F438499

General Info

Members Datasets Scaffolds Average Seq Length
415 216 830 222

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100446748|Ga0070713_1004467482
Length 274
Sequence VSASGLNGSMSEDRGQGSARAGSQALAGSGPESAARSGAGISVVVADDHEVVRAGFAALLDTQPDFTVLGTAANGADAVSVCRALRPDVVLMDVRMPGTDGIEATRQLIGDPAGAAADPDRAPPKVLILTTFDLDEYVFDALRAGASGFLLKDVTAERLFEAVRVVAAGEALLAPAVTRRLISEFARLRPAAGAAGAAARPGALAALTPRETEVLRLVAEGLSNTEIAGRLVVTEETVKTHVSRILAKLGLRDRTQAVVAAYESGLVVPGRERG

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
49 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
52 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
53 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
75 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
76 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
77 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
78 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
79 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
80 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
81 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
82 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
83 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
84 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
85 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
86 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
87 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
88 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
89 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
90 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
91 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
92 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
93 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
94 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
95 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
96 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
97 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
98 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
99 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
100 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
101 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
102 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
103 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
104 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
105 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
106 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
107 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
108 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
109 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
116 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
117 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
118 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
119 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
120 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
121 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
122 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
123 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
124 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
125 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
128 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
129 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
130 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
131 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
132 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
133 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
134 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
135 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
136 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
137 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
138 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
139 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
140 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
141 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
142 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
143 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
144 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
145 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
146 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
147 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
148 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
149 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
150 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
151 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
152 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
153 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
154 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
155 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
156 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
157 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
158 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
159 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
160 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
