F438492
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 415 | 239 | 413 | 245 |
Family's Representative Sequence
| Representative Sequence | 3300005331|Ga0070670_100191099|Ga0070670_1001910992 |
| Length | 285 |
| Sequence | MKSRMARVFITGSADGLGQLSAKSLIEQGHKVALHSRNAERGHIAISKNPGAEAVFTGDLSNLVEIKNLANELNESGAFDAVIHNAGVYKVSASEIFTVNTLAPYILTCLIKKPGRLIYLSSGMHFHGRPKLDKFENGISHITYSDSKLHVLMLCMAVARKWADVYSNAVDPGWVPTKMGGRGAPDNLRQGYETQVWLAVSNDVHAKVTGSYFFHQKEKHHNPEADDVLLQERFLGLCHEITVLLFRNRIKTKSRLNFFKKRLLHFNAIADADQSSCIKVLVIQI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 2 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 63 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 92 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 141 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 142 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 143 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 144 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 145 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 146 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 147 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 148 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 149 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 150 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 151 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 152 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 153 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 154 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 155 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 156 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 157 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 158 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 159 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 160 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 161 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 162 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 163 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 164 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 165 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 166 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 167 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 168 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 177 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 178 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 179 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 180 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 181 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 183 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 184 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 203 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 204 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 205 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 206 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 207 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 208 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 209 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 210 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 211 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 212 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 213 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 214 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 215 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 216 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 217 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 218 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 219 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 220 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 221 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 222 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 223 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 224 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 226 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 227 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 228 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 231 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 232 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 235 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 236 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 237 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 238 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 239 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.52 |
| Metatranscriptomes | 0 |
| Isolates | 0.48 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.41 |
| Nodule | 0 |
| Rhizoplane | 1.45 |
| Rhizosphere | 93.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10000296 | 3300002459 | Bacteria | 18771 |
| 2 | rootH2_10202275 | 3300003320 | Bacteria | 2683 |
| 3 | rootH2_10234768 | 3300003320 | Bacteria | 1505 |
| 4 | rootL2_10013519 | 3300003322 | Bacteria | 5073 |
| 5 | rootL2_10040286 | 3300003322 | Bacteria | 11317 |
| 6 | rootL2_10049588 | 3300003322 | Bacteria | 5241 |
| 7 | rootL2_10087964 | 3300003322 | Bacteria | 2720 |
| 8 | rootL2_10305785 | 3300003322 | Bacteria | 1250 |
| 9 | rootH1_10024356 | 3300003323 | Bacteria | 19253 |
| 10 | rootH1_10278093 | 3300003323 | Bacteria | 1686 |
| 11 | Ga0065704_10125251 | 3300005289 | Bacteria | 1684 |
| 12 | Ga0065715_10119774 | 3300005293 | Bacteria | 2277 |
| 13 | Ga0065707_10172990 | 3300005295 | Bacteria | 1471 |
| 14 | Ga0070658_10112149 | 3300005327 | Unclassified | 2260 |
| 15 | Ga0070658_10130252 | 3300005327 | Bacteria | 2096 |
| 16 | Ga0070658_10173283 | 3300005327 | Bacteria | 1813 |
| 17 | Ga0070676_10384447 | 3300005328 | Unclassified | 973 |
| 18 | Ga0070683_100000369 | 3300005329 | Bacteria | 31172 |
| 19 | Ga0070683_100020132 | 3300005329 | Bacteria | 5935 |
| 20 | Ga0070683_100502883 | 3300005329 | Unclassified | 1158 |
| 21 | Ga0070690_100006820 | 3300005330 | Bacteria | 6496 |
| 22 | Ga0070670_100001499 | 3300005331 | Bacteria | 18809 |
| 23 | Ga0070670_100040947 | 3300005331 | Bacteria | 3982 |
| 24 | Ga0070670_100191099 | 3300005331 | Unclassified | 1778 |
| 25 | Ga0070670_100413172 | 3300005331 | Bacteria | 1192 |
| 26 | Ga0068869_100066797 | 3300005334 | Unclassified | 2651 |
| 27 | Ga0068869_100230197 | 3300005334 | Bacteria | 1472 |
| 28 | Ga0070682_100019814 | 3300005337 | Bacteria | 3951 |
| 29 | Ga0070682_100042571 | 3300005337 | Bacteria | 2804 |
| 30 | Ga0068868_100946825 | 3300005338 | Unclassified | 785 |
| 31 | Ga0070689_100065606 | 3300005340 | Bacteria | 2827 |
| 32 | Ga0070687_100005111 | 3300005343 | Bacteria | 5289 |
| 33 | Ga0070661_100002729 | 3300005344 | Bacteria | 12103 |
| 34 | Ga0070661_100452281 | 3300005344 | Bacteria | 1022 |
| 35 | Ga0070692_10008616 | 3300005345 | Bacteria | 4556 |
| 36 | Ga0070668_100065466 | 3300005347 | Bacteria | 2819 |
| 37 | Ga0070669_100071498 | 3300005353 | Bacteria | 2567 |
| 38 | Ga0070669_100367514 | 3300005353 | Bacteria | 1171 |
| 39 | Ga0070675_100026841 | 3300005354 | Bacteria | 4623 |
| 40 | Ga0070671_100183658 | 3300005355 | Bacteria | 1771 |
| 41 | Ga0070671_100207988 | 3300005355 | Bacteria | 1659 |
| 42 | Ga0070671_100267872 | 3300005355 | Unclassified | 1452 |
| 43 | Ga0070674_100048772 | 3300005356 | Bacteria | 2908 |
| 44 | Ga0070673_100035190 | 3300005364 | Bacteria | 3795 |
| 45 | Ga0070673_100098390 | 3300005364 | Bacteria | 2404 |
| 46 | Ga0070688_100016767 | 3300005365 | Bacteria | 4193 |
| 47 | Ga0070659_100000542 | 3300005366 | Bacteria | 27536 |
