F438508

General Info

Members Datasets Scaffolds Average Seq Length
415 182 830 122

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_101525137|Ga0070707_1015251371
Length 132
Sequence VRGAENTVMTSPSLARPEIQAELISEALGSASVGFLVWDDHRRYIAANAAACEILGTTLEELLGQQVGGHTVEGLDAVEDALATGFSSGTATVQRFDGRGPVDVFYATFTTKTAGMPFMATVIAPLATDAPR

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
83 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
84 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
85 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
86 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
87 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
88 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
89 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
90 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
97 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
98 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
99 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
100 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
101 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
102 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
103 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
104 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
105 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
106 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
107 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
108 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
109 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
110 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
113 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
114 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
115 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
116 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
117 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
118 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
119 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
120 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
121 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
122 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
123 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
124 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
125 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
126 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
127 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
128 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
129 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
130 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
131 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
132 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
133 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
134 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
135 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
136 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
137 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
138 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
139 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
140 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
141 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
142 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
143 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
144 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
145 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
146 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
147 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
148 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
149 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
150 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
151 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
152 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
153 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
154 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
155 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
156 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
174 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
175 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
176 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
177 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
178 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
179 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
180 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
181 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
182 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.52
Metatranscriptomes 0.48
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.19
Rhizosphere 91.57
Stem 0
Stem Tuber 0