161 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
162 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
163 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
164 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
165 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
166 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
167 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
168 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
169 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
170 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
171 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
172 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
177 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
189 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
190 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
191 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
192 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
193 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
194 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
195 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
196 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
203 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
204 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
205 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
206 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
207 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
208 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
212 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
213 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
214 2643221604 Nocardioides sp. Root190 Isolate Unclassified
215 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
216 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.83
Metatranscriptomes 1.2
Isolates 0.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 0.96
Rhizosphere 94.22
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100446748 3300005436 Bacteria 1214
2 rootH1_10096502 3300003316 Bacteria 1548
3 Ga0070658_10139887 3300005327 Bacteria 2022
4 Ga0070683_100055316 3300005329 Bacteria 3682
5 Ga0070680_100129958 3300005336 Bacteria 2106
6 Ga0068868_100569175 3300005338 Bacteria 1000
7 Ga0070671_100120048 3300005355 Bacteria 2212
8 Ga0070659_100224013 3300005366 Bacteria 1553
9 Ga0070709_10060586 3300005434 Bacteria 2406
10 Ga0070714_100000552 3300005435 Bacteria 26986
11 Ga0070714_100035663 3300005435 Bacteria 4169
12 Ga0070714_100182099 3300005435 Bacteria 1912
13 Ga0070714_100185307 3300005435 Bacteria 1896
14 Ga0070714_100607499 3300005435 Bacteria 1051
15 Ga0070713_100088543 3300005436 Bacteria 2657
16 Ga0070713_100184055 3300005436 Bacteria 1879
17 Ga0070713_100206762 3300005436 Bacteria 1775
18 Ga0070713_100284330 3300005436 Bacteria 1518
19 Ga0070710_10022305 3300005437 Bacteria 3309
20 Ga0070710_10070992 3300005437 Bacteria 2007
21 Ga0070710_10268880 3300005437 Bacteria 1102
22 Ga0070711_100069911 3300005439 Bacteria 2470
23 Ga0070708_100001603 3300005445 Bacteria 17338
24 Ga0070663_100071040 3300005455 Bacteria 2532
25 Ga0070662_100079409 3300005457 Bacteria 2440
26 Ga0070681_10031277 3300005458 Bacteria 5342
27 Ga0070706_100066207 3300005467 Bacteria 3342
28 Ga0070706_100172508 3300005467 Bacteria 2019
29 Ga0070706_100398047 3300005467 Bacteria 1282
30 Ga0070707_100002062 3300005468 Bacteria 19264
31 Ga0070707_100009909 3300005468 Bacteria 8870
32 Ga0070707_100027490 3300005468 Bacteria 5412
33 Ga0070707_100209935 3300005468 Bacteria 1898
34 Ga0070707_100713614 3300005468 Bacteria 966
35 Ga0070698_100009278 3300005471 Bacteria 10556
36 Ga0070698_100014895 3300005471 Bacteria 8221
37 Ga0070698_100115239 3300005471 Bacteria 2652
38 Ga0070698_100198777 3300005471 Bacteria 1941
39 Ga0070698_100438182 3300005471 Bacteria 1242
40 Ga0070698_100525450 3300005471 Bacteria 1122
41 Ga0070699_100002453 3300005518 Bacteria 16669
42 Ga0070699_100407972 3300005518 Bacteria 1229
43 Ga0070679_100288877 3300005530 Bacteria 1591
44 Ga0070684_100447658 3300005535 Bacteria 1193
45 Ga0070697_100003236 3300005536 Bacteria 12501
46 Ga0070665_100129489 3300005548 Bacteria 2525
47 Ga0070664_100029157 3300005564 Bacteria 4599
48 Ga0070664_100511137 3300005564 Bacteria 1108
49 Ga0068857_100231278 3300005577 Bacteria 1691
50 Ga0068856_100148434 3300005614 Bacteria 2352
51 Ga0068856_100429943 3300005614 Bacteria 1340
52 Ga0081455_10125498 3300005937 Bacteria 2015
53 Ga0081540_1008143 3300005983 Bacteria 7354
54 Ga0081539_10015468 3300005985 Bacteria 5542
55 Ga0081539_10036743 3300005985 Bacteria 2926
56 Ga0070717_10049573 3300006028 Bacteria 3447
57 Ga0070717_10053516 3300006028 Bacteria 3327
58 Ga0070717_10139318 3300006028 Bacteria 2091
59 Ga0070717_10182890 3300006028 Bacteria 1828
60 Ga0070717_10535003 3300006028 Bacteria 1061
61 Ga0070716_100003535 3300006173 Bacteria 7372
62 Ga0070716_100010242 3300006173 Bacteria 4697
63 Ga0070716_100055498 3300006173 Bacteria 2267
64 Ga0070716_100120517 3300006173 Bacteria 1641
65 Ga0070712_100025103 3300006175 Bacteria 3957
66 Ga0075434_100921390 3300006871 Bacteria 889