| 48 | Ga0070659_100002724 | 3300005366 | Bacteria | 12569 |
| 49 | Ga0070667_100024409 | 3300005367 | Bacteria | 5021 |
| 50 | Ga0070667_100840440 | 3300005367 | Bacteria | 853 |
| 51 | Ga0070714_100272531 | 3300005435 | Bacteria | 1570 |
| 52 | Ga0070713_100148132 | 3300005436 | Bacteria | 2085 |
| 53 | Ga0070710_10191364 | 3300005437 | Bacteria | 1287 |
| 54 | Ga0070705_100004849 | 3300005440 | Bacteria | 6545 |
| 55 | Ga0070694_100004601 | 3300005444 | Bacteria | 8298 |
| 56 | Ga0070694_100029789 | 3300005444 | Bacteria | 3565 |
| 57 | Ga0070678_100133942 | 3300005456 | Bacteria | 1973 |
| 58 | Ga0070678_100405459 | 3300005456 | Bacteria | 1185 |
| 59 | Ga0070678_100568609 | 3300005456 | Bacteria | 1008 |
| 60 | Ga0070662_100389263 | 3300005457 | Bacteria | 1149 |
| 61 | Ga0068867_100012692 | 3300005459 | Bacteria | 5959 |
| 62 | Ga0068867_100012940 | 3300005459 | Bacteria | 5903 |
| 63 | Ga0068867_100028134 | 3300005459 | Bacteria | 4045 |
| 64 | Ga0068867_100074772 | 3300005459 | Bacteria | 2540 |
| 65 | Ga0070698_100023649 | 3300005471 | Bacteria | 6420 |
| 66 | Ga0070679_100036518 | 3300005530 | Bacteria | 4876 |
| 67 | Ga0070679_100048260 | 3300005530 | Bacteria | 4243 |
| 68 | Ga0070679_100196143 | 3300005530 | Bacteria | 1987 |
| 69 | Ga0070684_100001473 | 3300005535 | Bacteria | 16983 |
| 70 | Ga0070684_100023366 | 3300005535 | Bacteria | 5169 |
| 71 | Ga0070684_100386574 | 3300005535 | Bacteria | 1289 |
| 72 | Ga0070686_100008908 | 3300005544 | Bacteria | 5625 |
| 73 | Ga0070695_100157544 | 3300005545 | Bacteria | 1591 |
| 74 | Ga0070693_100007482 | 3300005547 | Bacteria | 5341 |
| 75 | Ga0070693_100248533 | 3300005547 | Unclassified | 1178 |
| 76 | Ga0070704_100036985 | 3300005549 | Bacteria | 3331 |
| 77 | Ga0070704_100147095 | 3300005549 | Bacteria | 1848 |
| 78 | Ga0070704_100555364 | 3300005549 | Unclassified | 1004 |
| 79 | Ga0070664_100000744 | 3300005564 | Bacteria | 25104 |
| 80 | Ga0070664_100011463 | 3300005564 | Bacteria | 7194 |
| 81 | Ga0070664_100030222 | 3300005564 | Bacteria | 4519 |
| 82 | Ga0070664_100260382 | 3300005564 | Bacteria | 1561 |
| 83 | Ga0070664_100616073 | 3300005564 | Unclassified | 1007 |
| 84 | Ga0068857_100001073 | 3300005577 | Bacteria | 21162 |
| 85 | Ga0068857_100222988 | 3300005577 | Bacteria | 1722 |
| 86 | Ga0068857_100682415 | 3300005577 | Bacteria | 975 |
| 87 | Ga0068854_100083273 | 3300005578 | Bacteria | 2365 |
| 88 | Ga0068856_100032315 | 3300005614 | Bacteria | 5123 |
| 89 | Ga0070702_100004452 | 3300005615 | Bacteria | 6396 |
| 90 | Ga0068852_100287747 | 3300005616 | Bacteria | 1586 |
| 91 | Ga0068852_100319687 | 3300005616 | Bacteria | 1507 |
| 92 | Ga0068852_100394259 | 3300005616 | Bacteria | 1360 |
| 93 | Ga0068859_100000436 | 3300005617 | Bacteria | 41890 |
| 94 | Ga0068859_100020344 | 3300005617 | Bacteria | 6662 |
| 95 | Ga0068859_100035757 | 3300005617 | Bacteria | 4985 |
| 96 | Ga0068859_100152280 | 3300005617 | Bacteria | 2388 |
| 97 | Ga0068859_100158655 | 3300005617 | Bacteria | 2341 |
| 98 | Ga0068859_100163855 | 3300005617 | Bacteria | 2302 |
| 99 | Ga0068859_100405648 | 3300005617 | Bacteria | 1459 |
| 100 | Ga0068859_100584248 | 3300005617 | Bacteria | 1211 |
| 101 | Ga0068864_100046716 | 3300005618 | Bacteria | 3716 |
| 102 | Ga0068864_100071525 | 3300005618 | Unclassified | 3021 |
| 103 | Ga0068864_100087696 | 3300005618 | Bacteria | 2740 |
| 104 | Ga0068864_100229109 | 3300005618 | Bacteria | 1718 |
| 105 | Ga0068866_10014277 | 3300005718 | Unclassified | 3504 |
| 106 | Ga0068866_10193404 | 3300005718 | Bacteria | 1210 |
| 107 | Ga0068861_100031415 | 3300005719 | Bacteria | 3902 |
| 108 | Ga0068861_100118101 | 3300005719 | Bacteria | 2136 |
| 109 | Ga0068851_10003512 | 3300005834 | Bacteria | 6977 |
| 110 | Ga0068870_10018128 | 3300005840 | Bacteria | 3394 |
| 111 | Ga0068863_100117720 | 3300005841 | Bacteria | 2532 |
| 112 | Ga0068858_100000316 | 3300005842 | Bacteria | 51458 |
| 113 | Ga0068858_100260258 | 3300005842 | Bacteria | 1649 |
| 114 | Ga0068858_100358986 | 3300005842 | Bacteria | 1396 |
| 115 | Ga0068860_100009781 | 3300005843 | Bacteria | 9521 |
| 116 | Ga0068860_100018513 | 3300005843 | Bacteria | 6774 |
| 117 | Ga0068860_100026526 | 3300005843 | Bacteria | 5584 |
| 118 | Ga0068860_100056608 | 3300005843 | Bacteria | 3727 |
| 119 | Ga0068862_100015469 | 3300005844 | Bacteria | 6337 |
| 120 | Ga0068862_100044734 | 3300005844 | Bacteria | 3776 |
| 121 | Ga0068862_100606084 | 3300005844 | Unclassified | 1052 |
| 122 | Ga0081539_10018276 | 3300005985 | Unclassified | 4873 |
| 123 | Ga0075366_10002297 | 3300006195 | Bacteria | 9763 |
| 124 | Ga0075366_10008021 | 3300006195 | Bacteria | 5852 |
| 125 | Ga0097621_100021765 | 3300006237 | Bacteria | 4967 |
| 126 | Ga0097621_100707633 | 3300006237 | Bacteria | 928 |
| 127 | Ga0068871_100032048 | 3300006358 | Bacteria | 4148 |
| 128 | Ga0068865_100113517 | 3300006881 | Bacteria | 2003 |
| 129 | Ga0068865_100259209 | 3300006881 | Bacteria | 1376 |
| 130 | Ga0068865_100349537 | 3300006881 | Bacteria | 1197 |
| 131 | Ga0097620_100000436 | 3300006931 | Bacteria | 41890 |
| 132 | Ga0097620_100020344 | 3300006931 | Bacteria | 6662 |
| 133 | Ga0097620_100035756 | 3300006931 | Bacteria | 4985 |
| 134 | Ga0097620_100146141 | 3300006931 | Bacteria | 2439 |
| 135 | Ga0097620_100152280 | 3300006931 | Bacteria | 2388 |
| 136 | Ga0097620_100158644 | 3300006931 | Bacteria | 2341 |
| 137 | Ga0097620_100163845 | 3300006931 | Bacteria | 2302 |
| 138 | Ga0097620_100405620 | 3300006931 | Bacteria | 1459 |
| 139 | Ga0097620_100584208 | 3300006931 | Bacteria | 1211 |
| 140 | Ga0105240_10233891 | 3300009093 | Unclassified | 2134 |
| 141 | Ga0105240_10843635 | 3300009093 | Bacteria | 990 |
| 142 | Ga0111539_10095585 | 3300009094 | Bacteria | 3490 |
| 143 | Ga0105247_10014191 | 3300009101 | Bacteria | 4780 |
| 144 | Ga0105247_10025441 | 3300009101 | Bacteria | 3570 |
| 145 | Ga0105243_10072179 | 3300009148 | Bacteria | 2793 |
| 146 | Ga0105243_10677873 | 3300009148 | Bacteria | 1002 |
| 147 | Ga0105242_10027558 | 3300009176 | Bacteria | 4513 |
| 148 | Ga0105242_10159032 | 3300009176 | Bacteria | 1976 |
| 149 | Ga0105242_10344692 | 3300009176 | Bacteria | 1374 |
| 150 | Ga0105237_10000056 | 3300009545 | Bacteria | 151313 |
| 151 | Ga0105237_10000176 | 3300009545 | Bacteria | 90175 |
| 152 | Ga0105237_10002520 | 3300009545 | Bacteria | 22687 |
| 153 | Ga0105237_10049057 | 3300009545 | Bacteria | 4245 |
| 154 | Ga0105237_10418478 | 3300009545 | Bacteria | 1345 |
| 155 | Ga0105238_10010374 | 3300009551 | Bacteria | 9351 |
| 156 | Ga0105238_10130224 | 3300009551 | Unclassified | 2494 |
| 157 | Ga0105249_10013964 | 3300009553 | Bacteria | 7099 |
| 158 | Ga0105249_10017914 | 3300009553 | Bacteria | 6294 |
| 159 | Ga0105249_10018429 | 3300009553 | Bacteria | 6211 |
| 160 | Ga0105249_10879450 | 3300009553 | Unclassified | 962 |
| 161 | Ga0105239_10001693 | 3300010375 | Bacteria | 29061 |
| 162 | Ga0105239_10028378 | 3300010375 | Bacteria | 6156 |
| 163 | Ga0105239_10204296 | 3300010375 | Bacteria | 2214 |
| 164 | Ga0105246_10114326 | 3300011119 | Bacteria | 1988 |
| 165 | Ga0157373_10178052 | 3300013100 | Bacteria | 1497 |
| 166 | Ga0157370_10149237 | 3300013104 | Bacteria | 2176 |
| 167 | Ga0157374_10222604 | 3300013296 | Bacteria | 1852 |
| 168 | Ga0157378_10001986 | 3300013297 | Bacteria | 18311 |
| 169 | Ga0157378_10019929 | 3300013297 | Bacteria | 5898 |
| 170 | Ga0157378_10106410 | 3300013297 | Bacteria | 2566 |
| 171 | Ga0157378_10124137 | 3300013297 | Bacteria | 2383 |
| 172 | Ga0157378_10182880 | 3300013297 | Bacteria | 1973 |
| 173 | Ga0163162_10000535 | 3300013306 | Bacteria | 35127 |
