263 3300038443 Ga0395901_0588303 Ga0395901_0588303_218_934 236
264 iso_pu_bacteria 2896429255 2896430753 236
265 3300014326 Ga0157380_10273140 Ga0157380_102731402 237
266 3300031995 Ga0307409_100704721 Ga0307409_1007047212 237
267 3300031731 Ga0307405_10187833 Ga0307405_101878333 238
268 3300031824 Ga0307413_10010607 Ga0307413_100106075 238
269 3300031903 Ga0307407_10042853 Ga0307407_100428533 238
270 3300031995 Ga0307409_100016750 Ga0307409_1000167503 238
271 3300031995 Ga0307409_100036139 Ga0307409_1000361391 238
272 3300032004 Ga0307414_10014045 Ga0307414_100140455 238
273 3300032005 Ga0307411_10055267 Ga0307411_100552672 238
274 3300032126 Ga0307415_100552835 Ga0307415_1005528352 238
275 3300046664 Ga0495659_0085818 Ga0495659_0085818_178_906 239
276 3300032004 Ga0307414_10041379 Ga0307414_100413792 240
277 3300001990 JGI24737J22298_10000293 JGI24737J22298_100002934 241
278 3300002075 JGI24738J21930_10000814 JGI24738J21930_100008141 241
279 3300005327 Ga0070658_10091850 Ga0070658_100918502 241
280 3300005328 Ga0070676_10004996 Ga0070676_100049967 241
281 3300005333 Ga0070677_10089095 Ga0070677_100890952 241
282 3300005334 Ga0068869_100000094 Ga0068869_10000009419 241
283 3300005334 Ga0068869_100054716 Ga0068869_1000547161 241
284 3300005338 Ga0068868_100000113 Ga0068868_10000011311 241
285 3300005339 Ga0070660_100041201 Ga0070660_1000412011 241
286 3300005340 Ga0070689_100219498 Ga0070689_1002194982 241
287 3300005343 Ga0070687_100240747 Ga0070687_1002407471 241
288 3300005344 Ga0070661_100016841 Ga0070661_1000168416 241
289 3300005347 Ga0070668_100002775 Ga0070668_1000027755 241
290 3300005353 Ga0070669_100000155 Ga0070669_10000015521 241
291 3300005354 Ga0070675_100022533 Ga0070675_1000225337 241
292 3300005356 Ga0070674_100019554 Ga0070674_1000195542 241
293 3300005364 Ga0070673_100001756 Ga0070673_10000175611 241
294 3300005366 Ga0070659_100000305 Ga0070659_10000030524 241
295 3300005366 Ga0070659_100126912 Ga0070659_1001269123 241
296 3300005367 Ga0070667_100003284 Ga0070667_1000032843 241
297 3300005367 Ga0070667_100020175 Ga0070667_1000201755 241
298 3300005457 Ga0070662_100017631 Ga0070662_1000176313 241
299 3300005457 Ga0070662_100024764 Ga0070662_1000247642 241
300 3300005458 Ga0070681_10062150 Ga0070681_100621503 241
301 3300005459 Ga0068867_100001817 Ga0068867_10000181716 241
302 3300005459 Ga0068867_100010918 Ga0068867_1000109185 241
303 3300005530 Ga0070679_100088459 Ga0070679_1000884592 241
304 3300005539 Ga0068853_100005924 Ga0068853_1000059247 241
305 3300005543 Ga0070672_100000710 Ga0070672_10000071012 241
306 3300005545 Ga0070695_100152172 Ga0070695_1001521721 241
307 3300005547 Ga0070693_100108366 Ga0070693_1001083662 241
308 3300005548 Ga0070665_100171238 Ga0070665_1001712383 241
309 3300005563 Ga0068855_100038147 Ga0068855_1000381473 241
310 3300005564 Ga0070664_100032263 Ga0070664_1000322632 241
311 3300005577 Ga0068857_100004853 Ga0068857_10000485310 241
312 3300005577 Ga0068857_100018433 Ga0068857_1000184336 241
313 3300005578 Ga0068854_100000206 Ga0068854_10000020633 241
314 3300005578 Ga0068854_100079015 Ga0068854_1000790151 241
315 3300005614 Ga0068856_100116421 Ga0068856_1001164213 241
316 3300005616 Ga0068852_100002924 Ga0068852_1000029246 241
317 3300005617 Ga0068859_100007995 Ga0068859_1000079955 241
318 3300005617 Ga0068859_100148071 Ga0068859_1001480712 241
319 3300005617 Ga0068859_100152907 Ga0068859_1001529074 241
320 3300005618 Ga0068864_100000428 Ga0068864_10000042841 241
321 3300005618 Ga0068864_100019569 Ga0068864_1000195696 241
322 3300005718 Ga0068866_10082265 Ga0068866_100822652 241
323 3300005718 Ga0068866_10227022 Ga0068866_102270221 241
324 3300005719 Ga0068861_100341256 Ga0068861_1003412562 241
325 3300005834 Ga0068851_10133079 Ga0068851_101330792 241
326 3300005841 Ga0068863_100000634 Ga0068863_10000063417 241
327 3300005842 Ga0068858_100001980 Ga0068858_10000198012 241
328 3300005842 Ga0068858_100012384 Ga0068858_1000123847 241
329 3300005843 Ga0068860_100003691 Ga0068860_10000369115 241
330 3300005843 Ga0068860_100051191 Ga0068860_1000511915 241
331 3300005843 Ga0068860_100541909 Ga0068860_1005419092 241
332 3300005844 Ga0068862_100036890 Ga0068862_1000368905 241
333 3300006358 Ga0068871_100058543 Ga0068871_1000585434 241
334 3300006931 Ga0097620_100007995 Ga0097620_1000079959 241
335 3300006931 Ga0097620_100148071 Ga0097620_1001480712 241
336 3300006931 Ga0097620_100152919 Ga0097620_1001529194 241
337 3300009098 Ga0105245_10038702 Ga0105245_100387021 241
338 3300009098 Ga0105245_10096984 Ga0105245_100969844 241