67 Ga0105247_10254186 3300009101 Bacteria 1202
68 Ga0114129_10129528 3300009147 Bacteria 3467
69 Ga0105241_10543783 3300009174 Bacteria 1042
70 Ga0105237_10022866 3300009545 Bacteria 6412
71 Ga0105237_10706910 3300009545 Bacteria 1014
72 Ga0105238_10673471 3300009551 Bacteria 1046
73 Ga0105239_10082969 3300010375 Bacteria 3529
74 Ga0157338_1003886 3300012515 Bacteria 1265
75 Ga0157370_10308459 3300013104 Bacteria 1460
76 Ga0157369_10392923 3300013105 Bacteria 1439
77 Ga0157372_10141949 3300013307 Bacteria 2768
78 Ga0157375_10805492 3300013308 Bacteria 1088
79 Ga0157379_10114525 3300014968 Bacteria 2424
80 Ga0206356_11729817 3300020070 Bacteria 934
81 Ga0206355_1399566 3300020076 Bacteria 875
82 Ga0206352_10115302 3300020078 Bacteria 916
83 Ga0206354_11540000 3300020081 Bacteria 1071
84 Ga0213874_10029285 3300021377 Bacteria 1579
85 Ga0213875_10000247 3300021388 Bacteria 54340
86 Ga0213875_10081850 3300021388 Bacteria 1506
87 Ga0224712_10099097 3300022467 Bacteria 1233
88 Ga0207699_10006153 3300025906 Bacteria 5788
89 Ga0207699_10024113 3300025906 Bacteria 3322
90 Ga0207684_10019569 3300025910 Bacteria 5790
91 Ga0207707_10667117 3300025912 Bacteria 875
92 Ga0207671_10335606 3300025914 Bacteria 1197
93 Ga0207693_10014050 3300025915 Bacteria 6446
94 Ga0207693_10020322 3300025915 Bacteria 5283
95 Ga0207663_10050218 3300025916 Bacteria 2591
96 Ga0207663_10234614 3300025916 Bacteria 1342
97 Ga0207663_10310583 3300025916 Bacteria 1181
98 Ga0207649_10052217 3300025920 Bacteria 2535
99 Ga0207649_10534289 3300025920 Bacteria 895
100 Ga0207652_10279028 3300025921 Bacteria 1507
101 Ga0207646_10001404 3300025922 Bacteria 29879
102 Ga0207646_10003126 3300025922 Bacteria 18991
103 Ga0207646_10007848 3300025922 Bacteria 10785
104 Ga0207646_10018758 3300025922 Bacteria 6446
105 Ga0207646_10157870 3300025922 Bacteria 2046
106 Ga0207687_10023643 3300025927 Bacteria 4100
107 Ga0207700_10007664 3300025928 Bacteria 6625
108 Ga0207700_10012873 3300025928 Bacteria 5414
109 Ga0207700_10029173 3300025928 Bacteria 3890
110 Ga0207700_10057992 3300025928 Bacteria 2923
111 Ga0207700_10111122 3300025928 Bacteria 2205
112 Ga0207700_10354717 3300025928 Bacteria 1278
113 Ga0207700_10599520 3300025928 Bacteria 980
114 Ga0207664_10001959 3300025929 Bacteria 13566
115 Ga0207664_10013277 3300025929 Bacteria 5907
116 Ga0207664_10162163 3300025929 Bacteria 1907
117 Ga0207664_10237285 3300025929 Bacteria 1587
118 Ga0207664_10368534 3300025929 Bacteria 1274
119 Ga0207706_10024052 3300025933 Bacteria 5465
120 Ga0207665_10003433 3300025939 Bacteria 10600
121 Ga0207665_10027721 3300025939 Bacteria 3743
122 Ga0207679_10017794 3300025945 Bacteria 4748
123 Ga0207677_10194180 3300026023 Bacteria 1608
124 Ga0207678_10010026 3300026067 Bacteria 8313
125 Ga0207678_10041052 3300026067 Bacteria 4011
126 Ga0207678_10291583 3300026067 Bacteria 1401
127 Ga0207674_10176482 3300026116 Bacteria 2089
128 Ga0268266_10458361 3300028379 Bacteria 1213
129 Ga0268265_10163741 3300028380 Bacteria 1893
130 Ga0265337_1001275 3300028556 Bacteria 12666
131 Ga0265326_10007862 3300028558 Bacteria 3247
132 Ga0265319_1004305 3300028563 Bacteria 7082
133 Ga0265334_10001156 3300028573 Bacteria 12910
134 Ga0265322_10050353 3300028654 Bacteria 1182
135 Ga0265336_10009525 3300028666 Bacteria 3354
136 Ga0265338_10001831 3300028800 Bacteria 33341
137 Ga0265338_10190139 3300028800 Bacteria 1557
138 Ga0265324_10018803 3300029957 Bacteria 2492
139 Ga0265332_10001697 3300031238 Bacteria 12014
140 Ga0265320_10104277 3300031240 Bacteria 1303
141 Ga0265325_10021641 3300031241 Bacteria 3530
142 Ga0265340_10020304 3300031247 Bacteria 3415
143 Ga0265316_10019339 3300031344 Bacteria 5828
144 Ga0307513_10003197 3300031456 Bacteria 22363
145 Ga0265313_10034417 3300031595 Bacteria 2562
146 Ga0265314_10280387 3300031711 Bacteria 943
147 Ga0265342_10118362 3300031712 Bacteria 1493
148 Ga0307507_10372498 3300033179 Bacteria 827
149 Ga0373926_0002875 3300035083 Bacteria 5515
150 Ga0373926_0014326 3300035083 Bacteria 2695
151 Ga0373934_0021083 3300035086 Bacteria 2509
152 Ga0373934_0053409 3300035086 Bacteria 1603
153 Ga0373944_0003163 3300035089 Bacteria 4235
154 Ga0373944_0012737 3300035089 Bacteria 2322
155 Ga0373923_0000354 3300035111 Bacteria 10402
156 Ga0373923_0051363 3300035111 Bacteria 1729
157 Ga0373923_0087641 3300035111 Bacteria 1358
158 Ga0373923_0168423 3300035111 Bacteria 1002
159 Ga0373936_0001071 3300035113 Bacteria 9796
160 Ga0373936_0003905 3300035113 Bacteria 5613
161 Ga0373945_0006289 3300035116 Bacteria 3823
162 Ga0373953_0022034 3300035117 Bacteria 2397
163 Ga0373953_0127514 3300035117 Bacteria 1083
164 Ga0373954_0042463 3300035118 Bacteria 2120
165 Ga0373954_0087034 3300035118 Bacteria 1497
166 Ga0373956_0040481 3300035119 Bacteria 2067
167 Ga0373956_0060614 3300035119 Bacteria 1713
168 Ga0373956_0067310 3300035119 Bacteria 1630
169 Ga0373956_0094258 3300035119 Bacteria 1383
170 Ga0373957_0000592 3300035120 Bacteria 9179
171 Ga0373957_0038796 3300035120 Bacteria 1784
172 Ga0373957_0045191 3300035120 Bacteria 1668
173 Ga0373943_0003085 3300035170 Bacteria 7565
174 Ga0373943_0004628 3300035170 Bacteria 6219