| 174 | Ga0163162_10031920 | 3300013306 | Bacteria | 5227 |
| 175 | Ga0163162_10095635 | 3300013306 | Bacteria | 3058 |
| 176 | Ga0163162_10108006 | 3300013306 | Bacteria | 2879 |
| 177 | Ga0163162_10291654 | 3300013306 | Bacteria | 1763 |
| 178 | Ga0163162_10313448 | 3300013306 | Unclassified | 1701 |
| 179 | Ga0157372_10753343 | 3300013307 | Bacteria | 1132 |
| 180 | Ga0157372_10919294 | 3300013307 | Bacteria | 1015 |
| 181 | Ga0157375_10143059 | 3300013308 | Unclassified | 2520 |
| 182 | Ga0163163_10001643 | 3300014325 | Bacteria | 18815 |
| 183 | Ga0163163_10001884 | 3300014325 | Bacteria | 17736 |
| 184 | Ga0163163_10256119 | 3300014325 | Bacteria | 1801 |
| 185 | Ga0157380_10004292 | 3300014326 | Bacteria | 9874 |
| 186 | Ga0157380_10006281 | 3300014326 | Bacteria | 8343 |
| 187 | Ga0157380_10068990 | 3300014326 | Bacteria | 2851 |
| 188 | Ga0157380_10079598 | 3300014326 | Bacteria | 2676 |
| 189 | Ga0157377_10015183 | 3300014745 | Bacteria | 3932 |
| 190 | Ga0157379_10008833 | 3300014968 | Bacteria | 8789 |
| 191 | Ga0157379_10181727 | 3300014968 | Bacteria | 1900 |
| 192 | Ga0157379_10325244 | 3300014968 | Bacteria | 1404 |
| 193 | Ga0157376_10848003 | 3300014969 | Unclassified | 929 |
| 194 | Ga0163161_10236037 | 3300017792 | Unclassified | 1420 |
| 195 | Ga0213876_10000206 | 3300021384 | Bacteria | 59646 |
| 196 | Ga0209455_1003182 | 3300025272 | Bacteria | 5953 |
| 197 | Ga0207697_10013031 | 3300025315 | Bacteria | 3474 |
| 198 | Ga0207653_10013461 | 3300025885 | Unclassified | 2561 |
| 199 | Ga0207642_10147343 | 3300025899 | Bacteria | 1249 |
| 200 | Ga0207688_10045869 | 3300025901 | Bacteria | 2439 |
| 201 | Ga0207688_10227463 | 3300025901 | Bacteria | 1125 |
| 202 | Ga0207647_10035789 | 3300025904 | Unclassified | 3161 |
| 203 | Ga0207645_10029275 | 3300025907 | Bacteria | 3551 |
| 204 | Ga0207645_10297357 | 3300025907 | Unclassified | 1074 |
| 205 | Ga0207645_10343771 | 3300025907 | Bacteria | 998 |
| 206 | Ga0207643_10013053 | 3300025908 | Bacteria | 4491 |
| 207 | Ga0207643_10128911 | 3300025908 | Bacteria | 1503 |
| 208 | Ga0207705_10088856 | 3300025909 | Unclassified | 2260 |
| 209 | Ga0207705_10191787 | 3300025909 | Unclassified | 1546 |
| 210 | Ga0207695_10015351 | 3300025913 | Bacteria | 9018 |
| 211 | Ga0207671_10000172 | 3300025914 | Bacteria | 99486 |
| 212 | Ga0207671_10001166 | 3300025914 | Bacteria | 31300 |
| 213 | Ga0207671_10001997 | 3300025914 | Bacteria | 22478 |
| 214 | Ga0207671_10003766 | 3300025914 | Bacteria | 14911 |
| 215 | Ga0207671_10063312 | 3300025914 | Bacteria | 2748 |
| 216 | Ga0207662_10007822 | 3300025918 | Bacteria | 5824 |
| 217 | Ga0207662_10039893 | 3300025918 | Bacteria | 2756 |
| 218 | Ga0207649_10001318 | 3300025920 | Bacteria | 14782 |
| 219 | Ga0207652_10187642 | 3300025921 | Unclassified | 1859 |
| 220 | Ga0207681_10520113 | 3300025923 | Bacteria | 976 |
| 221 | Ga0207694_10121612 | 3300025924 | Bacteria | 2085 |
| 222 | Ga0207650_10000005 | 3300025925 | Bacteria | 663190 |
| 223 | Ga0207650_10007263 | 3300025925 | Bacteria | 7546 |
| 224 | Ga0207650_10103282 | 3300025925 | Unclassified | 2197 |
| 225 | Ga0207700_10015311 | 3300025928 | Bacteria | 5053 |
| 226 | Ga0207664_10000501 | 3300025929 | Bacteria | 27913 |
| 227 | Ga0207664_10639749 | 3300025929 | Bacteria | 956 |
| 228 | Ga0207644_10026019 | 3300025931 | Bacteria | 4028 |
| 229 | Ga0207690_10000668 | 3300025932 | Bacteria | 21960 |
| 230 | Ga0207690_10002344 | 3300025932 | Bacteria | 11495 |
| 231 | Ga0207706_10178010 | 3300025933 | Bacteria | 1868 |
| 232 | Ga0207706_10216238 | 3300025933 | Bacteria | 1679 |
| 233 | Ga0207686_10133245 | 3300025934 | Bacteria | 1707 |
| 234 | Ga0207691_10525389 | 3300025940 | Bacteria | 1004 |
| 235 | Ga0207711_10063278 | 3300025941 | Bacteria | 3193 |
| 236 | Ga0207711_10107708 | 3300025941 | Bacteria | 2475 |
| 237 | Ga0207711_10235168 | 3300025941 | Bacteria | 1679 |
| 238 | Ga0207689_10016707 | 3300025942 | Bacteria | 6210 |
| 239 | Ga0207689_10075274 | 3300025942 | Unclassified | 2775 |
| 240 | Ga0207689_10076584 | 3300025942 | Bacteria | 2750 |
| 241 | Ga0207689_10346500 | 3300025942 | Bacteria | 1234 |
| 242 | Ga0207661_10001242 | 3300025944 | Bacteria | 17032 |
| 243 | Ga0207661_10084543 | 3300025944 | Bacteria | 2629 |
| 244 | Ga0207679_10000182 | 3300025945 | Bacteria | 51887 |
| 245 | Ga0207679_10091067 | 3300025945 | Bacteria | 2359 |
| 246 | Ga0207679_10358170 | 3300025945 | Bacteria | 1273 |
| 247 | Ga0207679_10561684 | 3300025945 | Unclassified | 1025 |
| 248 | Ga0207651_10147865 | 3300025960 | Bacteria | 1825 |
| 249 | Ga0207651_10185545 | 3300025960 | Bacteria | 1654 |
| 250 | Ga0207651_10268002 | 3300025960 | Bacteria | 1405 |
| 251 | Ga0207712_10001780 | 3300025961 | Bacteria | 14326 |
| 252 | Ga0207712_10064142 | 3300025961 | Bacteria | 2618 |
| 253 | Ga0207668_10021774 | 3300025972 | Bacteria | 4092 |
| 254 | Ga0207640_10142467 | 3300025981 | Bacteria | 1749 |
| 255 | Ga0207658_10010211 | 3300025986 | Bacteria | 6378 |
| 256 | Ga0207677_10399599 | 3300026023 | Bacteria | 1165 |
| 257 | Ga0207703_10005005 | 3300026035 | Bacteria | 10749 |
| 258 | Ga0207703_10067585 | 3300026035 | Unclassified | 2941 |
| 259 | Ga0207703_10192229 | 3300026035 | Bacteria | 1808 |
| 260 | Ga0207703_10201586 | 3300026035 | Bacteria | 1768 |
| 261 | Ga0207639_10322572 | 3300026041 | Bacteria | 1372 |
| 262 | Ga0207678_10051879 | 3300026067 | Bacteria | 3540 |
| 263 | Ga0207708_10303609 | 3300026075 | Bacteria | 1299 |
| 264 | Ga0207708_10430617 | 3300026075 | Bacteria | 1095 |
| 265 | Ga0207702_10039537 | 3300026078 | Bacteria | 3953 |
| 266 | Ga0207641_10142844 | 3300026088 | Bacteria | 2162 |
| 267 | Ga0207641_10221250 | 3300026088 | Bacteria | 1756 |
| 268 | Ga0207648_10000394 | 3300026089 | Bacteria | 48433 |
| 269 | Ga0207648_10014563 | 3300026089 | Bacteria | 7264 |
| 270 | Ga0207648_10019162 | 3300026089 | Bacteria | 6174 |
| 271 | Ga0207648_10147497 | 3300026089 | Bacteria | 2075 |
| 272 | Ga0207648_10159667 | 3300026089 | Bacteria | 1991 |
| 273 | Ga0207648_10250811 | 3300026089 | Bacteria | 1578 |
| 274 | Ga0207648_10715064 | 3300026089 | Unclassified | 929 |
| 275 | Ga0207676_10068704 | 3300026095 | Bacteria | 2835 |
| 276 | Ga0207676_10408303 | 3300026095 | Bacteria | 1271 |
| 277 | Ga0207676_10647707 | 3300026095 | Bacteria | 1019 |
| 278 | Ga0207674_10003912 | 3300026116 | Bacteria | 18125 |
| 279 | Ga0207674_10008888 | 3300026116 | Bacteria | 11553 |
| 280 | Ga0207674_10053054 | 3300026116 | Bacteria | 4133 |
| 281 | Ga0207674_10401895 | 3300026116 | Bacteria | 1324 |
| 282 | Ga0207675_100000820 | 3300026118 | Bacteria | 30929 |
| 283 | Ga0207675_100023593 | 3300026118 | Bacteria | 5724 |
| 284 | Ga0207675_100032380 | 3300026118 | Bacteria | 4869 |
| 285 | Ga0207675_100198262 | 3300026118 | Bacteria | 1927 |
| 286 | Ga0207675_100225015 | 3300026118 | Bacteria | 1808 |
| 287 | Ga0207683_10032094 | 3300026121 | Bacteria | 4561 |
| 288 | Ga0207683_10056097 | 3300026121 | Bacteria | 3455 |
| 289 | Ga0207698_10265581 | 3300026142 | Bacteria | 1579 |
| 290 | Ga0207698_10386653 | 3300026142 | Bacteria | 1333 |
| 291 | Ga0207698_10726253 | 3300026142 | Bacteria | 990 |
| 292 | Ga0268265_10031033 | 3300028380 | Bacteria | 3856 |
| 293 | Ga0268265_10160700 | 3300028380 | Unclassified | 1908 |
| 294 | Ga0268265_10254718 | 3300028380 | Bacteria | 1557 |
| 295 | Ga0268265_10717617 | 3300028380 | Bacteria | 967 |
| 296 | Ga0268264_10006942 | 3300028381 | Bacteria | 9500 |
| 297 | Ga0268264_10025826 | 3300028381 | Bacteria | 4797 |
| 298 | Ga0268264_10050736 | 3300028381 | Bacteria | 3456 |
| 299 | Ga0268264_10085240 | 3300028381 | Bacteria | 2711 |
| 300 | Ga0307515_10000300 | 3300028794 | Bacteria | 122040 |