Unclassified 17.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_101525137 3300005468 Unclassified 635
2 Ga0070658_10008960 3300005327 Bacteria 8042
3 Ga0070683_100125918 3300005329 Bacteria 2422
4 Ga0070683_100336483 3300005329 Bacteria 1437
5 Ga0070683_101083094 3300005329 Bacteria 770
6 Ga0070680_100056139 3300005336 Bacteria 3219
7 Ga0070680_100251123 3300005336 Bacteria 1495
8 Ga0070680_100496276 3300005336 Bacteria 1044
9 Ga0070682_100024366 3300005337 Bacteria 3601
10 Ga0070682_100668143 3300005337 Unclassified 829
11 Ga0068868_101158475 3300005338 Bacteria 713
12 Ga0070660_100005286 3300005339 Bacteria 8930
13 Ga0070660_100443841 3300005339 Bacteria 1076
14 Ga0070691_10015645 3300005341 Bacteria 3485
15 Ga0070687_100344411 3300005343 Bacteria 960
16 Ga0070661_100052729 3300005344 Bacteria 2977
17 Ga0070671_100192992 3300005355 Bacteria 1726
18 Ga0070659_100037615 3300005366 Bacteria 3774
19 Ga0070709_10014329 3300005434 Bacteria 4482
20 Ga0070709_10316037 3300005434 Unclassified 1145
21 Ga0070714_100003882 3300005435 Bacteria 11227
22 Ga0070714_100015515 3300005435 Bacteria 6128
23 Ga0070714_100037596 3300005435 Bacteria 4068
24 Ga0070714_100087931 3300005435 Bacteria 2718
25 Ga0070714_100096278 3300005435 Bacteria 2600
26 Ga0070714_100118556 3300005435 Bacteria 2352
27 Ga0070714_100642931 3300005435 Bacteria 1021
28 Ga0070713_100071586 3300005436 Bacteria 2930
29 Ga0070713_100513227 3300005436 Bacteria 1132
30 Ga0070710_10003777 3300005437 Bacteria 7164
31 Ga0070710_10271137 3300005437 Bacteria 1098
32 Ga0070711_100311710 3300005439 Bacteria 1254
33 Ga0070705_100236897 3300005440 Unclassified 1273
34 Ga0070694_100099780 3300005444 Bacteria 2052
35 Ga0070663_100746545 3300005455 Unclassified 835
36 Ga0070678_101321414 3300005456 Bacteria 671
37 Ga0070681_10025398 3300005458 Bacteria 5959
38 Ga0070681_10081959 3300005458 Bacteria 3182
39 Ga0070681_10144377 3300005458 Bacteria 2309
40 Ga0070699_100868133 3300005518 Bacteria 826
41 Ga0070679_100061051 3300005530 Bacteria 3757
42 Ga0070679_100093878 3300005530 Bacteria 2987
43 Ga0070684_100181184 3300005535 Bacteria 1915
44 Ga0070697_100830707 3300005536 Unclassified 818
45 Ga0070672_100577896 3300005543 Bacteria 977
46 Ga0070686_100582565 3300005544 Bacteria 879
47 Ga0070695_100000009 3300005545 Bacteria 87710
48 Ga0070695_100579410 3300005545 Bacteria 878
49 Ga0070693_100821223 3300005547 Unclassified 691
50 Ga0070693_101017491 3300005547 Unclassified 628
51 Ga0068855_100024180 3300005563 Bacteria 7272
52 Ga0068856_100086712 3300005614 Bacteria 3111
53 Ga0068856_100477383 3300005614 Bacteria 1268
54 Ga0068856_101689111 3300005614 Unclassified 646
55 Ga0070702_100018904 3300005615 Bacteria 3582
56 Ga0068852_100106467 3300005616 Bacteria 2542
57 Ga0068863_100053297 3300005841 Bacteria 3834
58 Ga0070717_10011983 3300006028 Bacteria 6600
59 Ga0070717_10033681 3300006028 Bacteria 4134
60 Ga0070716_100388343 3300006173 Unclassified 1000
61 Ga0070712_100509384 3300006175 Bacteria 1010
62 Ga0070712_100635531 3300006175 Bacteria 906
63 Ga0097621_100657241 3300006237 Bacteria 962
64 Ga0068871_101188671 3300006358 Bacteria 715
65 Ga0075433_10405169 3300006852 Bacteria 1203
66 Ga0075434_100018013 3300006871 Bacteria 6814
67 Ga0075435_100179885 3300007076 Unclassified 1787
68 Ga0105240_10053517 3300009093 Bacteria 5066
69 Ga0105240_10125221 3300009093 Bacteria 3089
70 Ga0105245_12149257 3300009098 Bacteria 612
71 Ga0105241_10679025 3300009174 Bacteria 938
72 Ga0105248_10136247 3300009177 Bacteria 2769
73 Ga0105237_10043931 3300009545 Bacteria 4500
74 Ga0105238_10031975 3300009551 Bacteria 5355
75 Ga0105238_10352165 3300009551 Bacteria 1461
76 Ga0157370_10181854 3300013104 Bacteria 1954
77 Ga0157369_10030846 3300013105 Bacteria 5910
78 Ga0157369_10337795 3300013105 Bacteria 1565
79 Ga0157369_10493649 3300013105 Bacteria 1267
80 Ga0157374_10102216 3300013296 Bacteria 2749
81 Ga0157374_11708509 3300013296 Unclassified 654
82 Ga0163162_10217169 3300013306 Bacteria 2042
83 Ga0157372_10041390 3300013307 Bacteria 5095
84 Ga0157372_10227126 3300013307 Bacteria 2164
85 Ga0157372_10230787 3300013307 Bacteria 2146
86 Ga0157372_10480596 3300013307 Bacteria 1448
87 Ga0182008_10161128 3300014497 Bacteria 1129
88 Ga0182008_10538009 3300014497 Unclassified 647
89 Ga0157376_10318107 3300014969 Bacteria 1479
90 Ga0206356_11075183 3300020070 Bacteria 674
91 Ga0206354_10093681 3300020081 Bacteria 824
92 Ga0207692_10008654 3300025898 Bacteria 4222
93 Ga0207692_11013787 3300025898 Unclassified 548
94 Ga0207647_10314834 3300025904 Unclassified 889
95 Ga0207699_10147140 3300025906 Bacteria 1554
96 Ga0207699_10791013 3300025906 Unclassified 697
97 Ga0207654_10541405 3300025911 Bacteria 826
98 Ga0207707_10109612 3300025912 Bacteria 2413
99 Ga0207707_10280104 3300025912 Bacteria 1444
100 Ga0207707_10285591 3300025912 Bacteria 1428
101 Ga0207693_10008691 3300025915 Bacteria 8307