175 Ga0373946_0000053 3300035171 Bacteria 30553
176 Ga0373946_0000680 3300035171 Bacteria 11412
177 Ga0373955_0000985 3300035172 Bacteria 12067
178 Ga0373955_0019128 3300035172 Bacteria 3418
179 Ga0373955_0033291 3300035172 Bacteria 2713
180 Ga0373955_0147193 3300035172 Bacteria 1384
181 Ga0373924_0002056 3300035410 Bacteria 6713
182 Ga0373924_0028764 3300035410 Bacteria 2216
183 Ga0373935_0001287 3300035692 Bacteria 13829
184 Ga0373935_0006250 3300035692 Bacteria 7089
185 Ga0373935_0008547 3300035692 Bacteria 6129
186 Ga0373927_0017965 3300035695 Bacteria 4652
187 Ga0373927_0024949 3300035695 Bacteria 3908
188 Ga0373927_0156505 3300035695 Bacteria 1493
189 Ga0373933_0018125 3300035724 Bacteria 3955
190 Ga0373933_0036025 3300035724 Bacteria 2893
191 Ga0373933_0044000 3300035724 Bacteria 2643
192 Ga0373933_0141446 3300035724 Bacteria 1519
193 Ga0373933_0206034 3300035724 Bacteria 1259
194 Ga0373947_0000001 3300035725 Bacteria 510932
195 Ga0373947_0004110 3300035725 Bacteria 8557
196 Ga0373947_0004259 3300035725 Bacteria 8396
197 Ga0373937_0134351 3300036401 Bacteria 2312
198 Ga0373925_0000360 3300037068 Bacteria 47318
199 Ga0373925_0009957 3300037068 Bacteria 6903
200 Ga0373925_0011700 3300037068 Bacteria 6345
201 Ga0395898_0104058 3300037466 Bacteria 2723
202 Ga0436364_0160043 3300037853 Bacteria 4594
203 Ga0436364_0415384 3300037853 Bacteria 1901
204 Ga0436364_0564008 3300037853 Bacteria 3737
205 Ga0436364_1207205 3300037853 Bacteria 119769
206 Ga0436365_0160385 3300039437 Bacteria 931
207 Ga0436365_0466493 3300039437 Bacteria 846
208 Ga0436365_1154768 3300039437 Bacteria 867
209 Ga0436363_0091067 3300039450 Bacteria 1566
210 Ga0436363_1275403 3300039450 Bacteria 1048
211 Ga0451807_2146810 3300041486 Bacteria 1097
212 Ga0451837_1160343 3300041494 Bacteria 1993
213 Ga0451839_0157956 3300041496 Bacteria 1037
214 Ga0466969_0011935 3300044656 Bacteria 4594
215 Ga0466972_0133531 3300044658 Bacteria 1169
216 Ga0466966_0018396 3300044684 Bacteria 4609
217 Ga0466961_0016130 3300044693 Bacteria 4797
218 Ga0466961_0209063 3300044693 Bacteria 1205
219 Ga0466964_0050050 3300044706 Bacteria 1712
220 Ga0466971_0057403 3300044719 Bacteria 1756
221 Ga0466971_0087246 3300044719 Bacteria 1426
222 Ga0466959_0048479 3300045049 Bacteria 3121
223 Ga0466967_0164649 3300045976 Bacteria 2083
224 Ga0495592_0000605 3300046454 Bacteria 25317
225 Ga0495592_0001782 3300046454 Bacteria 15155
226 Ga0495592_0194695 3300046454 Bacteria 1372
227 Ga0495603_0007843 3300046455 Bacteria 6435
228 Ga0495629_0013348 3300046459 Bacteria 5926
229 Ga0495641_0009364 3300046461 Bacteria 5823
230 Ga0495641_0015480 3300046461 Bacteria 4069
231 Ga0495651_0002697 3300046462 Bacteria 13778
232 Ga0495651_0008624 3300046462 Bacteria 7817
233 Ga0495651_0126225 3300046462 Bacteria 1873
234 Ga0495651_0159517 3300046462 Bacteria 1617
235 Ga0495651_0177023 3300046462 Bacteria 1513
236 Ga0495651_0194062 3300046462 Bacteria 1426
237 Ga0495653_0006613 3300046463 Bacteria 9518
238 Ga0495653_0036439 3300046463 Bacteria 3874
239 Ga0495653_0037817 3300046463 Bacteria 3789
240 Ga0495653_0056033 3300046463 Bacteria 3006
241 Ga0495653_0059088 3300046463 Bacteria 2912
242 Ga0495653_0199145 3300046463 Bacteria 1360
243 Ga0495580_0012749 3300046472 Bacteria 6442
244 Ga0495582_0001711 3300046473 Bacteria 12373
245 Ga0495582_0029837 3300046473 Bacteria 2994
246 Ga0495639_0000696 3300046475 Bacteria 15406
247 Ga0495662_0000867 3300046476 Bacteria 14766
248 Ga0495662_0002868 3300046476 Bacteria 8721
249 Ga0495662_0015238 3300046476 Bacteria 3735
250 Ga0495664_0001546 3300046477 Bacteria 12189
251 Ga0495664_0003023 3300046477 Bacteria 9104
252 Ga0495594_0006249 3300046499 Bacteria 6125
253 Ga0495608_0010648 3300046511 Bacteria 6415
254 Ga0495608_0012669 3300046511 Bacteria 5850
255 Ga0495608_0383363 3300046511 Bacteria 861
256 Ga0495618_0003663 3300046514 Bacteria 9525
257 Ga0495618_0214658 3300046514 Bacteria 1215
258 Ga0495628_0007581 3300046516 Bacteria 9382
259 Ga0495628_0259934 3300046516 Bacteria 1294
260 Ga0495630_0002512 3300046517 Bacteria 12718
261 Ga0495630_0039432 3300046517 Bacteria 3531
262 Ga0495630_0160703 3300046517 Bacteria 1710
263 Ga0495630_0167623 3300046517 Bacteria 1672
264 Ga0495630_0463338 3300046517 Bacteria 971
265 Ga0495648_0063706 3300046524 Bacteria 2175
266 Ga0495666_0000305 3300046526 Bacteria 21370
267 Ga0495666_0001689 3300046526 Bacteria 10905
268 Ga0495652_0003628 3300046529 Bacteria 15113
269 Ga0495652_0017810 3300046529 Bacteria 6339
270 Ga0495652_0045316 3300046529 Bacteria 3783
271 Ga0495652_0079297 3300046529 Bacteria 2715
272 Ga0495652_0160940 3300046529 Bacteria 1743
273 Ga0495665_0006116 3300046531 Bacteria 6497
274 Ga0495640_0007800 3300046533 Bacteria 8422
275 Ga0495640_0021226 3300046533 Bacteria 4769
276 Ga0495640_0102128 3300046533 Bacteria 1882
277 Ga0495640_0147236 3300046533 Bacteria 1514
278 Ga0495586_0004038 3300046535 Bacteria 7867
279 Ga0495587_0002358 3300046536 Bacteria 12621
280 Ga0495587_0010798 3300046536 Bacteria 5798
281 Ga0495587_0031458 3300046536 Bacteria 3213
282 Ga0495587_0143747 3300046536 Bacteria 1360
283 Ga0495645_0015275 3300046543 Bacteria 5460
284 Ga0495645_0024949 3300046543 Bacteria 4339