| 301 | Ga0316183_1086246 | 3300030742 | Bacteria | 40321 |
| 302 | Ga0316181_1280322 | 3300030744 | Bacteria | 32733 |
| 303 | Ga0265316_10055693 | 3300031344 | Bacteria | 3091 |
| 304 | Ga0307408_100086688 | 3300031548 | Bacteria | 2354 |
| 305 | Ga0316576_10005467 | 3300031727 | Bacteria | 7770 |
| 306 | Ga0316578_10064318 | 3300031728 | Bacteria | 2165 |
| 307 | Ga0307405_10079763 | 3300031731 | Bacteria | 2135 |
| 308 | Ga0307413_10021370 | 3300031824 | Bacteria | 3463 |
| 309 | Ga0307410_10014549 | 3300031852 | Bacteria | 4634 |
| 310 | Ga0307406_10048290 | 3300031901 | Bacteria | 2687 |
| 311 | Ga0307412_10014697 | 3300031911 | Bacteria | 4626 |
| 312 | Ga0307409_100042540 | 3300031995 | Bacteria | 3403 |
| 313 | Ga0307409_100395884 | 3300031995 | Bacteria | 1318 |
| 314 | Ga0307416_100026082 | 3300032002 | Bacteria | 4300 |
| 315 | Ga0307411_10014316 | 3300032005 | Bacteria | 4408 |
| 316 | Ga0373941_0003580 | 3300035115 | Bacteria | 3533 |
| 317 | Ga0373941_0021717 | 3300035115 | Bacteria | 1815 |
| 318 | Ga0316574_0383774 | 3300035398 | Unclassified | 886 |
| 319 | Ga0373927_0312547 | 3300035695 | Bacteria | 1034 |
| 320 | Ga0316582_0260552 | 3300036647 | Unclassified | 1189 |
| 321 | Ga0316584_0074183 | 3300036712 | Bacteria | 2551 |
| 322 | Ga0436365_0880687 | 3300039437 | Bacteria | 59690 |
| 323 | Ga0439436_0025789 | 3300041404 | Bacteria | 1726 |
| 324 | Ga0439449_0013498 | 3300042007 | Bacteria | 3074 |
| 325 | Ga0439457_034118 | 3300042014 | Bacteria | 1130 |
| 326 | Ga0451577_0217415 | 3300042876 | Unclassified | 1727 |
| 327 | Ga0451577_0438348 | 3300042876 | Unclassified | 1186 |
| 328 | Ga0466972_0000007 | 3300044658 | Bacteria | 277010 |
| 329 | Ga0453683_0000139 | 3300044673 | Bacteria | 105329 |
| 330 | Ga0453684_0000256 | 3300044712 | Bacteria | 228862 |
| 331 | Ga0453684_0174344 | 3300044712 | Bacteria | 2531 |
| 332 | Ga0453684_0637302 | 3300044712 | Bacteria | 1164 |
| 333 | Ga0453684_0934220 | 3300044712 | Bacteria | 927 |
| 334 | Ga0495641_0076134 | 3300046461 | Bacteria | 1504 |
| 335 | Ga0495606_0007762 | 3300046507 | Bacteria | 9498 |
| 336 | Ga0495633_0000167 | 3300046558 | Bacteria | 86373 |
| 337 | Ga0495668_0079160 | 3300046616 | Bacteria | 1804 |
| 338 | Ga0495687_023321 | 3300047443 | Bacteria | 2956 |
| 339 | Ga0495684_0181123 | 3300047471 | Bacteria | 1562 |
| 340 | Ga0495686_0000607 | 3300047472 | Bacteria | 49581 |
| 341 | Ga0496100_0020346 | 3300048903 | Bacteria | 3977 |
| 342 | Ga0496100_0088594 | 3300048903 | Bacteria | 2107 |
| 343 | Ga0496102_0061989 | 3300048905 | Bacteria | 3424 |
| 344 | Ga0496106_0272802 | 3300048909 | Bacteria | 1354 |
| 345 | Ga0496107_0017233 | 3300048910 | Bacteria | 5080 |
| 346 | Ga0496115_0032866 | 3300048918 | Bacteria | 4095 |
| 347 | Ga0496121_0000026 | 3300048924 | Bacteria | 450157 |
| 348 | Ga0495678_012209 | 3300049459 | Bacteria | 4079 |
| 349 | Ga0501296_014953 | 3300049519 | Unclassified | 955 |
| 350 | Ga0501298_013446 | 3300049521 | Bacteria | 1450 |
| 351 | Ga0501031_0104397 | 3300049568 | Bacteria | 1849 |
| 352 | Ga0501032_0034630 | 3300049569 | Bacteria | 3455 |
| 353 | Ga0501033_0045063 | 3300049570 | Unclassified | 3283 |
| 354 | Ga0501034_0010869 | 3300049571 | Bacteria | 9455 |
| 355 | Ga0501034_0130307 | 3300049571 | Bacteria | 2498 |
| 356 | Ga0501036_0115614 | 3300049572 | Unclassified | 2266 |
| 357 | Ga0501037_0014266 | 3300049573 | Bacteria | 5855 |
| 358 | Ga0501038_0012080 | 3300049574 | Bacteria | 7885 |
| 359 | Ga0501039_0022435 | 3300049575 | Unclassified | 4846 |
| 360 | Ga0501039_0029553 | 3300049575 | Bacteria | 4221 |
| 361 | Ga0501043_0192998 | 3300049579 | Bacteria | 1583 |
| 362 | Ga0501046_0030308 | 3300049580 | Bacteria | 4391 |
| 363 | Ga0501047_0034670 | 3300049581 | Unclassified | 4873 |
| 364 | Ga0501048_0087480 | 3300049582 | Bacteria | 2198 |
| 365 | Ga0501067_0018261 | 3300049583 | Bacteria | 3885 |
| 366 | Ga0501068_0014361 | 3300049584 | Bacteria | 4525 |
| 367 | Ga0501070_0109113 | 3300049586 | Bacteria | 2286 |
| 368 | Ga0501072_0233991 | 3300049588 | Bacteria | 1463 |
| 369 | Ga0501073_0013517 | 3300049589 | Bacteria | 5936 |
| 370 | Ga0501074_0017043 | 3300049590 | Bacteria | 5270 |
| 371 | Ga0501199_002791 | 3300049650 | Bacteria | 1650 |
| 372 | Ga0501199_006095 | 3300049650 | Unclassified | 1222 |
| 373 | Ga0501202_002075 | 3300049652 | Bacteria | 3324 |
| 374 | Ga0501209_027106 | 3300049656 | Bacteria | 1420 |
| 375 | Ga0501216_033775 | 3300049660 | Bacteria | 955 |
| 376 | Ga0501217_011708 | 3300049661 | Bacteria | 1944 |
| 377 | Ga0501223_004436 | 3300049663 | Unclassified | 3002 |
| 378 | Ga0501224_005348 | 3300049664 | Bacteria | 1837 |
| 379 | Ga0501227_009701 | 3300049665 | Bacteria | 2079 |
| 380 | Ga0501230_009755 | 3300049667 | Bacteria | 1483 |
| 381 | Ga0501233_017690 | 3300049668 | Bacteria | 1490 |
| 382 | Ga0501233_034144 | 3300049668 | Bacteria | 1165 |
| 383 | Ga0501235_006902 | 3300049669 | Unclassified | 2471 |
| 384 | Ga0501236_001070 | 3300049670 | Unclassified | 3114 |
| 385 | Ga0501239_008630 | 3300049672 | Bacteria | 1093 |
| 386 | Ga0501243_013385 | 3300049675 | Bacteria | 1302 |
| 387 | Ga0501256_003619 | 3300049685 | Bacteria | 1293 |
| 388 | Ga0501257_007283 | 3300049686 | Unclassified | 2472 |
| 389 | Ga0501257_027341 | 3300049686 | Bacteria | 1365 |
| 390 | Ga0501258_011299 | 3300049687 | Bacteria | 955 |
| 391 | Ga0501221_001645 | 3300049704 | Bacteria | 3715 |
| 392 | Ga0501225_0003020 | 3300049705 | Bacteria | 5137 |
| 393 | Ga0501225_0008606 | 3300049705 | Bacteria | 2924 |
| 394 | Ga0501225_0014743 | 3300049705 | Bacteria | 2180 |
| 395 | Ga0501229_013963 | 3300049706 | Bacteria | 1032 |
| 396 | Ga0501234_002797 | 3300049707 | Bacteria | 2746 |
| 397 | Ga0501245_004622 | 3300049708 | Bacteria | 1894 |
| 398 | Ga0501083_0030741 | 3300049744 | Bacteria | 3687 |
| 399 | Ga0501264_000865 | 3300049761 | Plasmid | 3903 |
| 400 | Ga0501266_013306 | 3300049763 | Bacteria | 1069 |
| 401 | Ga0501273_000984 | 3300049770 | Bacteria | 2548 |
| 402 | Ga0501035_0035768 | 3300049822 | Unclassified | 4506 |
| 403 | Ga0501044_0002454 | 3300049823 | Bacteria | 21139 |
| 404 | Ga0501226_005308 | 3300049853 | Bacteria | 1473 |
| 405 | nmdc:mga0k408_177_c3 | 3300050493 | Bacteria | 27094 |
| 406 | nmdc:mga08y16_75632_c1 | 3300050511 | Bacteria | 3510 |
| 407 | Ga0495655_0023353 | 3300053083 | Bacteria | 1425 |
| 408 | Ga0500583_0000334 | 3300053092 | Bacteria | 15648 |
| 409 | Ga0500651_0145503 | 3300053093 | Eukaryota | 1426 |
| 410 | Ga0500608_002770 | 3300053122 | Bacteria | 6458 |
| 411 | Ga0500568_0001098 | 3300053139 | Bacteria | 18219 |
| 412 | Ga0500616_0055590 | 3300053153 | Bacteria | 2069 |
| 413 | Ga0500637_0145182 | 3300053178 | Eukaryota | 1372 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042876 | Ga0451577_0438348 | Ga0451577_0438348_526_1155 | 199 |
| 2 | 3300005437 | Ga0070710_10191364 | Ga0070710_101913642 | 213 |
| 3 | 3300048905 | Ga0496102_0061989 | Ga0496102_0061989_2389_3102 | 215 |
| 4 | 3300048909 | Ga0496106_0272802 | Ga0496106_0272802_624_1337 | 215 |
| 5 | 3300048918 | Ga0496115_0032866 | Ga0496115_0032866_1548_2261 | 215 |
| 6 | 3300005435 | Ga0070714_100272531 | Ga0070714_1002725312 | 216 |
| 7 | 3300025929 | Ga0207664_10639749 | Ga0207664_106397492 | 216 |
| 8 | 3300005436 | Ga0070713_100148132 | Ga0070713_1001481322 | 223 |
| 9 | 3300025928 | Ga0207700_10015311 | Ga0207700_100153113 | 223 |
| 10 | 3300005344 | Ga0070661_100452281 | Ga0070661_1004522811 | 227 |
| 11 | 3300005535 | Ga0070684_100023366 | Ga0070684_1000233663 | 227 |
| 12 | 3300005547 | Ga0070693_100248533 | Ga0070693_1002485331 | 230 |