102 Ga0207693_10147382 3300025915 Bacteria 1851
103 Ga0207693_10794505 3300025915 Unclassified 730
104 Ga0207663_10018096 3300025916 Bacteria 3940
105 Ga0207663_10224278 3300025916 Bacteria 1369
106 Ga0207663_10229339 3300025916 Unclassified 1356
107 Ga0207663_11000576 3300025916 Bacteria 671
108 Ga0207660_10013739 3300025917 Bacteria 5312
109 Ga0207660_10166925 3300025917 Bacteria 1702
110 Ga0207660_10204765 3300025917 Bacteria 1542
111 Ga0207660_10565993 3300025917 Bacteria 925
112 Ga0207662_10239646 3300025918 Bacteria 1187
113 Ga0207657_10002647 3300025919 Bacteria 19326
114 Ga0207657_10643775 3300025919 Bacteria 825
115 Ga0207649_10032018 3300025920 Bacteria 3131
116 Ga0207652_10226694 3300025921 Bacteria 1684
117 Ga0207694_10485247 3300025924 Bacteria 1034
118 Ga0207687_10084386 3300025927 Bacteria 2302
119 Ga0207700_10037850 3300025928 Bacteria 3497
120 Ga0207700_10161197 3300025928 Bacteria 1863
121 Ga0207664_10008513 3300025929 Bacteria 7162
122 Ga0207664_10012180 3300025929 Bacteria 6145
123 Ga0207664_10103037 3300025929 Bacteria 2361
124 Ga0207664_11786989 3300025929 Unclassified 537
125 Ga0207665_11246209 3300025939 Bacteria 593
126 Ga0207711_10353959 3300025941 Bacteria 1360
127 Ga0207661_10133760 3300025944 Bacteria 2127
128 Ga0207679_11184285 3300025945 Bacteria 701
129 Ga0207639_10202392 3300026041 Bacteria 1704
130 Ga0207702_10113566 3300026078 Bacteria 2412
131 Ga0207702_10424148 3300026078 Bacteria 1287
132 Ga0207683_11204195 3300026121 Bacteria 702
133 Ga0373953_0083240 3300035117 Bacteria 1333
134 Ga0373957_0084356 3300035120 Bacteria 1257
135 Ga0373943_0735446 3300035170 Unclassified 585
136 Ga0373962_0343924 3300035242 Unclassified 538
137 Ga0373924_0052587 3300035410 Bacteria 1691
138 Ga0373931_0439255 3300035691 Bacteria 833
139 Ga0373927_0999859 3300035695 Bacteria 552
140 Ga0373933_0164232 3300035724 Bacteria 1411
141 Ga0373947_0327888 3300035725 Unclassified 1025
142 Ga0395899_0071457 3300037312 Bacteria 2540
143 Ga0395900_0095663 3300037418 Bacteria 3052
144 Ga0395898_1314421 3300037466 Bacteria 652
145 Ga0395898_1409712 3300037466 Bacteria 624
146 Ga0395905_0247109 3300037471 Bacteria 1667
147 Ga0395905_0340152 3300037471 Bacteria 1392
148 Ga0395905_1512004 3300037471 Unclassified 576
149 Ga0395901_0023714 3300038443 Bacteria 6292
150 Ga0436360_0939065 3300039438 Bacteria 2003
151 Ga0451853_1839916 3300041512 Bacteria 1663
152 Ga0466969_0014597 3300044656 Bacteria 4129
153 Ga0466969_0030445 3300044656 Bacteria 2750
154 Ga0466969_0083360 3300044656 Bacteria 1523
155 Ga0466969_0098424 3300044656 Bacteria 1379
156 Ga0466965_0022314 3300044683 Bacteria 3053
157 Ga0466965_0078430 3300044683 Bacteria 1668
158 Ga0466965_0128597 3300044683 Bacteria 1312
159 Ga0466965_0255907 3300044683 Bacteria 940
160 Ga0466966_0008887 3300044684 Bacteria 6653
161 Ga0466966_0010970 3300044684 Bacteria 6013
162 Ga0466961_0003736 3300044693 Bacteria 9511
163 Ga0466961_0010777 3300044693 Bacteria 5839
164 Ga0466961_0026591 3300044693 Bacteria 3719
165 Ga0466961_0028328 3300044693 Bacteria 3601
166 Ga0466961_0029065 3300044693 Bacteria 3554
167 Ga0466961_0109590 3300044693 Bacteria 1738
168 Ga0466961_0151244 3300044693 Bacteria 1449
169 Ga0466961_0300398 3300044693 Bacteria 981
170 Ga0466963_0001936 3300044694 Bacteria 11343
171 Ga0466963_0004463 3300044694 Bacteria 8140
172 Ga0466963_0009708 3300044694 Bacteria 5803
173 Ga0466963_0013356 3300044694 Bacteria 5041
174 Ga0466963_0016571 3300044694 Bacteria 4585
175 Ga0466963_0024005 3300044694 Bacteria 3878
176 Ga0466963_0024846 3300044694 Bacteria 3815
177 Ga0466963_0033129 3300044694 Bacteria 3351
178 Ga0466963_0074178 3300044694 Bacteria 2294
179 Ga0466963_0084750 3300044694 Bacteria 2151
180 Ga0466963_0085605 3300044694 Bacteria 2140
181 Ga0466963_0126863 3300044694 Bacteria 1759
182 Ga0466963_0671034 3300044694 Bacteria 731
183 Ga0466963_0787916 3300044694 Unclassified 670
184 Ga0466963_0796849 3300044694 Unclassified 666
185 Ga0466963_0858393 3300044694 Bacteria 640
186 Ga0466963_0866812 3300044694 Bacteria 637
187 Ga0466963_0994641 3300044694 Unclassified 590
188 Ga0466964_0005740 3300044706 Bacteria 4621
189 Ga0466964_0026024 3300044706 Bacteria 2287
190 Ga0466964_0029989 3300044706 Bacteria 2151
191 Ga0466964_0036849 3300044706 Bacteria 1963
192 Ga0466964_0045336 3300044706 Bacteria 1789
193 Ga0466964_0048333 3300044706 Bacteria 1739
194 Ga0466964_0066148 3300044706 Bacteria 1516
195 Ga0466964_0347277 3300044706 Unclassified 761
196 Ga0466964_0683313 3300044706 Bacteria 571
197 Ga0466971_0001034 3300044719 Bacteria 11524
198 Ga0466971_0001706 3300044719 Bacteria 9303
199 Ga0466971_0002143 3300044719 Bacteria 8360
200 Ga0466971_0004293 3300044719 Bacteria 6144
201 Ga0466971_0043859 3300044719 Unclassified 2009
202 Ga0466971_0061547 3300044719 Unclassified 1697
203 Ga0466971_0108725 3300044719 Bacteria 1278