339 3300009174 Ga0105241_10713948 Ga0105241_107139481 241
340 3300009177 Ga0105248_10001472 Ga0105248_100014729 241
341 3300009551 Ga0105238_10031422 Ga0105238_100314226 241
342 3300013100 Ga0157373_10002262 Ga0157373_100022628 241
343 3300013102 Ga0157371_10002300 Ga0157371_1000230011 241
344 3300013297 Ga0157378_10001977 Ga0157378_100019775 241
345 3300013306 Ga0163162_10023769 Ga0163162_100237695 241
346 3300013306 Ga0163162_10024015 Ga0163162_100240156 241
347 3300013308 Ga0157375_10343690 Ga0157375_103436902 241
348 3300014325 Ga0163163_10082441 Ga0163163_100824412 241
349 3300017792 Ga0163161_10192997 Ga0163161_101929972 241
350 3300025315 Ga0207697_10000109 Ga0207697_1000010911 241
351 3300025321 Ga0207656_10090302 Ga0207656_100903022 241
352 3300025893 Ga0207682_10146201 Ga0207682_101462012 241
353 3300025901 Ga0207688_10000437 Ga0207688_1000043723 241
354 3300025904 Ga0207647_10000446 Ga0207647_1000044617 241
355 3300025907 Ga0207645_10022319 Ga0207645_100223192 241
356 3300025912 Ga0207707_10241931 Ga0207707_102419312 241
357 3300025917 Ga0207660_10005689 Ga0207660_100056894 241
358 3300025919 Ga0207657_10002553 Ga0207657_1000255322 241
359 3300025920 Ga0207649_10280471 Ga0207649_102804712 241
360 3300025921 Ga0207652_10018615 Ga0207652_100186155 241
361 3300025923 Ga0207681_10001626 Ga0207681_1000162616 241
362 3300025924 Ga0207694_10107887 Ga0207694_101078872 241
363 3300025926 Ga0207659_10017980 Ga0207659_100179806 241
364 3300025927 Ga0207687_10020101 Ga0207687_100201013 241
365 3300025927 Ga0207687_10375316 Ga0207687_103753162 241
366 3300025931 Ga0207644_10142711 Ga0207644_101427112 241
367 3300025932 Ga0207690_10016590 Ga0207690_100165906 241
368 3300025932 Ga0207690_10260500 Ga0207690_102605002 241
369 3300025933 Ga0207706_10000300 Ga0207706_1000030051 241
370 3300025933 Ga0207706_10003071 Ga0207706_100030719 241
371 3300025933 Ga0207706_10043528 Ga0207706_100435282 241
372 3300025936 Ga0207670_10015979 Ga0207670_100159792 241
373 3300025940 Ga0207691_10000294 Ga0207691_1000029412 241
374 3300025940 Ga0207691_10094196 Ga0207691_100941962 241
375 3300025941 Ga0207711_10003143 Ga0207711_100031437 241
376 3300025942 Ga0207689_10000064 Ga0207689_1000006419 241
377 3300025942 Ga0207689_10064262 Ga0207689_100642622 241
378 3300025945 Ga0207679_10186785 Ga0207679_101867852 241
379 3300025949 Ga0207667_10020043 Ga0207667_100200436 241
380 3300025960 Ga0207651_10000355 Ga0207651_1000035518 241
381 3300025972 Ga0207668_10453983 Ga0207668_104539832 241
382 3300025981 Ga0207640_10001142 Ga0207640_100011427 241
383 3300025981 Ga0207640_10023138 Ga0207640_100231381 241
384 3300025986 Ga0207658_10183280 Ga0207658_101832802 241
385 3300026023 Ga0207677_10006963 Ga0207677_100069635 241
386 3300026035 Ga0207703_10008809 Ga0207703_100088096 241
387 3300026067 Ga0207678_10133243 Ga0207678_101332433 241
388 3300026078 Ga0207702_10015844 Ga0207702_100158444 241
389 3300026088 Ga0207641_10016059 Ga0207641_100160592 241
390 3300026088 Ga0207641_10034128 Ga0207641_100341284 241
391 3300026089 Ga0207648_10001537 Ga0207648_1000153728 241
392 3300026089 Ga0207648_10008749 Ga0207648_1000874911 241
393 3300026095 Ga0207676_10004949 Ga0207676_100049492 241
394 3300026116 Ga0207674_10002909 Ga0207674_1000290922 241
395 3300026116 Ga0207674_10008433 Ga0207674_100084335 241
396 3300026118 Ga0207675_100262336 Ga0207675_1002623362 241
397 3300026121 Ga0207683_10013889 Ga0207683_100138896 241
398 3300026142 Ga0207698_10010153 Ga0207698_100101532 241
399 3300028380 Ga0268265_10026131 Ga0268265_100261312 241
400 3300028381 Ga0268264_10018939 Ga0268264_100189395 241
401 3300028381 Ga0268264_10058563 Ga0268264_100585632 241
402 3300028381 Ga0268264_10461026 Ga0268264_104610262 241
403 3300032005 Ga0307411_10504791 Ga0307411_105047912 241
404 3300037418 Ga0395900_0053036 Ga0395900_0053036_1902_2627 241
405 3300037471 Ga0395905_0026975 Ga0395905_0026975_3788_4516 241
406 3300037471 Ga0395905_0072001 Ga0395905_0072001_243_968 241
407 3300044901 Ga0466960_0033135 Ga0466960_0033135_1233_1979 241
408 3300046525 Ga0495663_0003568 Ga0495663_0003568_1310_2047 241
409 3300048905 Ga0496102_0039069 Ga0496102_0039069_1793_2521 241
410 3300048906 Ga0496103_0016684 Ga0496103_0016684_1040_1768 241
411 3300048907 Ga0496104_0555192 Ga0496104_0555192_216_944 241
412 3300048910 Ga0496107_0026987 Ga0496107_0026987_565_1293 241
413 3300048912 Ga0496109_0078718 Ga0496109_0078718_216_944 241
414 3300048914 Ga0496111_0244087 Ga0496111_0244087_89_817 241
415 3300048915 Ga0496112_0056962 Ga0496112_0056962_644_1372 241