| 13 | 3300053093 | Ga0500651_0145503 | Ga0500651_0145503_300_1022 | 231 |
| 14 | 3300053178 | Ga0500637_0145182 | Ga0500637_0145182_15_737 | 231 |
| 15 | 3300048924 | Ga0496121_0000026 | Ga0496121_0000026_92044_92787 | 232 |
| 16 | iso_pu_bacteria | 2852623160 | 2852624431 | 232 |
| 17 | iso_pu_bacteria | 2884933994 | 2884936700 | 232 |
| 18 | 3300046461 | Ga0495641_0076134 | Ga0495641_0076134_541_1377 | 233 |
| 19 | 3300047471 | Ga0495684_0181123 | Ga0495684_0181123_370_1206 | 233 |
| 20 | 3300005355 | Ga0070671_100267872 | Ga0070671_1002678721 | 235 |
| 21 | 3300005367 | Ga0070667_100840440 | Ga0070667_1008404401 | 235 |
| 22 | 3300005617 | Ga0068859_100000436 | Ga0068859_10000043635 | 235 |
| 23 | 3300005842 | Ga0068858_100000316 | Ga0068858_1000003166 | 235 |
| 24 | 3300006931 | Ga0097620_100000436 | Ga0097620_10000043635 | 235 |
| 25 | 3300009101 | Ga0105247_10014191 | Ga0105247_100141916 | 235 |
| 26 | 3300013308 | Ga0157375_10143059 | Ga0157375_101430592 | 235 |
| 27 | 3300014968 | Ga0157379_10008833 | Ga0157379_100088334 | 235 |
| 28 | 3300025981 | Ga0207640_10142467 | Ga0207640_101424672 | 235 |
| 29 | 3300026035 | Ga0207703_10005005 | Ga0207703_100050058 | 235 |
| 30 | 3300005614 | Ga0068856_100032315 | Ga0068856_1000323152 | 236 |
| 31 | 3300009093 | Ga0105240_10233891 | Ga0105240_102338912 | 236 |
| 32 | 3300009093 | Ga0105240_10843635 | Ga0105240_108436352 | 236 |
| 33 | 3300009545 | Ga0105237_10000176 | Ga0105237_1000017625 | 236 |
| 34 | 3300009545 | Ga0105237_10049057 | Ga0105237_100490575 | 236 |
| 35 | 3300009551 | Ga0105238_10130224 | Ga0105238_101302243 | 236 |
| 36 | 3300009553 | Ga0105249_10879450 | Ga0105249_108794502 | 236 |
| 37 | 3300010375 | Ga0105239_10001693 | Ga0105239_1000169315 | 236 |
| 38 | 3300010375 | Ga0105239_10028378 | Ga0105239_100283783 | 236 |
| 39 | 3300013306 | Ga0163162_10000535 | Ga0163162_1000053511 | 236 |
| 40 | 3300025272 | Ga0209455_1003182 | Ga0209455_10031825 | 236 |
| 41 | 3300025913 | Ga0207695_10015351 | Ga0207695_100153516 | 236 |
| 42 | 3300025914 | Ga0207671_10000172 | Ga0207671_1000017286 | 236 |
| 43 | 3300025914 | Ga0207671_10063312 | Ga0207671_100633122 | 236 |
| 44 | 3300025929 | Ga0207664_10000501 | Ga0207664_100005015 | 236 |
| 45 | 3300026078 | Ga0207702_10039537 | Ga0207702_100395372 | 236 |
| 46 | 3300047443 | Ga0495687_023321 | Ga0495687_023321_81_791 | 236 |
| 47 | 3300049459 | Ga0495678_012209 | Ga0495678_012209_333_1043 | 236 |
| 48 | 3300049672 | Ga0501239_008630 | Ga0501239_008630_258_1004 | 236 |
| 49 | 3300053122 | Ga0500608_002770 | Ga0500608_002770_1283_1993 | 236 |
| 50 | 3300003320 | rootH2_10234768 | rootH2_102347681 | 237 |
| 51 | 3300005618 | Ga0068864_100087696 | Ga0068864_1000876963 | 238 |
| 52 | 3300009545 | Ga0105237_10418478 | Ga0105237_104184781 | 238 |
| 53 | 3300009553 | Ga0105249_10013964 | Ga0105249_100139648 | 238 |
| 54 | 3300013104 | Ga0157370_10149237 | Ga0157370_101492371 | 238 |
| 55 | 3300014325 | Ga0163163_10256119 | Ga0163163_102561192 | 238 |
| 56 | 3300025914 | Ga0207671_10001997 | Ga0207671_1000199713 | 238 |
| 57 | 3300031548 | Ga0307408_100086688 | Ga0307408_1000866882 | 238 |
| 58 | 3300031731 | Ga0307405_10079763 | Ga0307405_100797632 | 238 |
| 59 | 3300031824 | Ga0307413_10021370 | Ga0307413_100213703 | 238 |
| 60 | 3300032002 | Ga0307416_100026082 | Ga0307416_1000260826 | 238 |
| 61 | 3300049521 | Ga0501298_013446 | Ga0501298_013446_11_739 | 238 |
| 62 | 3300049650 | Ga0501199_002791 | Ga0501199_002791_11_739 | 238 |
| 63 | 3300049652 | Ga0501202_002075 | Ga0501202_002075_1143_1871 | 238 |
| 64 | 3300049656 | Ga0501209_027106 | Ga0501209_027106_151_879 | 238 |
| 65 | 3300049663 | Ga0501223_004436 | Ga0501223_004436_1175_1903 | 238 |
| 66 | 3300049668 | Ga0501233_034144 | Ga0501233_034144_145_873 | 238 |
| 67 | 3300049686 | Ga0501257_027341 | Ga0501257_027341_236_964 | 238 |
| 68 | 3300049704 | Ga0501221_001645 | Ga0501221_001645_1021_1749 | 238 |
| 69 | 3300049705 | Ga0501225_0008606 | Ga0501225_0008606_967_1695 | 238 |
| 70 | 3300049707 | Ga0501234_002797 | Ga0501234_002797_618_1346 | 238 |
| 71 | 3300049708 | Ga0501245_004622 | Ga0501245_004622_1094_1822 | 238 |
| 72 | 3300049763 | Ga0501266_013306 | Ga0501266_013306_186_914 | 238 |
| 73 | 3300014969 | Ga0157376_10848003 | Ga0157376_108480031 | 239 |
| 74 | 3300031727 | Ga0316576_10005467 | Ga0316576_100054672 | 239 |
| 75 | 3300031728 | Ga0316578_10064318 | Ga0316578_100643182 | 239 |
| 76 | 3300036647 | Ga0316582_0260552 | Ga0316582_0260552_256_978 | 239 |
| 77 | 3300036712 | Ga0316584_0074183 | Ga0316584_0074183_1784_2524 | 239 |
| 78 | 3300042876 | Ga0451577_0217415 | Ga0451577_0217415_40_771 | 239 |
| 79 | 3300044712 | Ga0453684_0174344 | Ga0453684_0174344_716_1447 | 239 |
| 80 | 3300003320 | rootH2_10202275 | rootH2_102022752 | 240 |
| 81 | 3300003322 | rootL2_10013519 | rootL2_100135193 | 240 |
| 82 | 3300044712 | Ga0453684_0000256 | Ga0453684_0000256_198628_199380 | 240 |
| 83 | 3300003322 | rootL2_10087964 | rootL2_100879642 | 241 |
| 84 | 3300005328 | Ga0070676_10384447 | Ga0070676_103844471 | 241 |
| 85 | 3300005334 | Ga0068869_100066797 | Ga0068869_1000667973 | 241 |
| 86 | 3300005459 | Ga0068867_100012692 | Ga0068867_1000126922 | 241 |
| 87 | 3300005530 | Ga0070679_100048260 | Ga0070679_1000482602 | 241 |
| 88 | 3300005616 | Ga0068852_100287747 | Ga0068852_1002877472 | 241 |
| 89 | 3300005718 | Ga0068866_10014277 | Ga0068866_100142772 | 241 |
| 90 | 3300005843 | Ga0068860_100056608 | Ga0068860_1000566084 | 241 |
| 91 | 3300006881 | Ga0068865_100259209 | Ga0068865_1002592092 | 241 |
| 92 | 3300009176 | Ga0105242_10344692 | Ga0105242_103446921 | 241 |
| 93 | 3300025907 | Ga0207645_10297357 | Ga0207645_102973572 | 241 |
| 94 | 3300025940 | Ga0207691_10525389 | Ga0207691_105253891 | 241 |
| 95 | 3300025942 | Ga0207689_10075274 | Ga0207689_100752743 | 241 |
| 96 | 3300026089 | Ga0207648_10000394 | Ga0207648_100003945 | 241 |
| 97 | 3300028380 | Ga0268265_10160700 | Ga0268265_101607003 | 241 |
| 98 | 3300028381 | Ga0268264_10050736 | Ga0268264_100507364 | 241 |
| 99 | 3300035115 | Ga0373941_0003580 | Ga0373941_0003580_2656_3381 | 241 |
| 100 | 3300053153 | Ga0500616_0055590 | Ga0500616_0055590_869_1600 | 241 |
| 101 | 3300003322 | rootL2_10040286 | rootL2_100402868 | 242 |
| 102 | 3300003323 | rootH1_10024356 | rootH1_1002435614 | 242 |
| 103 | 3300005289 | Ga0065704_10125251 | Ga0065704_101252512 | 242 |
| 104 | 3300005295 | Ga0065707_10172990 | Ga0065707_101729901 | 242 |
| 105 | 3300005329 | Ga0070683_100020132 | Ga0070683_1000201325 | 242 |
| 106 | 3300005347 | Ga0070668_100065466 | Ga0070668_1000654664 | 242 |
| 107 | 3300005355 | Ga0070671_100183658 | Ga0070671_1001836582 | 242 |
| 108 | 3300005456 | Ga0070678_100568609 | Ga0070678_1005686091 | 242 |
| 109 | 3300005459 | Ga0068867_100028134 | Ga0068867_1000281345 | 242 |
| 110 | 3300005564 | Ga0070664_100011463 | Ga0070664_1000114635 | 242 |
| 111 | 3300005718 | Ga0068866_10193404 | Ga0068866_101934041 | 242 |
| 112 | 3300005841 | Ga0068863_100117720 | Ga0068863_1001177203 | 242 |
| 113 | 3300005843 | Ga0068860_100009781 | Ga0068860_1000097817 | 242 |
| 114 | 3300006195 | Ga0075366_10002297 | Ga0075366_100022979 | 242 |
| 115 | 3300009148 | Ga0105243_10072179 | Ga0105243_100721793 | 242 |
| 116 | 3300009176 | Ga0105242_10027558 | Ga0105242_100275583 | 242 |
| 117 | 3300013296 | Ga0157374_10222604 | Ga0157374_102226041 | 242 |
| 118 | 3300025899 | Ga0207642_10147343 | Ga0207642_101473431 | 242 |
| 119 | 3300025907 | Ga0207645_10343771 | Ga0207645_103437711 | 242 |
| 120 | 3300025934 | Ga0207686_10133245 | Ga0207686_101332452 | 242 |