285 Ga0495645_0048569 3300046543 Bacteria 3090
286 Ga0495667_0010722 3300046559 Bacteria 6197
287 Ga0495667_0016178 3300046559 Bacteria 5039
288 Ga0495667_0027104 3300046559 Bacteria 3862
289 Ga0495667_0038759 3300046559 Bacteria 3172
290 Ga0495667_0045761 3300046559 Bacteria 2895
291 Ga0495667_0089318 3300046559 Bacteria 1997
292 Ga0495667_0193865 3300046559 Bacteria 1301
293 Ga0495667_0297652 3300046559 Bacteria 1022
294 Ga0495634_0005453 3300046642 Bacteria 9785
295 Ga0495634_0032534 3300046642 Bacteria 3587
296 Ga0495634_0041871 3300046642 Bacteria 3109
297 Ga0495635_0004863 3300046663 Bacteria 9348
298 Ga0495635_0013320 3300046663 Bacteria 5755
299 Ga0495635_0025075 3300046663 Bacteria 4154
300 Ga0495635_0028361 3300046663 Bacteria 3890
301 Ga0495657_0005139 3300046675 Bacteria 10369
302 Ga0495657_0007245 3300046675 Bacteria 8594
303 Ga0495657_0020052 3300046675 Bacteria 4812
304 Ga0495657_0052453 3300046675 Bacteria 2734
305 Ga0495657_0081960 3300046675 Bacteria 2085
306 Ga0495657_0317016 3300046675 Bacteria 927
307 Ga0495599_0017371 3300046678 Bacteria 4473
308 Ga0495599_0023773 3300046678 Bacteria 3832
309 Ga0495599_0024958 3300046678 Bacteria 3739
310 Ga0495623_0003110 3300046679 Bacteria 10935
311 Ga0495623_0004540 3300046679 Bacteria 9115
312 Ga0495623_0043282 3300046679 Bacteria 2866
313 Ga0495646_0008659 3300046680 Bacteria 6466
314 Ga0495647_0021720 3300046681 Bacteria 2313
315 Ga0495658_0004233 3300046683 Bacteria 7061
316 Ga0495613_0001578 3300046689 Bacteria 17287
317 Ga0495613_0004773 3300046689 Bacteria 10173
318 Ga0495613_0012138 3300046689 Bacteria 6402
319 Ga0495624_0002010 3300046690 Bacteria 15506
320 Ga0495624_0077363 3300046690 Bacteria 2063
321 Ga0495600_0076169 3300046809 Bacteria 2190
322 Ga0495600_0111013 3300046809 Bacteria 1785
323 Ga0495600_0118009 3300046809 Bacteria 1726
324 Ga0495600_0145967 3300046809 Bacteria 1533
325 Ga0495581_0000510 3300047315 Bacteria 19910
326 Ga0495604_0001862 3300047317 Bacteria 17180
327 Ga0495604_0002067 3300047317 Bacteria 16202
328 Ga0495604_0068141 3300047317 Bacteria 2702
329 Ga0495604_0134121 3300047317 Bacteria 1776
330 Ga0495674_0011031 3300047319 Bacteria 8532
331 Ga0495674_0011897 3300047319 Bacteria 8202
332 Ga0495674_0020895 3300047319 Bacteria 6060
333 Ga0495674_0021093 3300047319 Bacteria 6028
334 Ga0495674_0079572 3300047319 Bacteria 2814
335 Ga0495674_0718173 3300047319 Bacteria 783
336 Ga0495676_0002725 3300047321 Bacteria 15849
337 Ga0495676_0038938 3300047321 Bacteria 3944
338 Ga0495680_0008645 3300047322 Bacteria 9240
339 Ga0495680_0017357 3300047322 Bacteria 6149
340 Ga0495680_0049829 3300047322 Bacteria 3278
341 Ga0495680_0060153 3300047322 Bacteria 2930
342 Ga0495680_0117465 3300047322 Bacteria 1966
343 Ga0495680_0230291 3300047322 Bacteria 1319
344 Ga0495675_0002841 3300047444 Bacteria 10377
345 Ga0495675_0007153 3300047444 Bacteria 6870
346 Ga0495675_0392523 3300047444 Bacteria 810
347 Ga0495684_0001345 3300047471 Bacteria 19793
348 Ga0495684_0005772 3300047471 Bacteria 9628
349 Ga0495684_0007519 3300047471 Bacteria 8434
350 Ga0495684_0015541 3300047471 Bacteria 5860
351 Ga0495684_0023522 3300047471 Bacteria 4737
352 Ga0495593_0002746 3300047673 Bacteria 10598
353 Ga0495593_0120830 3300047673 Bacteria 1333
354 Ga0495602_0006212 3300048088 Bacteria 12537
355 Ga0495602_0086342 3300048088 Bacteria 2619
356 Ga0495602_0155316 3300048088 Bacteria 1792
357 Ga0495602_0213707 3300048088 Bacteria 1461
358 Ga0495614_0048974 3300048089 Bacteria 1811
359 Ga0496109_0213930 3300048912 Bacteria 1813
360 Ga0496110_0945487 3300048913 Bacteria 768
361 Ga0496112_0380747 3300048915 Bacteria 1352
362 Ga0496126_0099524 3300048929 Bacteria 2546
363 Ga0501031_0074656 3300049568 Bacteria 2208
364 Ga0501031_0294726 3300049568 Bacteria 1052
365 Ga0501032_0080510 3300049569 Bacteria 2167
366 Ga0501036_0086506 3300049572 Bacteria 2649
367 Ga0501036_0233749 3300049572 Bacteria 1542
368 Ga0501037_0430970 3300049573 Bacteria 902
369 Ga0501038_0113833 3300049574 Bacteria 2238
370 Ga0501039_0022537 3300049575 Bacteria 4834
371 Ga0501039_0112530 3300049575 Bacteria 2128
372 Ga0501040_0053626 3300049576 Bacteria 2762
373 Ga0501041_0058203 3300049577 Bacteria 2363
374 Ga0501041_0225227 3300049577 Bacteria 1177
375 Ga0501043_0020283 3300049579 Bacteria 5217
376 Ga0501046_0091710 3300049580 Bacteria 2336
377 Ga0501048_0116957 3300049582 Bacteria 1883
378 Ga0501048_0294553 3300049582 Bacteria 1154
379 Ga0501068_0133507 3300049584 Bacteria 1553
380 Ga0501070_0248892 3300049586 Bacteria 1454
381 Ga0501071_0003075 3300049587 Bacteria 10340
382 Ga0501071_0356682 3300049587 Bacteria 1113
383 Ga0501072_0033729 3300049588 Bacteria 4011
384 Ga0501074_0012408 3300049590 Bacteria 6194
385 Ga0501075_0052489 3300049591 Bacteria 3065
386 Ga0501076_0033374 3300049592 Bacteria 4018
387 Ga0501076_0171854 3300049592 Bacteria 1766
388 Ga0501077_0009274 3300049593 Bacteria 6110
389 Ga0501079_0014494 3300049741 Bacteria 6011
390 Ga0501080_0123984 3300049742 Bacteria 2393
391 Ga0501081_0014476 3300049743 Bacteria 5202
392 Ga0501035_0184822 3300049822 Bacteria 1794
393 Ga0501045_0094570 3300049824 Bacteria 2210