204 Ga0466971_0175720 3300044719 Bacteria 1006
205 Ga0466971_0260253 3300044719 Bacteria 828
206 Ga0466971_0448961 3300044719 Bacteria 632
207 Ga0466968_0002079 3300044735 Bacteria 7289
208 Ga0466968_0011149 3300044735 Bacteria 3500
209 Ga0466968_0023492 3300044735 Bacteria 2512
210 Ga0466968_0036810 3300044735 Bacteria 2051
211 Ga0466968_0039188 3300044735 Bacteria 1994
212 Ga0466968_0051176 3300044735 Bacteria 1764
213 Ga0466968_0069707 3300044735 Unclassified 1529
214 Ga0466968_0460721 3300044735 Bacteria 629
215 Ga0466968_0489664 3300044735 Unclassified 611
216 Ga0466970_0006709 3300044765 Bacteria 5760
217 Ga0466970_0009785 3300044765 Bacteria 4854
218 Ga0466970_0047594 3300044765 Bacteria 2286
219 Ga0466970_0073862 3300044765 Bacteria 1835
220 Ga0466970_0278620 3300044765 Bacteria 940
221 Ga0466970_0284857 3300044765 Bacteria 930
222 Ga0466957_0002287 3300044842 Bacteria 10260
223 Ga0466957_0016406 3300044842 Bacteria 4333
224 Ga0466957_0027986 3300044842 Bacteria 3353
225 Ga0466957_0033053 3300044842 Bacteria 3101
226 Ga0466957_0085561 3300044842 Bacteria 1969
227 Ga0466957_0107452 3300044842 Bacteria 1766
228 Ga0466957_0603147 3300044842 Bacteria 769
229 Ga0466957_1072131 3300044842 Bacteria 580
230 Ga0466957_1090585 3300044842 Bacteria 575
231 Ga0466960_0091586 3300044901 Bacteria 1551
232 Ga0466960_0124504 3300044901 Bacteria 1354
233 Ga0466960_0290974 3300044901 Unclassified 918
234 Ga0466959_0026640 3300045049 Bacteria 4285
235 Ga0466959_0062787 3300045049 Unclassified 2699
236 Ga0466959_0090993 3300045049 Unclassified 2191
237 Ga0466959_0129408 3300045049 Bacteria 1789
238 Ga0466959_0200025 3300045049 Bacteria 1391
239 Ga0466959_0368117 3300045049 Unclassified 979
240 Ga0466958_0002464 3300045836 Bacteria 9301
241 Ga0466958_0002617 3300045836 Bacteria 9098
242 Ga0466958_0007132 3300045836 Bacteria 6124
243 Ga0466958_0009454 3300045836 Bacteria 5432
244 Ga0466958_0015935 3300045836 Bacteria 4321
245 Ga0466958_0037174 3300045836 Bacteria 2916
246 Ga0466958_0079054 3300045836 Bacteria 2022
247 Ga0466958_0180309 3300045836 Bacteria 1340
248 Ga0466958_0221890 3300045836 Bacteria 1206
249 Ga0466958_0230246 3300045836 Bacteria 1183
250 Ga0466958_0322225 3300045836 Bacteria 993
251 Ga0466958_0347701 3300045836 Bacteria 954
252 Ga0466958_0402390 3300045836 Unclassified 884
253 Ga0466958_0518906 3300045836 Bacteria 773
254 Ga0466958_0538865 3300045836 Bacteria 758
255 Ga0466967_0000615 3300045976 Bacteria 17720
256 Ga0466967_0001349 3300045976 Bacteria 14097
257 Ga0466967_0006046 3300045976 Bacteria 8509
258 Ga0466967_0008052 3300045976 Bacteria 7682
259 Ga0466967_0010668 3300045976 Bacteria 6907
260 Ga0466967_0031102 3300045976 Unclassified 4489
261 Ga0466967_0034487 3300045976 Bacteria 4296
262 Ga0466967_0050111 3300045976 Bacteria 3655
263 Ga0466967_0083108 3300045976 Bacteria 2895
264 Ga0466967_0125810 3300045976 Bacteria 2374
265 Ga0466967_0134863 3300045976 Bacteria 2295
266 Ga0466967_0146938 3300045976 Bacteria 2199
267 Ga0466967_0155555 3300045976 Bacteria 2141
268 Ga0466967_0177794 3300045976 Unclassified 2005
269 Ga0466967_0228883 3300045976 Bacteria 1769
270 Ga0466967_0282672 3300045976 Unclassified 1592
271 Ga0466967_0458919 3300045976 Bacteria 1246
272 Ga0466967_0556959 3300045976 Unclassified 1129
273 Ga0466967_0760052 3300045976 Bacteria 961
274 Ga0466967_0788773 3300045976 Unclassified 943
275 Ga0466967_1052612 3300045976 Bacteria 810
276 Ga0495592_0135636 3300046454 Bacteria 1717
277 Ga0495629_0017718 3300046459 Bacteria 5105
278 Ga0495629_0103661 3300046459 Unclassified 1984
279 Ga0495629_0143085 3300046459 Bacteria 1664
280 Ga0495629_0147946 3300046459 Bacteria 1633
281 Ga0495641_0014119 3300046461 Bacteria 4339
282 Ga0495641_0159625 3300046461 Unclassified 1008
283 Ga0495653_0034462 3300046463 Bacteria 4005
284 Ga0495653_0363938 3300046463 Unclassified 927
285 Ga0495582_0041245 3300046473 Bacteria 2543
286 Ga0495582_0287824 3300046473 Unclassified 944
287 Ga0495582_0305385 3300046473 Bacteria 915
288 Ga0495582_0884970 3300046473 Bacteria 516
289 Ga0495662_0122967 3300046476 Unclassified 1274
290 Ga0495664_0109959 3300046477 Bacteria 1663
291 Ga0495584_0120778 3300046491 Bacteria 1327
292 Ga0495596_0086246 3300046500 Bacteria 1219
293 Ga0495607_0041039 3300046501 Bacteria 2751
294 Ga0495608_0014717 3300046511 Bacteria 5429
295 Ga0495608_0035123 3300046511 Bacteria 3383
296 Ga0495608_0267385 3300046511 Unclassified 1063
297 Ga0495618_0130044 3300046514 Unclassified 1611
298 Ga0495618_0282150 3300046514 Bacteria 1036
299 Ga0495628_0840193 3300046516 Unclassified 640
300 Ga0495630_0059019 3300046517 Bacteria 2877
301 Ga0495630_0409914 3300046517 Bacteria 1038
302 Ga0495630_0567839 3300046517 Unclassified 870
303 Ga0495630_0891755 3300046517 Bacteria 678
304 Ga0495644_0085286 3300046523 Bacteria 1190
305 Ga0495663_0084910 3300046525 Bacteria 1025