| 121 | 3300025972 | Ga0207668_10021774 | Ga0207668_100217742 | 242 |
| 122 | 3300026088 | Ga0207641_10142844 | Ga0207641_101428442 | 242 |
| 123 | 3300026089 | Ga0207648_10250811 | Ga0207648_102508112 | 242 |
| 124 | 3300026142 | Ga0207698_10386653 | Ga0207698_103866532 | 242 |
| 125 | 3300028381 | Ga0268264_10006942 | Ga0268264_100069427 | 242 |
| 126 | 3300044658 | Ga0466972_0000007 | Ga0466972_0000007_21998_22729 | 242 |
| 127 | 3300044673 | Ga0453683_0000139 | Ga0453683_0000139_31003_31734 | 242 |
| 128 | 3300044712 | Ga0453684_0637302 | Ga0453684_0637302_385_1116 | 242 |
| 129 | 3300046558 | Ga0495633_0000167 | Ga0495633_0000167_13633_14361 | 242 |
| 130 | 3300048903 | Ga0496100_0020346 | Ga0496100_0020346_1817_2614 | 242 |
| 131 | 3300048910 | Ga0496107_0017233 | Ga0496107_0017233_1608_2402 | 242 |
| 132 | 3300049568 | Ga0501031_0104397 | Ga0501031_0104397_552_1319 | 242 |
| 133 | 3300049569 | Ga0501032_0034630 | Ga0501032_0034630_1582_2349 | 242 |
| 134 | 3300049571 | Ga0501034_0130307 | Ga0501034_0130307_1561_2328 | 242 |
| 135 | 3300049574 | Ga0501038_0012080 | Ga0501038_0012080_1318_2085 | 242 |
| 136 | 3300049575 | Ga0501039_0029553 | Ga0501039_0029553_31_798 | 242 |
| 137 | 3300049580 | Ga0501046_0030308 | Ga0501046_0030308_3486_4253 | 242 |
| 138 | 3300049582 | Ga0501048_0087480 | Ga0501048_0087480_82_849 | 242 |
| 139 | 3300049583 | Ga0501067_0018261 | Ga0501067_0018261_300_1067 | 242 |
| 140 | 3300049584 | Ga0501068_0014361 | Ga0501068_0014361_3354_4121 | 242 |
| 141 | 3300049586 | Ga0501070_0109113 | Ga0501070_0109113_1275_2042 | 242 |
| 142 | 3300049588 | Ga0501072_0233991 | Ga0501072_0233991_141_908 | 242 |
| 143 | 3300049589 | Ga0501073_0013517 | Ga0501073_0013517_245_1012 | 242 |
| 144 | 3300049590 | Ga0501074_0017043 | Ga0501074_0017043_3120_3887 | 242 |
| 145 | 3300049670 | Ga0501236_001070 | Ga0501236_001070_1369_2097 | 242 |
| 146 | 3300049744 | Ga0501083_0030741 | Ga0501083_0030741_1229_1996 | 242 |
| 147 | 3300049761 | Ga0501264_000865 | Ga0501264_000865_741_1469 | 242 |
| 148 | 3300050493 | nmdc:mga0k408_177_c3 | nmdc:mga0k408_177_c3_1455_2183 | 242 |
| 149 | 3300002459 | JGI24751J29686_10000296 | JGI24751J29686_1000029613 | 243 |
| 150 | 3300003322 | rootL2_10049588 | rootL2_100495883 | 243 |
| 151 | 3300003322 | rootL2_10305785 | rootL2_103057851 | 243 |
| 152 | 3300003323 | rootH1_10278093 | rootH1_102780932 | 243 |
| 153 | 3300005293 | Ga0065715_10119774 | Ga0065715_101197742 | 243 |
| 154 | 3300005327 | Ga0070658_10112149 | Ga0070658_101121493 | 243 |
| 155 | 3300005327 | Ga0070658_10130252 | Ga0070658_101302521 | 243 |
| 156 | 3300005327 | Ga0070658_10173283 | Ga0070658_101732833 | 243 |
| 157 | 3300005329 | Ga0070683_100000369 | Ga0070683_10000036921 | 243 |
| 158 | 3300005329 | Ga0070683_100502883 | Ga0070683_1005028832 | 243 |
| 159 | 3300005330 | Ga0070690_100006820 | Ga0070690_1000068202 | 243 |
| 160 | 3300005331 | Ga0070670_100001499 | Ga0070670_10000149913 | 243 |
| 161 | 3300005331 | Ga0070670_100040947 | Ga0070670_1000409474 | 243 |
| 162 | 3300005331 | Ga0070670_100191099 | Ga0070670_1001910992 | 243 |
| 163 | 3300005331 | Ga0070670_100413172 | Ga0070670_1004131721 | 243 |
| 164 | 3300005334 | Ga0068869_100230197 | Ga0068869_1002301971 | 243 |
| 165 | 3300005337 | Ga0070682_100019814 | Ga0070682_1000198142 | 243 |
| 166 | 3300005337 | Ga0070682_100042571 | Ga0070682_1000425714 | 243 |
| 167 | 3300005338 | Ga0068868_100946825 | Ga0068868_1009468251 | 243 |
| 168 | 3300005340 | Ga0070689_100065606 | Ga0070689_1000656063 | 243 |
| 169 | 3300005343 | Ga0070687_100005111 | Ga0070687_1000051114 | 243 |
| 170 | 3300005344 | Ga0070661_100002729 | Ga0070661_10000272911 | 243 |
| 171 | 3300005345 | Ga0070692_10008616 | Ga0070692_100086167 | 243 |
| 172 | 3300005353 | Ga0070669_100071498 | Ga0070669_1000714983 | 243 |
| 173 | 3300005353 | Ga0070669_100367514 | Ga0070669_1003675141 | 243 |
| 174 | 3300005354 | Ga0070675_100026841 | Ga0070675_1000268413 | 243 |
| 175 | 3300005355 | Ga0070671_100207988 | Ga0070671_1002079884 | 243 |
| 176 | 3300005356 | Ga0070674_100048772 | Ga0070674_1000487722 | 243 |
| 177 | 3300005364 | Ga0070673_100035190 | Ga0070673_1000351902 | 243 |
| 178 | 3300005364 | Ga0070673_100098390 | Ga0070673_1000983902 | 243 |
| 179 | 3300005365 | Ga0070688_100016767 | Ga0070688_1000167672 | 243 |
| 180 | 3300005366 | Ga0070659_100000542 | Ga0070659_1000005428 | 243 |
| 181 | 3300005366 | Ga0070659_100002724 | Ga0070659_10000272412 | 243 |
| 182 | 3300005367 | Ga0070667_100024409 | Ga0070667_1000244091 | 243 |
| 183 | 3300005440 | Ga0070705_100004849 | Ga0070705_1000048496 | 243 |
| 184 | 3300005444 | Ga0070694_100004601 | Ga0070694_1000046015 | 243 |
| 185 | 3300005444 | Ga0070694_100029789 | Ga0070694_1000297892 | 243 |
| 186 | 3300005456 | Ga0070678_100133942 | Ga0070678_1001339422 | 243 |
| 187 | 3300005456 | Ga0070678_100405459 | Ga0070678_1004054591 | 243 |
| 188 | 3300005457 | Ga0070662_100389263 | Ga0070662_1003892632 | 243 |
| 189 | 3300005459 | Ga0068867_100012940 | Ga0068867_1000129401 | 243 |
| 190 | 3300005459 | Ga0068867_100074772 | Ga0068867_1000747722 | 243 |
| 191 | 3300005471 | Ga0070698_100023649 | Ga0070698_1000236495 | 243 |
| 192 | 3300005530 | Ga0070679_100036518 | Ga0070679_1000365184 | 243 |
| 193 | 3300005530 | Ga0070679_100196143 | Ga0070679_1001961432 | 243 |
| 194 | 3300005535 | Ga0070684_100001473 | Ga0070684_10000147317 | 243 |
| 195 | 3300005535 | Ga0070684_100386574 | Ga0070684_1003865742 | 243 |
| 196 | 3300005544 | Ga0070686_100008908 | Ga0070686_1000089085 | 243 |
| 197 | 3300005545 | Ga0070695_100157544 | Ga0070695_1001575441 | 243 |
| 198 | 3300005547 | Ga0070693_100007482 | Ga0070693_10000748210 | 243 |
| 199 | 3300005549 | Ga0070704_100036985 | Ga0070704_1000369854 | 243 |
| 200 | 3300005549 | Ga0070704_100147095 | Ga0070704_1001470952 | 243 |
| 201 | 3300005549 | Ga0070704_100555364 | Ga0070704_1005553641 | 243 |
| 202 | 3300005564 | Ga0070664_100000744 | Ga0070664_1000007442 | 243 |
| 203 | 3300005564 | Ga0070664_100030222 | Ga0070664_1000302226 | 243 |
| 204 | 3300005564 | Ga0070664_100260382 | Ga0070664_1002603821 | 243 |
| 205 | 3300005564 | Ga0070664_100616073 | Ga0070664_1006160732 | 243 |
| 206 | 3300005577 | Ga0068857_100001073 | Ga0068857_10000107314 | 243 |
| 207 | 3300005577 | Ga0068857_100222988 | Ga0068857_1002229882 | 243 |
| 208 | 3300005577 | Ga0068857_100682415 | Ga0068857_1006824151 | 243 |
| 209 | 3300005578 | Ga0068854_100083273 | Ga0068854_1000832733 | 243 |
| 210 | 3300005615 | Ga0070702_100004452 | Ga0070702_1000044526 | 243 |
| 211 | 3300005616 | Ga0068852_100319687 | Ga0068852_1003196872 | 243 |
| 212 | 3300005616 | Ga0068852_100394259 | Ga0068852_1003942592 | 243 |
| 213 | 3300005617 | Ga0068859_100020344 | Ga0068859_1000203442 | 243 |
| 214 | 3300005617 | Ga0068859_100035757 | Ga0068859_1000357577 | 243 |
| 215 | 3300005617 | Ga0068859_100152280 | Ga0068859_1001522803 | 243 |
| 216 | 3300005617 | Ga0068859_100158655 | Ga0068859_1001586551 | 243 |
| 217 | 3300005617 | Ga0068859_100163855 | Ga0068859_1001638552 | 243 |
| 218 | 3300005617 | Ga0068859_100405648 | Ga0068859_1004056482 | 243 |
| 219 | 3300005617 | Ga0068859_100584248 | Ga0068859_1005842481 | 243 |
| 220 | 3300005618 | Ga0068864_100046716 | Ga0068864_1000467165 | 243 |
| 221 | 3300005618 | Ga0068864_100071525 | Ga0068864_1000715252 | 243 |
| 222 | 3300005618 | Ga0068864_100229109 | Ga0068864_1002291091 | 243 |
| 223 | 3300005719 | Ga0068861_100031415 | Ga0068861_1000314152 | 243 |
| 224 | 3300005719 | Ga0068861_100118101 | Ga0068861_1001181012 | 243 |
| 225 | 3300005834 | Ga0068851_10003512 | Ga0068851_100035124 | 243 |
| 226 | 3300005840 | Ga0068870_10018128 | Ga0068870_100181282 | 243 |