394 nmdc:mga05p37_260558_c1 3300050507 Bacteria 2075
395 nmdc:mga0n895_231225_c1 3300050512 Bacteria 1876
396 nmdc:mga0rr50_517381_c1 3300050513 Bacteria 1015
397 Ga0495601_0017526 3300053077 Bacteria 4348
398 Ga0495601_0121463 3300053077 Bacteria 1697
399 Ga0495612_0001211 3300053078 Bacteria 10633
400 Ga0495595_0113961 3300053084 Bacteria 1313
401 Ga0495595_0142629 3300053084 Bacteria 1176
402 Ga0495595_0174517 3300053084 Bacteria 1065
403 Ga0495619_0002829 3300053085 Bacteria 11303
404 Ga0495619_0142806 3300053085 Bacteria 1649
405 Ga0495619_0375768 3300053085 Bacteria 982
406 Ga0500573_0211130 3300053140 Bacteria 1024
407 Ga0501084_0104113 3300054114 Bacteria 2383
408 Ga0501082_0018387 3300060353 Bacteria 6019
409 Ga0501082_0335961 3300060353 Bacteria 1316
410 Ga0466962_0016330 3300061719 Bacteria 3579
411 Ga0530510_0073288 3300061734 Bacteria 2485
412 2585296124 2582581312 Bacteria 7308206
413 2644032111 2643221604 Bacteria 5014917
414 2954700982 2954691527 Bacteria 10720516
415 2954706355 2954701450 Bacteria 10834262
416 Ga0070713_100446748
417 rootH1_10096502
418 Ga0070658_10139887
419 Ga0070683_100055316
420 Ga0070680_100129958
421 Ga0068868_100569175
422 Ga0070671_100120048
423 Ga0070659_100224013
424 Ga0070709_10060586
425 Ga0070714_100000552
426 Ga0070714_100035663
427 Ga0070714_100182099
428 Ga0070714_100185307
429 Ga0070714_100607499
430 Ga0070713_100088543
431 Ga0070713_100184055
432 Ga0070713_100206762
433 Ga0070713_100284330
434 Ga0070710_10022305
435 Ga0070710_10070992
436 Ga0070710_10268880
437 Ga0070711_100069911
438 Ga0070708_100001603
439 Ga0070663_100071040
440 Ga0070662_100079409
441 Ga0070681_10031277
442 Ga0070706_100066207
443 Ga0070706_100172508
444 Ga0070706_100398047
445 Ga0070707_100002062
446 Ga0070707_100009909
447 Ga0070707_100027490
448 Ga0070707_100209935
449 Ga0070707_100713614
450 Ga0070698_100009278
451 Ga0070698_100014895
452 Ga0070698_100115239
453 Ga0070698_100198777
454 Ga0070698_100438182
455 Ga0070698_100525450
456 Ga0070699_100002453
457 Ga0070699_100407972
458 Ga0070679_100288877
459 Ga0070684_100447658
460 Ga0070697_100003236
461 Ga0070665_100129489
462 Ga0070664_100029157
463 Ga0070664_100511137
464 Ga0068857_100231278
465 Ga0068856_100148434
466 Ga0068856_100429943
467 Ga0081455_10125498
468 Ga0081540_1008143
469 Ga0081539_10015468
470 Ga0081539_10036743
471 Ga0070717_10049573
472 Ga0070717_10053516
473 Ga0070717_10139318
474 Ga0070717_10182890
475 Ga0070717_10535003
476 Ga0070716_100003535
477 Ga0070716_100010242
478 Ga0070716_100055498
479 Ga0070716_100120517
480 Ga0070712_100025103
481 Ga0075434_100921390
482 Ga0105247_10254186
483 Ga0114129_10129528
484 Ga0105241_10543783
485 Ga0105237_10022866
486 Ga0105237_10706910
487 Ga0105238_10673471
488 Ga0105239_10082969
489 Ga0157338_1003886
490 Ga0157370_10308459
491 Ga0157369_10392923
492 Ga0157372_10141949
493 Ga0157375_10805492
494 Ga0157379_10114525
495 Ga0206356_11729817
496 Ga0206355_1399566
497 Ga0206352_10115302
498 Ga0206354_11540000
499 Ga0213874_10029285
500 Ga0213875_10000247
501 Ga0213875_10081850
502 Ga0224712_10099097
503 Ga0207699_10006153
504 Ga0207699_10024113
505 Ga0207684_10019569
506 Ga0207707_10667117
507 Ga0207671_10335606
508 Ga0207693_10014050
509 Ga0207693_10020322
510 Ga0207663_10050218
511 Ga0207663_10234614
512 Ga0207663_10310583
513 Ga0207649_10052217
514 Ga0207649_10534289
515 Ga0207652_10279028
516 Ga0207646_10001404
517 Ga0207646_10003126
518 Ga0207646_10007848
519 Ga0207646_10018758
520 Ga0207646_10157870
521 Ga0207687_10023643
522 Ga0207700_10007664
523 Ga0207700_10012873
524 Ga0207700_10029173
525 Ga0207700_10057992
526 Ga0207700_10111122
527 Ga0207700_10354717
528 Ga0207700_10599520
529 Ga0207664_10001959
530 Ga0207664_10013277
531 Ga0207664_10162163
532 Ga0207664_10237285
533 Ga0207664_10368534
534 Ga0207706_10024052
535 Ga0207665_10003433
536 Ga0207665_10027721
537 Ga0207679_10017794
538 Ga0207677_10194180
539 Ga0207678_10010026
540 Ga0207678_10041052
541 Ga0207678_10291583
542 Ga0207674_10176482
543 Ga0268266_10458361
544 Ga0268265_10163741
545 Ga0265337_1001275
546 Ga0265326_10007862
547 Ga0265319_1004305
548 Ga0265334_10001156
549 Ga0265322_10050353
550 Ga0265336_10009525
551 Ga0265338_10001831
552 Ga0265338_10190139
553 Ga0265324_10018803
554 Ga0265332_10001697
555 Ga0265320_10104277
556 Ga0265325_10021641
557 Ga0265340_10020304
558 Ga0265316_10019339
559 Ga0307513_10003197
560 Ga0265313_10034417
561 Ga0265314_10280387
562 Ga0265342_10118362
563 Ga0307507_10372498
564 Ga0373926_0002875
565 Ga0373926_0014326
566 Ga0373934_0021083
567 Ga0373934_0053409
568 Ga0373944_0003163
569 Ga0373944_0012737
570 Ga0373923_0000354
571 Ga0373923_0051363
572 Ga0373923_0087641
573 Ga0373923_0168423
574 Ga0373936_0001071
575 Ga0373936_0003905
576 Ga0373945_0006289
577 Ga0373953_0022034
578 Ga0373953_0127514
579 Ga0373954_0042463
580 Ga0373954_0087034
581 Ga0373956_0040481
582 Ga0373956_0060614
583 Ga0373956_0067310
584 Ga0373956_0094258
585 Ga0373957_0000592
586 Ga0373957_0038796
587 Ga0373957_0045191
588 Ga0373943_0003085
589 Ga0373943_0004628
590 Ga0373946_0000053
591 Ga0373946_0000680
592 Ga0373955_0000985
593 Ga0373955_0019128
594 Ga0373955_0033291
595 Ga0373955_0147193