306 Ga0495642_0170784 3300046528 Bacteria 945
307 Ga0495652_0093484 3300046529 Bacteria 2455
308 Ga0495652_0541640 3300046529 Bacteria 801
309 Ga0495640_0030113 3300046533 Bacteria 3889
310 Ga0495640_0447368 3300046533 Bacteria 789
311 Ga0495586_0016712 3300046535 Bacteria 3903
312 Ga0495586_0123875 3300046535 Bacteria 1445
313 Ga0495609_0273879 3300046538 Unclassified 691
314 Ga0495645_0144323 3300046543 Bacteria 1658
315 Ga0495667_0061792 3300046559 Bacteria 2455
316 Ga0495656_0001684 3300046615 Bacteria 7232
317 Ga0495634_0009047 3300046642 Bacteria 7365
318 Ga0495634_0262187 3300046642 Bacteria 1054
319 Ga0495634_0685294 3300046642 Unclassified 590
320 Ga0495611_0312929 3300046648 Bacteria 723
321 Ga0495635_0013680 3300046663 Bacteria 5678
322 Ga0495659_0112234 3300046664 Bacteria 1066
323 Ga0495661_0167627 3300046665 Bacteria 1174
324 Ga0495657_0015450 3300046675 Bacteria 5587
325 Ga0495623_0094142 3300046679 Bacteria 1833
326 Ga0495646_0186970 3300046680 Bacteria 1134
327 Ga0495647_0019446 3300046681 Bacteria 2428
328 Ga0495647_0112745 3300046681 Bacteria 1136
329 Ga0495658_0107907 3300046683 Unclassified 1671
330 Ga0495658_0548079 3300046683 Bacteria 740
331 Ga0495613_0010205 3300046689 Bacteria 6977
332 Ga0495613_0693070 3300046689 Unclassified 671
333 Ga0495613_0826574 3300046689 Unclassified 603
334 Ga0495624_0010750 3300046690 Bacteria 6308
335 Ga0495624_0044092 3300046690 Bacteria 2844
336 Ga0495670_0560168 3300046691 Unclassified 622
337 Ga0495589_0433612 3300046794 Unclassified 602
338 Ga0495674_0264545 3300047319 Unclassified 1412
339 Ga0495674_0371274 3300047319 Bacteria 1158
340 Ga0495674_1062072 3300047319 Unclassified 618
341 Ga0495674_1363199 3300047319 Bacteria 530
342 Ga0495676_0094289 3300047321 Unclassified 2230
343 Ga0495676_0234230 3300047321 Unclassified 1260
344 Ga0495676_0754319 3300047321 Unclassified 628
345 Ga0495680_0025389 3300047322 Bacteria 4905
346 Ga0495680_0064358 3300047322 Bacteria 2812
347 Ga0495680_0163703 3300047322 Bacteria 1614
348 Ga0495679_151642 3300047446 Bacteria 622
349 Ga0495681_0222301 3300047470 Bacteria 757
350 Ga0495684_0010240 3300047471 Bacteria 7251
351 Ga0495593_0557650 3300047673 Unclassified 575
352 Ga0495602_0291592 3300048088 Bacteria 1198
353 Ga0495614_0161493 3300048089 Unclassified 1003
354 Ga0495614_0193949 3300048089 Unclassified 917
355 Ga0496100_0116214 3300048903 Bacteria 1866
356 Ga0496100_0410214 3300048903 Bacteria 1033
357 Ga0496100_0590542 3300048903 Bacteria 862
358 Ga0496101_0046419 3300048904 Bacteria 3115
359 Ga0496101_0257152 3300048904 Bacteria 1361
360 Ga0496101_0733375 3300048904 Unclassified 780
361 Ga0496103_0350347 3300048906 Unclassified 949
362 Ga0496104_0007845 3300048907 Bacteria 9460
363 Ga0496104_0362271 3300048907 Bacteria 1362
364 Ga0496104_0853997 3300048907 Bacteria 816
365 Ga0496105_0006008 3300048908 Bacteria 9273
366 Ga0496105_0034045 3300048908 Bacteria 4188
367 Ga0496105_0051381 3300048908 Bacteria 3406
368 Ga0496105_0316667 3300048908 Bacteria 1251
369 Ga0496105_1207703 3300048908 Bacteria 556
370 Ga0496107_0086516 3300048910 Bacteria 2288
371 Ga0496107_0096734 3300048910 Bacteria 2161
372 Ga0496107_0213745 3300048910 Bacteria 1434
373 Ga0496108_0005918 3300048911 Bacteria 9911
374 Ga0496108_0049186 3300048911 Bacteria 3526
375 Ga0496108_0981309 3300048911 Unclassified 722
376 Ga0496109_0003641 3300048912 Bacteria 12876
377 Ga0496109_0013165 3300048912 Bacteria 7159
378 Ga0496109_1223133 3300048912 Bacteria 688
379 Ga0496110_1045930 3300048913 Unclassified 724
380 Ga0496111_0243941 3300048914 Unclassified 1334
381 Ga0496111_0493572 3300048914 Bacteria 901
382 Ga0496112_0011494 3300048915 Bacteria 8086
383 Ga0496112_0397428 3300048915 Bacteria 1318
384 Ga0496113_0051660 3300048916 Bacteria 3068
385 Ga0496114_0045517 3300048917 Bacteria 3646
386 Ga0496114_0053472 3300048917 Bacteria 3366
387 Ga0496115_0027818 3300048918 Bacteria 4426
388 Ga0496115_0294094 3300048918 Bacteria 1331
389 Ga0501067_0013662 3300049583 Bacteria 4496
390 Ga0501067_0135382 3300049583 Unclassified 1372
391 Ga0501067_0465602 3300049583 Bacteria 706
392 Ga0501069_0006919 3300049585 Bacteria 5929
393 Ga0501069_0042522 3300049585 Bacteria 2514
394 Ga0501069_0124738 3300049585 Bacteria 1472
395 Ga0501070_0446028 3300049586 Bacteria 1044
396 nmdc:mga0n895_180369_c1 3300050512 Bacteria 2143
397 nmdc:mga0n895_651991_c1 3300050512 Bacteria 1051
398 nmdc:mga0rr50_1171386_c1 3300050513 Bacteria 653
399 Ga0495601_0010919 3300053077 Bacteria 5420
400 Ga0495601_0701775 3300053077 Unclassified 645
401 Ga0495601_1066258 3300053077 Unclassified 506
402 Ga0495612_0128340 3300053078 Bacteria 1094
403 Ga0495612_0271592 3300053078 Bacteria 757
404 Ga0495595_0032675 3300053084 Bacteria 2344
405 Ga0495619_0007503 3300053085 Bacteria 6907
406 Ga0495619_0121610 3300053085 Bacteria 1790
407 Ga0495619_0289984 3300053085 Bacteria 1134