| 227 | 3300005842 | Ga0068858_100260258 | Ga0068858_1002602582 | 243 |
| 228 | 3300005842 | Ga0068858_100358986 | Ga0068858_1003589862 | 243 |
| 229 | 3300005843 | Ga0068860_100018513 | Ga0068860_1000185135 | 243 |
| 230 | 3300005843 | Ga0068860_100026526 | Ga0068860_1000265262 | 243 |
| 231 | 3300005844 | Ga0068862_100015469 | Ga0068862_1000154692 | 243 |
| 232 | 3300005844 | Ga0068862_100044734 | Ga0068862_1000447344 | 243 |
| 233 | 3300005844 | Ga0068862_100606084 | Ga0068862_1006060842 | 243 |
| 234 | 3300005985 | Ga0081539_10018276 | Ga0081539_100182764 | 243 |
| 235 | 3300006195 | Ga0075366_10008021 | Ga0075366_100080213 | 243 |
| 236 | 3300006237 | Ga0097621_100021765 | Ga0097621_1000217653 | 243 |
| 237 | 3300006237 | Ga0097621_100707633 | Ga0097621_1007076331 | 243 |
| 238 | 3300006358 | Ga0068871_100032048 | Ga0068871_1000320483 | 243 |
| 239 | 3300006881 | Ga0068865_100113517 | Ga0068865_1001135173 | 243 |
| 240 | 3300006881 | Ga0068865_100349537 | Ga0068865_1003495372 | 243 |
| 241 | 3300006931 | Ga0097620_100020344 | Ga0097620_1000203446 | 243 |
| 242 | 3300006931 | Ga0097620_100035756 | Ga0097620_1000357562 | 243 |
| 243 | 3300006931 | Ga0097620_100146141 | Ga0097620_1001461413 | 243 |
| 244 | 3300006931 | Ga0097620_100152280 | Ga0097620_1001522803 | 243 |
| 245 | 3300006931 | Ga0097620_100158644 | Ga0097620_1001586442 | 243 |
| 246 | 3300006931 | Ga0097620_100163845 | Ga0097620_1001638452 | 243 |
| 247 | 3300006931 | Ga0097620_100405620 | Ga0097620_1004056202 | 243 |
| 248 | 3300006931 | Ga0097620_100584208 | Ga0097620_1005842081 | 243 |
| 249 | 3300009094 | Ga0111539_10095585 | Ga0111539_100955852 | 243 |
| 250 | 3300009101 | Ga0105247_10025441 | Ga0105247_100254412 | 243 |
| 251 | 3300009148 | Ga0105243_10677873 | Ga0105243_106778731 | 243 |
| 252 | 3300009176 | Ga0105242_10159032 | Ga0105242_101590321 | 243 |
| 253 | 3300009545 | Ga0105237_10000056 | Ga0105237_1000005655 | 243 |
| 254 | 3300009545 | Ga0105237_10002520 | Ga0105237_1000252012 | 243 |
| 255 | 3300009551 | Ga0105238_10010374 | Ga0105238_100103742 | 243 |
| 256 | 3300009553 | Ga0105249_10017914 | Ga0105249_100179144 | 243 |
| 257 | 3300009553 | Ga0105249_10018429 | Ga0105249_100184294 | 243 |
| 258 | 3300010375 | Ga0105239_10204296 | Ga0105239_102042962 | 243 |
| 259 | 3300011119 | Ga0105246_10114326 | Ga0105246_101143262 | 243 |
| 260 | 3300013100 | Ga0157373_10178052 | Ga0157373_101780521 | 243 |
| 261 | 3300013297 | Ga0157378_10001986 | Ga0157378_1000198615 | 243 |
| 262 | 3300013297 | Ga0157378_10019929 | Ga0157378_100199293 | 243 |
| 263 | 3300013297 | Ga0157378_10106410 | Ga0157378_101064102 | 243 |
| 264 | 3300013297 | Ga0157378_10124137 | Ga0157378_101241373 | 243 |
| 265 | 3300013297 | Ga0157378_10182880 | Ga0157378_101828801 | 243 |
| 266 | 3300013306 | Ga0163162_10031920 | Ga0163162_100319202 | 243 |
| 267 | 3300013306 | Ga0163162_10095635 | Ga0163162_100956353 | 243 |
| 268 | 3300013306 | Ga0163162_10108006 | Ga0163162_101080062 | 243 |
| 269 | 3300013306 | Ga0163162_10291654 | Ga0163162_102916542 | 243 |
| 270 | 3300013306 | Ga0163162_10313448 | Ga0163162_103134482 | 243 |
| 271 | 3300013307 | Ga0157372_10753343 | Ga0157372_107533432 | 243 |
| 272 | 3300013307 | Ga0157372_10919294 | Ga0157372_109192941 | 243 |
| 273 | 3300014325 | Ga0163163_10001643 | Ga0163163_1000164312 | 243 |
| 274 | 3300014325 | Ga0163163_10001884 | Ga0163163_100018842 | 243 |
| 275 | 3300014326 | Ga0157380_10004292 | Ga0157380_100042925 | 243 |
| 276 | 3300014326 | Ga0157380_10006281 | Ga0157380_100062813 | 243 |
| 277 | 3300014326 | Ga0157380_10068990 | Ga0157380_100689902 | 243 |
| 278 | 3300014326 | Ga0157380_10079598 | Ga0157380_100795982 | 243 |
| 279 | 3300014745 | Ga0157377_10015183 | Ga0157377_100151832 | 243 |
| 280 | 3300014968 | Ga0157379_10181727 | Ga0157379_101817272 | 243 |
| 281 | 3300014968 | Ga0157379_10325244 | Ga0157379_103252441 | 243 |
| 282 | 3300017792 | Ga0163161_10236037 | Ga0163161_102360371 | 243 |
| 283 | 3300021384 | Ga0213876_10000206 | Ga0213876_1000020643 | 243 |
| 284 | 3300025315 | Ga0207697_10013031 | Ga0207697_100130312 | 243 |
| 285 | 3300025885 | Ga0207653_10013461 | Ga0207653_100134611 | 243 |
| 286 | 3300025901 | Ga0207688_10045869 | Ga0207688_100458693 | 243 |
| 287 | 3300025901 | Ga0207688_10227463 | Ga0207688_102274631 | 243 |
| 288 | 3300025904 | Ga0207647_10035789 | Ga0207647_100357892 | 243 |
| 289 | 3300025907 | Ga0207645_10029275 | Ga0207645_100292752 | 243 |
| 290 | 3300025908 | Ga0207643_10013053 | Ga0207643_100130533 | 243 |
| 291 | 3300025908 | Ga0207643_10128911 | Ga0207643_101289112 | 243 |
| 292 | 3300025909 | Ga0207705_10088856 | Ga0207705_100888564 | 243 |
| 293 | 3300025909 | Ga0207705_10191787 | Ga0207705_101917872 | 243 |
| 294 | 3300025914 | Ga0207671_10001166 | Ga0207671_1000116626 | 243 |
| 295 | 3300025914 | Ga0207671_10003766 | Ga0207671_100037668 | 243 |
| 296 | 3300025918 | Ga0207662_10007822 | Ga0207662_100078224 | 243 |
| 297 | 3300025918 | Ga0207662_10039893 | Ga0207662_100398932 | 243 |
| 298 | 3300025920 | Ga0207649_10001318 | Ga0207649_100013185 | 243 |
| 299 | 3300025921 | Ga0207652_10187642 | Ga0207652_101876422 | 243 |
| 300 | 3300025923 | Ga0207681_10520113 | Ga0207681_105201131 | 243 |
| 301 | 3300025924 | Ga0207694_10121612 | Ga0207694_101216122 | 243 |
| 302 | 3300025925 | Ga0207650_10000005 | Ga0207650_10000005477 | 243 |
| 303 | 3300025925 | Ga0207650_10007263 | Ga0207650_100072639 | 243 |
| 304 | 3300025925 | Ga0207650_10103282 | Ga0207650_101032822 | 243 |
| 305 | 3300025931 | Ga0207644_10026019 | Ga0207644_100260194 | 243 |
| 306 | 3300025932 | Ga0207690_10000668 | Ga0207690_100006684 | 243 |
| 307 | 3300025932 | Ga0207690_10002344 | Ga0207690_1000234410 | 243 |
| 308 | 3300025933 | Ga0207706_10178010 | Ga0207706_101780102 | 243 |
| 309 | 3300025933 | Ga0207706_10216238 | Ga0207706_102162382 | 243 |
| 310 | 3300025941 | Ga0207711_10063278 | Ga0207711_100632781 | 243 |
| 311 | 3300025941 | Ga0207711_10107708 | Ga0207711_101077082 | 243 |
| 312 | 3300025941 | Ga0207711_10235168 | Ga0207711_102351682 | 243 |
| 313 | 3300025942 | Ga0207689_10016707 | Ga0207689_100167076 | 243 |
| 314 | 3300025942 | Ga0207689_10076584 | Ga0207689_100765842 | 243 |
| 315 | 3300025942 | Ga0207689_10346500 | Ga0207689_103465002 | 243 |
| 316 | 3300025944 | Ga0207661_10001242 | Ga0207661_100012422 | 243 |
| 317 | 3300025944 | Ga0207661_10084543 | Ga0207661_100845433 | 243 |
| 318 | 3300025945 | Ga0207679_10000182 | Ga0207679_1000018223 | 243 |
| 319 | 3300025945 | Ga0207679_10091067 | Ga0207679_100910672 | 243 |
| 320 | 3300025945 | Ga0207679_10358170 | Ga0207679_103581701 | 243 |
| 321 | 3300025945 | Ga0207679_10561684 | Ga0207679_105616841 | 243 |
| 322 | 3300025960 | Ga0207651_10147865 | Ga0207651_101478652 | 243 |
| 323 | 3300025960 | Ga0207651_10185545 | Ga0207651_101855454 | 243 |
| 324 | 3300025960 | Ga0207651_10268002 | Ga0207651_102680022 | 243 |
| 325 | 3300025961 | Ga0207712_10001780 | Ga0207712_100017804 | 243 |
| 326 | 3300025961 | Ga0207712_10064142 | Ga0207712_100641423 | 243 |
| 327 | 3300025986 | Ga0207658_10010211 | Ga0207658_100102115 | 243 |
| 328 | 3300026023 | Ga0207677_10399599 | Ga0207677_103995992 | 243 |
| 329 | 3300026035 | Ga0207703_10067585 | Ga0207703_100675852 | 243 |
| 330 | 3300026035 | Ga0207703_10192229 | Ga0207703_101922295 | 243 |
| 331 | 3300026035 | Ga0207703_10201586 | Ga0207703_102015861 | 243 |
| 332 | 3300026041 | Ga0207639_10322572 | Ga0207639_103225723 | 243 |
| 333 | 3300026067 | Ga0207678_10051879 | Ga0207678_100518794 | 243 |
| 334 | 3300026075 | Ga0207708_10303609 | Ga0207708_103036091 | 243 |