596 Ga0373924_0002056
597 Ga0373924_0028764
598 Ga0373935_0001287
599 Ga0373935_0006250
600 Ga0373935_0008547
601 Ga0373927_0017965
602 Ga0373927_0024949
603 Ga0373927_0156505
604 Ga0373933_0018125
605 Ga0373933_0036025
606 Ga0373933_0044000
607 Ga0373933_0141446
608 Ga0373933_0206034
609 Ga0373947_0000001
610 Ga0373947_0004110
611 Ga0373947_0004259
612 Ga0373937_0134351
613 Ga0373925_0000360
614 Ga0373925_0009957
615 Ga0373925_0011700
616 Ga0395898_0104058
617 Ga0436364_0160043
618 Ga0436364_0415384
619 Ga0436364_0564008
620 Ga0436364_1207205
621 Ga0436365_0160385
622 Ga0436365_0466493
623 Ga0436365_1154768
624 Ga0436363_0091067
625 Ga0436363_1275403
626 Ga0451807_2146810
627 Ga0451837_1160343
628 Ga0451839_0157956
629 Ga0466969_0011935
630 Ga0466972_0133531
631 Ga0466966_0018396
632 Ga0466961_0016130
633 Ga0466961_0209063
634 Ga0466964_0050050
635 Ga0466971_0057403
636 Ga0466971_0087246
637 Ga0466959_0048479
638 Ga0466967_0164649
639 Ga0495592_0000605
640 Ga0495592_0001782
641 Ga0495592_0194695
642 Ga0495603_0007843
643 Ga0495629_0013348
644 Ga0495641_0009364
645 Ga0495641_0015480
646 Ga0495651_0002697
647 Ga0495651_0008624
648 Ga0495651_0126225
649 Ga0495651_0159517
650 Ga0495651_0177023
651 Ga0495651_0194062
652 Ga0495653_0006613
653 Ga0495653_0036439
654 Ga0495653_0037817
655 Ga0495653_0056033
656 Ga0495653_0059088
657 Ga0495653_0199145
658 Ga0495580_0012749
659 Ga0495582_0001711
660 Ga0495582_0029837
661 Ga0495639_0000696
662 Ga0495662_0000867
663 Ga0495662_0002868
664 Ga0495662_0015238
665 Ga0495664_0001546
666 Ga0495664_0003023
667 Ga0495594_0006249
668 Ga0495608_0010648
669 Ga0495608_0012669
670 Ga0495608_0383363
671 Ga0495618_0003663
672 Ga0495618_0214658
673 Ga0495628_0007581
674 Ga0495628_0259934
675 Ga0495630_0002512
676 Ga0495630_0039432
677 Ga0495630_0160703
678 Ga0495630_0167623
679 Ga0495630_0463338
680 Ga0495648_0063706
681 Ga0495666_0000305
682 Ga0495666_0001689
683 Ga0495652_0003628
684 Ga0495652_0017810
685 Ga0495652_0045316
686 Ga0495652_0079297
687 Ga0495652_0160940
688 Ga0495665_0006116
689 Ga0495640_0007800
690 Ga0495640_0021226
691 Ga0495640_0102128
692 Ga0495640_0147236
693 Ga0495586_0004038
694 Ga0495587_0002358
695 Ga0495587_0010798
696 Ga0495587_0031458
697 Ga0495587_0143747
698 Ga0495645_0015275
699 Ga0495645_0024949
700 Ga0495645_0048569
701 Ga0495667_0010722
702 Ga0495667_0016178
703 Ga0495667_0027104
704 Ga0495667_0038759
705 Ga0495667_0045761
706 Ga0495667_0089318
707 Ga0495667_0193865
708 Ga0495667_0297652
709 Ga0495634_0005453
710 Ga0495634_0032534
711 Ga0495634_0041871
712 Ga0495635_0004863
713 Ga0495635_0013320
714 Ga0495635_0025075
715 Ga0495635_0028361
716 Ga0495657_0005139
717 Ga0495657_0007245
718 Ga0495657_0020052
719 Ga0495657_0052453
720 Ga0495657_0081960
721 Ga0495657_0317016
722 Ga0495599_0017371
723 Ga0495599_0023773
724 Ga0495599_0024958
725 Ga0495623_0003110
726 Ga0495623_0004540
727 Ga0495623_0043282
728 Ga0495646_0008659
729 Ga0495647_0021720
730 Ga0495658_0004233
731 Ga0495613_0001578
732 Ga0495613_0004773
733 Ga0495613_0012138
734 Ga0495624_0002010
735 Ga0495624_0077363
736 Ga0495600_0076169
737 Ga0495600_0111013
738 Ga0495600_0118009
739 Ga0495600_0145967
740 Ga0495581_0000510
741 Ga0495604_0001862
742 Ga0495604_0002067
743 Ga0495604_0068141
744 Ga0495604_0134121
745 Ga0495674_0011031
746 Ga0495674_0011897
747 Ga0495674_0020895
748 Ga0495674_0021093
749 Ga0495674_0079572
750 Ga0495674_0718173
751 Ga0495676_0002725
752 Ga0495676_0038938
753 Ga0495680_0008645
754 Ga0495680_0017357
755 Ga0495680_0049829
756 Ga0495680_0060153
757 Ga0495680_0117465
758 Ga0495680_0230291
759 Ga0495675_0002841
760 Ga0495675_0007153
761 Ga0495675_0392523
762 Ga0495684_0001345
763 Ga0495684_0005772
764 Ga0495684_0007519
765 Ga0495684_0015541
766 Ga0495684_0023522
767 Ga0495593_0002746
768 Ga0495593_0120830
769 Ga0495602_0006212
770 Ga0495602_0086342
771 Ga0495602_0155316
772 Ga0495602_0213707
773 Ga0495614_0048974
774 Ga0496109_0213930
775 Ga0496110_0945487
776 Ga0496112_0380747
777 Ga0496126_0099524
778 Ga0501031_0074656
779 Ga0501031_0294726
780 Ga0501032_0080510
781 Ga0501036_0086506
782 Ga0501036_0233749
783 Ga0501037_0430970
784 Ga0501038_0113833
785 Ga0501039_0022537
786 Ga0501039_0112530
787 Ga0501040_0053626
788 Ga0501041_0058203
789 Ga0501041_0225227
790 Ga0501043_0020283
791 Ga0501046_0091710
792 Ga0501048_0116957
793 Ga0501048_0294553
794 Ga0501068_0133507
795 Ga0501070_0248892
796 Ga0501071_0003075
797 Ga0501071_0356682
798 Ga0501072_0033729
799 Ga0501074_0012408
800 Ga0501075_0052489
801 Ga0501076_0033374
802 Ga0501076_0171854
803 Ga0501077_0009274
804 Ga0501079_0014494
805 Ga0501080_0123984
806 Ga0501081_0014476
807 Ga0501035_0184822
808 Ga0501045_0094570
809 nmdc:mga05p37_260558_c1
810 nmdc:mga0n895_231225_c1
811 nmdc:mga0rr50_517381_c1
812 Ga0495601_0017526
813 Ga0495601_0121463
814 Ga0495612_0001211
815 Ga0495595_0113961
816 Ga0495595_0142629
817 Ga0495595_0174517
818 Ga0495619_0002829
819 Ga0495619_0142806
820 Ga0495619_0375768
821 Ga0500573_0211130
822 Ga0501084_0104113
823 Ga0501082_0018387
824 Ga0501082_0335961
825 Ga0466962_0016330
826 Ga0530510_0073288
827 2585296124
828 2644032111
829 2954700982
830 2954706355