408 Ga0466962_0000790 3300061719 Bacteria 14257
409 Ga0466962_0004157 3300061719 Bacteria 6939
410 Ga0466962_0028832 3300061719 Bacteria 2658
411 Ga0466962_0063408 3300061719 Bacteria 1764
412 Ga0466962_0064768 3300061719 Bacteria 1745
413 Ga0466962_0193894 3300061719 Bacteria 991
414 Ga0466962_0229849 3300061719 Bacteria 909
415 Ga0466962_0300136 3300061719 Bacteria 794
416 Ga0070707_101525137
417 Ga0070658_10008960
418 Ga0070683_100125918
419 Ga0070683_100336483
420 Ga0070683_101083094
421 Ga0070680_100056139
422 Ga0070680_100251123
423 Ga0070680_100496276
424 Ga0070682_100024366
425 Ga0070682_100668143
426 Ga0068868_101158475
427 Ga0070660_100005286
428 Ga0070660_100443841
429 Ga0070691_10015645
430 Ga0070687_100344411
431 Ga0070661_100052729
432 Ga0070671_100192992
433 Ga0070659_100037615
434 Ga0070709_10014329
435 Ga0070709_10316037
436 Ga0070714_100003882
437 Ga0070714_100015515
438 Ga0070714_100037596
439 Ga0070714_100087931
440 Ga0070714_100096278
441 Ga0070714_100118556
442 Ga0070714_100642931
443 Ga0070713_100071586
444 Ga0070713_100513227
445 Ga0070710_10003777
446 Ga0070710_10271137
447 Ga0070711_100311710
448 Ga0070705_100236897
449 Ga0070694_100099780
450 Ga0070663_100746545
451 Ga0070678_101321414
452 Ga0070681_10025398
453 Ga0070681_10081959
454 Ga0070681_10144377
455 Ga0070699_100868133
456 Ga0070679_100061051
457 Ga0070679_100093878
458 Ga0070684_100181184
459 Ga0070697_100830707
460 Ga0070672_100577896
461 Ga0070686_100582565
462 Ga0070695_100000009
463 Ga0070695_100579410
464 Ga0070693_100821223
465 Ga0070693_101017491
466 Ga0068855_100024180
467 Ga0068856_100086712
468 Ga0068856_100477383
469 Ga0068856_101689111
470 Ga0070702_100018904
471 Ga0068852_100106467
472 Ga0068863_100053297
473 Ga0070717_10011983
474 Ga0070717_10033681
475 Ga0070716_100388343
476 Ga0070712_100509384
477 Ga0070712_100635531
478 Ga0097621_100657241
479 Ga0068871_101188671
480 Ga0075433_10405169
481 Ga0075434_100018013
482 Ga0075435_100179885
483 Ga0105240_10053517
484 Ga0105240_10125221
485 Ga0105245_12149257
486 Ga0105241_10679025
487 Ga0105248_10136247
488 Ga0105237_10043931
489 Ga0105238_10031975
490 Ga0105238_10352165
491 Ga0157370_10181854
492 Ga0157369_10030846
493 Ga0157369_10337795
494 Ga0157369_10493649
495 Ga0157374_10102216
496 Ga0157374_11708509
497 Ga0163162_10217169
498 Ga0157372_10041390
499 Ga0157372_10227126
500 Ga0157372_10230787
501 Ga0157372_10480596
502 Ga0182008_10161128
503 Ga0182008_10538009
504 Ga0157376_10318107
505 Ga0206356_11075183
506 Ga0206354_10093681
507 Ga0207692_10008654
508 Ga0207692_11013787
509 Ga0207647_10314834
510 Ga0207699_10147140
511 Ga0207699_10791013
512 Ga0207654_10541405
513 Ga0207707_10109612
514 Ga0207707_10280104
515 Ga0207707_10285591
516 Ga0207693_10008691
517 Ga0207693_10147382
518 Ga0207693_10794505
519 Ga0207663_10018096
520 Ga0207663_10224278
521 Ga0207663_10229339
522 Ga0207663_11000576
523 Ga0207660_10013739
524 Ga0207660_10166925
525 Ga0207660_10204765
526 Ga0207660_10565993
527 Ga0207662_10239646
528 Ga0207657_10002647
529 Ga0207657_10643775
530 Ga0207649_10032018
531 Ga0207652_10226694
532 Ga0207694_10485247
533 Ga0207687_10084386
534 Ga0207700_10037850
535 Ga0207700_10161197
536 Ga0207664_10008513
537 Ga0207664_10012180
538 Ga0207664_10103037
539 Ga0207664_11786989
540 Ga0207665_11246209
541 Ga0207711_10353959
542 Ga0207661_10133760
543 Ga0207679_11184285
544 Ga0207639_10202392
545 Ga0207702_10113566
546 Ga0207702_10424148
547 Ga0207683_11204195
548 Ga0373953_0083240
549 Ga0373957_0084356
550 Ga0373943_0735446
551 Ga0373962_0343924
552 Ga0373924_0052587
553 Ga0373931_0439255
554 Ga0373927_0999859
555 Ga0373933_0164232
556 Ga0373947_0327888
557 Ga0395899_0071457
558 Ga0395900_0095663
559 Ga0395898_1314421
560 Ga0395898_1409712
561 Ga0395905_0247109
562 Ga0395905_0340152
563 Ga0395905_1512004
564 Ga0395901_0023714
565 Ga0436360_0939065
566 Ga0451853_1839916
567 Ga0466969_0014597
568 Ga0466969_0030445
569 Ga0466969_0083360
570 Ga0466969_0098424
571 Ga0466965_0022314
572 Ga0466965_0078430
573 Ga0466965_0128597
574 Ga0466965_0255907
575 Ga0466966_0008887
576 Ga0466966_0010970
577 Ga0466961_0003736
578 Ga0466961_0010777
579 Ga0466961_0026591
580 Ga0466961_0028328
581 Ga0466961_0029065
582 Ga0466961_0109590
583 Ga0466961_0151244
584 Ga0466961_0300398
585 Ga0466963_0001936
586 Ga0466963_0004463
587 Ga0466963_0009708
588 Ga0466963_0013356
589 Ga0466963_0016571
590 Ga0466963_0024005
591 Ga0466963_0024846
592 Ga0466963_0033129
593 Ga0466963_0074178
594 Ga0466963_0084750
595 Ga0466963_0085605
596 Ga0466963_0126863
597 Ga0466963_0671034
598 Ga0466963_0787916
599 Ga0466963_0796849
600 Ga0466963_0858393
601 Ga0466963_0866812
602 Ga0466963_0994641
603 Ga0466964_0005740
604 Ga0466964_0026024
605 Ga0466964_0029989
606 Ga0466964_0036849
607 Ga0466964_0045336
608 Ga0466964_0048333
609 Ga0466964_0066148
610 Ga0466964_0347277
611 Ga0466964_0683313
612 Ga0466971_0001034
613 Ga0466971_0001706
614 Ga0466971_0002143
615 Ga0466971_0004293
616 Ga0466971_0043859
617 Ga0466971_0061547
618 Ga0466971_0108725
619 Ga0466971_0175720
620 Ga0466971_0260253
621 Ga0466971_0448961
622 Ga0466968_0002079
623 Ga0466968_0011149
624 Ga0466968_0023492
625 Ga0466968_0036810
626 Ga0466968_0039188
627 Ga0466968_0051176
628 Ga0466968_0069707
629 Ga0466968_0460721
630 Ga0466968_0489664
631 Ga0466970_0006709
632 Ga0466970_0009785
633 Ga0466970_0047594
634 Ga0466970_0073862
635 Ga0466970_0278620
636 Ga0466970_0284857
637 Ga0466957_0002287
638 Ga0466957_0016406
639 Ga0466957_0027986
640 Ga0466957_0033053
641 Ga0466957_0085561
642 Ga0466957_0107452
643 Ga0466957_0603147
644 Ga0466957_1072131
645 Ga0466957_1090585
646 Ga0466960_0091586
647 Ga0466960_0124504
648 Ga0466960_0290974
649 Ga0466959_0026640
650 Ga0466959_0062787
651 Ga0466959_0090993
652 Ga0466959_0129408
653 Ga0466959_0200025
654 Ga0466959_0368117
655 Ga0466958_0002464
656 Ga0466958_0002617
657 Ga0466958_0007132
658 Ga0466958_0009454
659 Ga0466958_0015935
660 Ga0466958_0037174
661 Ga0466958_0079054
662 Ga0466958_0180309
663 Ga0466958_0221890
664 Ga0466958_0230246
665 Ga0466958_0322225
666 Ga0466958_0347701
667 Ga0466958_0402390
668 Ga0466958_0518906
669 Ga0466958_0538865
670 Ga0466967_0000615
671 Ga0466967_0001349
672 Ga0466967_0006046
673 Ga0466967_0008052
674 Ga0466967_0010668
675 Ga0466967_0031102
676 Ga0466967_0034487
677 Ga0466967_0050111
678 Ga0466967_0083108
679 Ga0466967_0125810
680 Ga0466967_0134863
681 Ga0466967_0146938
682 Ga0466967_0155555
683 Ga0466967_0177794
684 Ga0466967_0228883
685 Ga0466967_0282672
686 Ga0466967_0458919
687 Ga0466967_0556959
688 Ga0466967_0760052
689 Ga0466967_0788773
690 Ga0466967_1052612
691 Ga0495592_0135636
692 Ga0495629_0017718
693 Ga0495629_0103661
694 Ga0495629_0143085
695 Ga0495629_0147946
696 Ga0495641_0014119
697 Ga0495641_0159625
698 Ga0495653_0034462
699 Ga0495653_0363938
700 Ga0495582_0041245
701 Ga0495582_0287824
702 Ga0495582_0305385
703 Ga0495582_0884970
704 Ga0495662_0122967
705 Ga0495664_0109959
706 Ga0495584_0120778
707 Ga0495596_0086246
708 Ga0495607_0041039
709 Ga0495608_0014717
710 Ga0495608_0035123
711 Ga0495608_0267385
712 Ga0495618_0130044
713 Ga0495618_0282150
714 Ga0495628_0840193
715 Ga0495630_0059019
716 Ga0495630_0409914
717 Ga0495630_0567839
718 Ga0495630_0891755
719 Ga0495644_0085286
720 Ga0495663_0084910
721 Ga0495642_0170784
722 Ga0495652_0093484
723 Ga0495652_0541640
724 Ga0495640_0030113
725 Ga0495640_0447368
726 Ga0495586_0016712
727 Ga0495586_0123875
728 Ga0495609_0273879
729 Ga0495645_0144323
730 Ga0495667_0061792
731 Ga0495656_0001684
732 Ga0495634_0009047
733 Ga0495634_0262187
734 Ga0495634_0685294
735 Ga0495611_0312929
736 Ga0495635_0013680
737 Ga0495659_0112234
738 Ga0495661_0167627
739 Ga0495657_0015450
740 Ga0495623_0094142
741 Ga0495646_0186970
742 Ga0495647_0019446
743 Ga0495647_0112745
744 Ga0495658_0107907
745 Ga0495658_0548079
746 Ga0495613_0010205
747 Ga0495613_0693070
748 Ga0495613_0826574
749 Ga0495624_0010750
750 Ga0495624_0044092
751 Ga0495670_0560168
752 Ga0495589_0433612
753 Ga0495674_0264545
754 Ga0495674_0371274
755 Ga0495674_1062072
756 Ga0495674_1363199
757 Ga0495676_0094289
758 Ga0495676_0234230
759 Ga0495676_0754319
760 Ga0495680_0025389
761 Ga0495680_0064358
762 Ga0495680_0163703
763 Ga0495679_151642
764 Ga0495681_0222301
765 Ga0495684_0010240
766 Ga0495593_0557650
767 Ga0495602_0291592
768 Ga0495614_0161493
769 Ga0495614_0193949
770 Ga0496100_0116214
771 Ga0496100_0410214
772 Ga0496100_0590542
773 Ga0496101_0046419
774 Ga0496101_0257152
775 Ga0496101_0733375
776 Ga0496103_0350347
777 Ga0496104_0007845
778 Ga0496104_0362271
779 Ga0496104_0853997
780 Ga0496105_0006008
781 Ga0496105_0034045
782 Ga0496105_0051381
783 Ga0496105_0316667
784 Ga0496105_1207703
785 Ga0496107_0086516
786 Ga0496107_0096734
787 Ga0496107_0213745
788 Ga0496108_0005918
789 Ga0496108_0049186
790 Ga0496108_0981309
791 Ga0496109_0003641
792 Ga0496109_0013165
793 Ga0496109_1223133
794 Ga0496110_1045930
795 Ga0496111_0243941
796 Ga0496111_0493572
797 Ga0496112_0011494
798 Ga0496112_0397428
799 Ga0496113_0051660
800 Ga0496114_0045517
801 Ga0496114_0053472
802 Ga0496115_0027818
803 Ga0496115_0294094
804 Ga0501067_0013662
805 Ga0501067_0135382
806 Ga0501067_0465602
807 Ga0501069_0006919
808 Ga0501069_0042522
809 Ga0501069_0124738
810 Ga0501070_0446028
811 nmdc:mga0n895_180369_c1
812 nmdc:mga0n895_651991_c1
813 nmdc:mga0rr50_1171386_c1
814 Ga0495601_0010919
815 Ga0495601_0701775
816 Ga0495601_1066258
817 Ga0495612_0128340
818 Ga0495612_0271592
819 Ga0495595_0032675
820 Ga0495619_0007503
821 Ga0495619_0121610
822 Ga0495619_0289984
823 Ga0466962_0000790
824 Ga0466962_0004157
825 Ga0466962_0028832
826 Ga0466962_0063408
827 Ga0466962_0064768
828 Ga0466962_0193894
829 Ga0466962_0229849
830 Ga0466962_0300136

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00989

PAS

PAS fold

22

100

0.8

PF08448

PAS_4

PAS fold

28

112

0.77

PF13188

PAS_8

PAS domain

22

90

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ck3-assembly1.cif.gz_A structure of hif2a-arnt heterodimer in complex with (s)-1-(3,5-difluoro-phenyl)-5,5-difluoro-3-methanesulfonyl-5,6-dihydro-4h-cyclopenta[c]thiophen-4-ol 0.8508 23 120
4wn5-assembly2.cif.gz_A crystal structure of the c-terminal per-arnt-sim (pasb) of human hif-3alpha9 bound to 18:1-1-monoacylglycerol 0.8463 26 121
4pky-assembly2.cif.gz_D arnt/hif transcription factor/coactivator complex 0.8428 26 119
4zp4-assembly1.cif.gz_B crystal structure of the heterodimeric hif-2a:arnt complex 0.8427 24 121
6czw-assembly1.cif.gz_A crystal structure of pt1940 bound to hif2a-b*:arnt-b* complex 0.8417 23 121
ID Description Score Start End Superfamily
af_D4AA36_223_377_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.8521 25 121 3.30.450.20
af_Q9JHS2_237_365_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.8494 26 120 3.30.450.20
af_O02219_282_409_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.8454 23 121 3.30.450.20
2pr5A00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.8399 26 120 3.30.450.20
4f3lA03 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.8395 26 120 3.30.450.20
ID Description Score Start End GO Terms
AF-A0A538GNC1-F1-model_v4 PAS domain-containing protein 0.8857 1 121
AF-A0A538IF57-F1-model_v4 PAS domain-containing protein 0.8816 1 121
AF-A0A538GNC1-F1-model_v4 PAS domain-containing protein 0.879 1 121
AF-A0A5A7RM29-F1-model_v4 PAS domain-containing protein 0.8787 11 120
AF-A0A538IF57-F1-model_v4 PAS domain-containing protein 0.8749 1 121

Map