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02146

SIR2

Sir2 family

55

226

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rxl-assembly1.cif.gz_A crystal structure of cobb wt in complex with h4k16-crotonyl peptide 0.9561 4 234
1s5p-assembly1.cif.gz_A structure and substrate binding properties of cobb, a sir2 homolog protein deacetylase from eschericia coli. 0.948 4 234
6rxr-assembly1.cif.gz_A crystal structure of cobb ac2 (a76g, i131c, v162g) in complex with h4k16cr-2'oh-adpr peptide intermediate after co-crystallisation 0.9432 4 234
6rxr-assembly4.cif.gz_D crystal structure of cobb ac2 (a76g, i131c, v162g) in complex with h4k16cr-2'oh-adpr peptide intermediate after co-crystallisation 0.9417 4 234
6rxm-assembly4.cif.gz_D crystal structure of cobb ac2 (a76g, i131c, v162g) in complex with h4k16-acetyl peptide 0.9405 4 233
ID Description Score Start End Superfamily
af_A4IAM7_70_238_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9689 67 231 3.40.50.1220
1s5pA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9629 4 234 3.40.50.1220
af_P75960_40_271_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9522 4 231 3.40.50.1220
1s5pA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9424 4 234 3.40.50.1220
af_Q68FX9_35_302_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9415 2 227 3.40.50.1220
ID Description Score Start End GO Terms
AF-A0A848SJA8-F1-model_v4 protein acetyllysine N-acetyltransferase (EC 2.3.1.286) 0.987 1 162 GO:0017136
GO:0046872
GO:0070403
AF-A0A258Z3L3-F1-model_v4 deleted 0.9772 1 232
AF-A0A258H6Y7-F1-model_v4 NAD-dependent protein deacylase (EC 2.3.1.286) (Regulatory protein SIR2 homolog) 0.9753 1 231 GO:0005737
GO:0008270
GO:0032041
GO:0036054
GO:0036055
GO:0046969
GO:0046970
GO:0070403
GO:0097372
GO:0140765
GO:0141222
AF-A0A858RRV6-F1-model_v4 NAD-dependent protein deacylase (EC 2.3.1.286) (Regulatory protein SIR2 homolog) 0.9753 5 230 GO:0005737
GO:0008270
GO:0017136
GO:0036054
GO:0036055
GO:0070403
AF-T0GFY6-F1-model_v4 NAD-dependent protein deacylase (EC 2.3.1.286) (Regulatory protein SIR2 homolog) 0.9751 2 231 GO:0005737
GO:0008270
GO:0032041
GO:0036054
GO:0036055
GO:0046969
GO:0046970
GO:0070403
GO:0097372
GO:0140765
GO:0141222

Feature Viewer

pLDDT pTM Quality
92.96 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map