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00196

GerE

Bacterial regulatory proteins, luxR family

205

261

0.97

PF04545

Sigma70_r4

Sigma-70, region 4

203

250

0.97

PF08281

Sigma70_r4_2

Sigma-70, region 4

202

249

0.97

PF00072

Response_reg

Response regulator receiver domain

43

164

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1je8-assembly2.cif.gz_E two-component response regulator narl/dna complex: dna bending found in a high affinity site 0.9916 160 218
4wul-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.9884 161 223
4wsz-assembly1.cif.gz_B crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9883 159 223
4wsz-assembly1.cif.gz_A crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9848 159 223
4wu4-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 22bp dna 0.9809 159 222
ID Description Score Start End Superfamily
4if4C02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9686 159 224 1.10.10.10
1zlkB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.968 160 217 1.10.10.10
4if4D02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9678 159 224 1.10.10.10
4if4D01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9632 12 146 3.40.50.2300
3qp5D02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9601 163 215 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7K2MLM2-F1-model_v4 Response regulator 0.9772 12 143 GO:0000160
GO:0003677
AF-A0A4S3Q0P3-F1-model_v4 deleted 0.9678 12 136
AF-A0A2X3GRH1-F1-model_v4 Nitrogen regulation protein C 0.9675 12 125 GO:0000160
GO:0003677
GO:0010468
AF-A0A850CTL9-F1-model_v4 deleted 0.9631 9 119
AF-A0A1G7T7L2-F1-model_v4 Response regulator receiver domain-containing protein 0.9623 12 136 GO:0000160
GO:0003677

Map