| 335 | 3300026075 | Ga0207708_10430617 | Ga0207708_104306171 | 243 |
| 336 | 3300026088 | Ga0207641_10221250 | Ga0207641_102212502 | 243 |
| 337 | 3300026089 | Ga0207648_10014563 | Ga0207648_100145634 | 243 |
| 338 | 3300026089 | Ga0207648_10019162 | Ga0207648_100191622 | 243 |
| 339 | 3300026089 | Ga0207648_10147497 | Ga0207648_101474972 | 243 |
| 340 | 3300026089 | Ga0207648_10159667 | Ga0207648_101596671 | 243 |
| 341 | 3300026089 | Ga0207648_10715064 | Ga0207648_107150641 | 243 |
| 342 | 3300026095 | Ga0207676_10068704 | Ga0207676_100687043 | 243 |
| 343 | 3300026095 | Ga0207676_10408303 | Ga0207676_104083032 | 243 |
| 344 | 3300026095 | Ga0207676_10647707 | Ga0207676_106477071 | 243 |
| 345 | 3300026116 | Ga0207674_10003912 | Ga0207674_100039127 | 243 |
| 346 | 3300026116 | Ga0207674_10008888 | Ga0207674_100088882 | 243 |
| 347 | 3300026116 | Ga0207674_10053054 | Ga0207674_100530543 | 243 |
| 348 | 3300026116 | Ga0207674_10401895 | Ga0207674_104018952 | 243 |
| 349 | 3300026118 | Ga0207675_100000820 | Ga0207675_10000082017 | 243 |
| 350 | 3300026118 | Ga0207675_100023593 | Ga0207675_1000235938 | 243 |
| 351 | 3300026118 | Ga0207675_100032380 | Ga0207675_1000323804 | 243 |
| 352 | 3300026118 | Ga0207675_100198262 | Ga0207675_1001982622 | 243 |
| 353 | 3300026118 | Ga0207675_100225015 | Ga0207675_1002250151 | 243 |
| 354 | 3300026121 | Ga0207683_10032094 | Ga0207683_100320943 | 243 |
| 355 | 3300026121 | Ga0207683_10056097 | Ga0207683_100560975 | 243 |
| 356 | 3300026142 | Ga0207698_10265581 | Ga0207698_102655812 | 243 |
| 357 | 3300026142 | Ga0207698_10726253 | Ga0207698_107262531 | 243 |
| 358 | 3300028380 | Ga0268265_10031033 | Ga0268265_100310332 | 243 |
| 359 | 3300028380 | Ga0268265_10254718 | Ga0268265_102547182 | 243 |
| 360 | 3300028380 | Ga0268265_10717617 | Ga0268265_107176171 | 243 |
| 361 | 3300028381 | Ga0268264_10025826 | Ga0268264_100258264 | 243 |
| 362 | 3300028381 | Ga0268264_10085240 | Ga0268264_100852404 | 243 |
| 363 | 3300028794 | Ga0307515_10000300 | Ga0307515_1000030043 | 243 |
| 364 | 3300030742 | Ga0316183_1086246 | Ga0316183_108624628 | 243 |
| 365 | 3300030744 | Ga0316181_1280322 | Ga0316181_128032220 | 243 |
| 366 | 3300031344 | Ga0265316_10055693 | Ga0265316_100556931 | 243 |
| 367 | 3300031852 | Ga0307410_10014549 | Ga0307410_100145495 | 243 |
| 368 | 3300031901 | Ga0307406_10048290 | Ga0307406_100482902 | 243 |
| 369 | 3300031911 | Ga0307412_10014697 | Ga0307412_100146975 | 243 |
| 370 | 3300031995 | Ga0307409_100042540 | Ga0307409_1000425402 | 243 |
| 371 | 3300031995 | Ga0307409_100395884 | Ga0307409_1003958842 | 243 |
| 372 | 3300032005 | Ga0307411_10014316 | Ga0307411_100143164 | 243 |
| 373 | 3300035115 | Ga0373941_0021717 | Ga0373941_0021717_150_896 | 243 |
| 374 | 3300035398 | Ga0316574_0383774 | Ga0316574_0383774_77_811 | 243 |
| 375 | 3300035695 | Ga0373927_0312547 | Ga0373927_0312547_230_961 | 243 |
| 376 | 3300039437 | Ga0436365_0880687 | Ga0436365_0880687_2337_3068 | 243 |
| 377 | 3300041404 | Ga0439436_0025789 | Ga0439436_0025789_593_1327 | 243 |
| 378 | 3300042007 | Ga0439449_0013498 | Ga0439449_0013498_2299_3033 | 243 |
| 379 | 3300042014 | Ga0439457_034118 | Ga0439457_034118_104_838 | 243 |
| 380 | 3300044712 | Ga0453684_0934220 | Ga0453684_0934220_96_836 | 243 |
| 381 | 3300046507 | Ga0495606_0007762 | Ga0495606_0007762_5418_6152 | 243 |
| 382 | 3300046616 | Ga0495668_0079160 | Ga0495668_0079160_63_794 | 243 |
| 383 | 3300047472 | Ga0495686_0000607 | Ga0495686_0000607_47814_48548 | 243 |
| 384 | 3300048903 | Ga0496100_0088594 | Ga0496100_0088594_504_1262 | 243 |
| 385 | 3300049519 | Ga0501296_014953 | Ga0501296_014953_35_811 | 243 |
| 386 | 3300049570 | Ga0501033_0045063 | Ga0501033_0045063_1292_2044 | 243 |
| 387 | 3300049571 | Ga0501034_0010869 | Ga0501034_0010869_7109_7861 | 243 |
| 388 | 3300049572 | Ga0501036_0115614 | Ga0501036_0115614_1114_1866 | 243 |
| 389 | 3300049573 | Ga0501037_0014266 | Ga0501037_0014266_258_1010 | 243 |
| 390 | 3300049575 | Ga0501039_0022435 | Ga0501039_0022435_2725_3477 | 243 |
| 391 | 3300049579 | Ga0501043_0192998 | Ga0501043_0192998_571_1323 | 243 |
| 392 | 3300049581 | Ga0501047_0034670 | Ga0501047_0034670_3234_3986 | 243 |
| 393 | 3300049650 | Ga0501199_006095 | Ga0501199_006095_12_788 | 243 |
| 394 | 3300049660 | Ga0501216_033775 | Ga0501216_033775_94_870 | 243 |
| 395 | 3300049661 | Ga0501217_011708 | Ga0501217_011708_508_1284 | 243 |
| 396 | 3300049664 | Ga0501224_005348 | Ga0501224_005348_985_1761 | 243 |
| 397 | 3300049665 | Ga0501227_009701 | Ga0501227_009701_614_1390 | 243 |
| 398 | 3300049667 | Ga0501230_009755 | Ga0501230_009755_428_1204 | 243 |
| 399 | 3300049668 | Ga0501233_017690 | Ga0501233_017690_242_1018 | 243 |
| 400 | 3300049669 | Ga0501235_006902 | Ga0501235_006902_86_862 | 243 |
| 401 | 3300049675 | Ga0501243_013385 | Ga0501243_013385_205_981 | 243 |
| 402 | 3300049685 | Ga0501256_003619 | Ga0501256_003619_227_1003 | 243 |
| 403 | 3300049686 | Ga0501257_007283 | Ga0501257_007283_1185_1961 | 243 |
| 404 | 3300049687 | Ga0501258_011299 | Ga0501258_011299_77_844 | 243 |
| 405 | 3300049705 | Ga0501225_0003020 | Ga0501225_0003020_1723_2454 | 243 |
| 406 | 3300049705 | Ga0501225_0014743 | Ga0501225_0014743_622_1398 | 243 |
| 407 | 3300049706 | Ga0501229_013963 | Ga0501229_013963_50_826 | 243 |
| 408 | 3300049770 | Ga0501273_000984 | Ga0501273_000984_222_998 | 243 |
| 409 | 3300049822 | Ga0501035_0035768 | Ga0501035_0035768_1328_2080 | 243 |
| 410 | 3300049823 | Ga0501044_0002454 | Ga0501044_0002454_1306_2058 | 243 |
| 411 | 3300049853 | Ga0501226_005308 | Ga0501226_005308_40_816 | 243 |
| 412 | 3300050511 | nmdc:mga08y16_75632_c1 | nmdc:mga08y16_75632_c1_1909_2643 | 243 |
| 413 | 3300053083 | Ga0495655_0023353 | Ga0495655_0023353_138_869 | 243 |
| 414 | 3300053092 | Ga0500583_0000334 | Ga0500583_0000334_12350_13084 | 243 |
| 415 | 3300053139 | Ga0500568_0001098 | Ga0500568_0001098_10870_11604 | 243 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3rd5-assembly1.cif.gz_A | crystal structure of a putative uncharacterized protein from mycobacterium paratuberculosis | 0.8466 | 1 | 243 |
| 5o98-assembly2.cif.gz_B | binary complex of catharanthus roseus vitrosamine synthase with nadp+ | 0.8465 | 2 | 216 |
| 1n5d-assembly1.cif.gz_A | crystal structure of porcine testicular carbonyl reductase/ 20beta-hydroxysteroid dehydrogenase | 0.8463 | 2 | 216 |
| 6rnw-assembly1.cif.gz_A | the crystal structure of thermosynechococcus elongatus protochlorophyllide oxidoreductase (por) in complex with nadp. | 0.8441 | 2 | 239 |
| 3rd5-assembly1.cif.gz_A | crystal structure of a putative uncharacterized protein from mycobacterium paratuberculosis | 0.8433 | 1 | 243 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9XVS9_38_332_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9058 | 2 | 239 | 3.40.50.720 |
| af_Q54NY5_29_328_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8866 | 2 | 239 | 3.40.50.720 |
| af_Q9XVS9_38_332_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8845 | 2 | 239 | 3.40.50.720 |
| af_Q9LDY7_24_316_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8823 | 2 | 239 | 3.40.50.720 |
| af_A0PJE2_34_316_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8816 | 3 | 239 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3G4I4-F1-model_v4 | deleted | 0.9982 | 1 | 101 |
|
| AF-A0A2P8G4T9-F1-model_v4 | Short-subunit dehydrogenase | 0.998 | 1 | 243 |
|
| AF-A0A5N7UXH5-F1-model_v4 | deleted | 0.9959 | 1 | 86 |
|
| AF-A0A2P8G4T9-F1-model_v4 | Short-subunit dehydrogenase | 0.9939 | 1 | 243 |
|
| AF-A0A4R2WC41-F1-model_v4 | deleted | 0.9937 | 1 | 243 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar