F438492

General Info

Members Datasets Scaffolds Average Seq Length
415 239 413 245

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100191099|Ga0070670_1001910992
Length 285
Sequence MKSRMARVFITGSADGLGQLSAKSLIEQGHKVALHSRNAERGHIAISKNPGAEAVFTGDLSNLVEIKNLANELNESGAFDAVIHNAGVYKVSASEIFTVNTLAPYILTCLIKKPGRLIYLSSGMHFHGRPKLDKFENGISHITYSDSKLHVLMLCMAVARKWADVYSNAVDPGWVPTKMGGRGAPDNLRQGYETQVWLAVSNDVHAKVTGSYFFHQKEKHHNPEADDVLLQERFLGLCHEITVLLFRNRIKTKSRLNFFKKRLLHFNAIADADQSSCIKVLVIQI

Samples

Sample ID Description Type Environment
1 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
2 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
141 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
142 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
143 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
146 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
156 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
157 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
158 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
159 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
160 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
161 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
162 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
163 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
164 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
165 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
166 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
167 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
168 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
169 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
170 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
171 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
172 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
173 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
174 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
181 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
182 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
183 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
184 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
197 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
198 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
203 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
204 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
205 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
206 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
207 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
208 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
209 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
210 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
211 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
212 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
213 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
214 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
215 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
216 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
217 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
218 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
219 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
220 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
221 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
222 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
223 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
224 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
225 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
226 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
227 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
228 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
231 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
232 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
233 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
234 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
235 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
236 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
237 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
238 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
239 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.52
Metatranscriptomes 0
Isolates 0.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.41
Nodule 0
Rhizoplane 1.45
Rhizosphere 93.01
Stem 0
Stem Tuber 0
Unclassified 3.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10000296 3300002459 Bacteria 18771
2 rootH2_10202275 3300003320 Bacteria 2683
3 rootH2_10234768 3300003320 Bacteria 1505
4 rootL2_10013519 3300003322 Bacteria 5073
5 rootL2_10040286 3300003322 Bacteria 11317
6 rootL2_10049588 3300003322 Bacteria 5241
7 rootL2_10087964 3300003322 Bacteria 2720
8 rootL2_10305785 3300003322 Bacteria 1250
9 rootH1_10024356 3300003323 Bacteria 19253
10 rootH1_10278093 3300003323 Bacteria 1686
11 Ga0065704_10125251 3300005289 Bacteria 1684
12 Ga0065715_10119774 3300005293 Bacteria 2277
13 Ga0065707_10172990 3300005295 Bacteria 1471
14 Ga0070658_10112149 3300005327 Unclassified 2260
15 Ga0070658_10130252 3300005327 Bacteria 2096
16 Ga0070658_10173283 3300005327 Bacteria 1813
17 Ga0070676_10384447 3300005328 Unclassified 973
18 Ga0070683_100000369 3300005329 Bacteria 31172
19 Ga0070683_100020132 3300005329 Bacteria 5935
20 Ga0070683_100502883 3300005329 Unclassified 1158
21 Ga0070690_100006820 3300005330 Bacteria 6496
22 Ga0070670_100001499 3300005331 Bacteria 18809
23 Ga0070670_100040947 3300005331 Bacteria 3982
24 Ga0070670_100191099 3300005331 Unclassified 1778
25 Ga0070670_100413172 3300005331 Bacteria 1192
26 Ga0068869_100066797 3300005334 Unclassified 2651
27 Ga0068869_100230197 3300005334 Bacteria 1472
28 Ga0070682_100019814 3300005337 Bacteria 3951
29 Ga0070682_100042571 3300005337 Bacteria 2804
30 Ga0068868_100946825 3300005338 Unclassified 785
31 Ga0070689_100065606 3300005340 Bacteria 2827
32 Ga0070687_100005111 3300005343 Bacteria 5289
33 Ga0070661_100002729 3300005344 Bacteria 12103
34 Ga0070661_100452281 3300005344 Bacteria 1022
35 Ga0070692_10008616 3300005345 Bacteria 4556
36 Ga0070668_100065466 3300005347 Bacteria 2819
37 Ga0070669_100071498 3300005353 Bacteria 2567
38 Ga0070669_100367514 3300005353 Bacteria 1171
39 Ga0070675_100026841 3300005354 Bacteria 4623
40 Ga0070671_100183658 3300005355 Bacteria 1771
41 Ga0070671_100207988 3300005355 Bacteria 1659
42 Ga0070671_100267872 3300005355 Unclassified 1452
43 Ga0070674_100048772 3300005356 Bacteria 2908
44 Ga0070673_100035190 3300005364 Bacteria 3795
45 Ga0070673_100098390 3300005364 Bacteria 2404
46 Ga0070688_100016767 3300005365 Bacteria 4193
47 Ga0070659_100000542 3300005366 Bacteria 27536
48 Ga0070659_100002724 3300005366 Bacteria 12569
49 Ga0070667_100024409 3300005367 Bacteria 5021
50 Ga0070667_100840440 3300005367 Bacteria 853
51 Ga0070714_100272531 3300005435 Bacteria 1570
52 Ga0070713_100148132 3300005436 Bacteria 2085
53 Ga0070710_10191364 3300005437 Bacteria 1287
54 Ga0070705_100004849 3300005440 Bacteria 6545
55 Ga0070694_100004601 3300005444 Bacteria 8298
56 Ga0070694_100029789 3300005444 Bacteria 3565
57 Ga0070678_100133942 3300005456 Bacteria 1973
58 Ga0070678_100405459 3300005456 Bacteria 1185
59 Ga0070678_100568609 3300005456 Bacteria 1008
60 Ga0070662_100389263 3300005457 Bacteria 1149
61 Ga0068867_100012692 3300005459 Bacteria 5959
62 Ga0068867_100012940 3300005459 Bacteria 5903
63 Ga0068867_100028134 3300005459 Bacteria 4045
64 Ga0068867_100074772 3300005459 Bacteria 2540
65 Ga0070698_100023649 3300005471 Bacteria 6420
66 Ga0070679_100036518 3300005530 Bacteria 4876
67 Ga0070679_100048260 3300005530 Bacteria 4243
68 Ga0070679_100196143 3300005530 Bacteria 1987
69 Ga0070684_100001473 3300005535 Bacteria 16983
70 Ga0070684_100023366 3300005535 Bacteria 5169
71 Ga0070684_100386574 3300005535 Bacteria 1289
72 Ga0070686_100008908 3300005544 Bacteria 5625
73 Ga0070695_100157544 3300005545 Bacteria 1591
74 Ga0070693_100007482 3300005547 Bacteria 5341
75 Ga0070693_100248533 3300005547 Unclassified 1178
76 Ga0070704_100036985 3300005549 Bacteria 3331
77 Ga0070704_100147095 3300005549 Bacteria 1848
78 Ga0070704_100555364 3300005549 Unclassified 1004
79 Ga0070664_100000744 3300005564 Bacteria 25104
80 Ga0070664_100011463 3300005564 Bacteria 7194
81 Ga0070664_100030222 3300005564 Bacteria 4519
82 Ga0070664_100260382 3300005564 Bacteria 1561
83 Ga0070664_100616073 3300005564 Unclassified 1007
84 Ga0068857_100001073 3300005577 Bacteria 21162
85 Ga0068857_100222988 3300005577 Bacteria 1722
86 Ga0068857_100682415 3300005577 Bacteria 975
87 Ga0068854_100083273 3300005578 Bacteria 2365
88 Ga0068856_100032315 3300005614 Bacteria 5123
89 Ga0070702_100004452 3300005615 Bacteria 6396
90 Ga0068852_100287747 3300005616 Bacteria 1586
91 Ga0068852_100319687 3300005616 Bacteria 1507
92 Ga0068852_100394259 3300005616 Bacteria 1360
93 Ga0068859_100000436 3300005617 Bacteria 41890
94 Ga0068859_100020344 3300005617 Bacteria 6662
95 Ga0068859_100035757 3300005617 Bacteria 4985
96 Ga0068859_100152280 3300005617 Bacteria 2388
97 Ga0068859_100158655 3300005617 Bacteria 2341
98 Ga0068859_100163855 3300005617 Bacteria 2302
99 Ga0068859_100405648 3300005617 Bacteria 1459
100 Ga0068859_100584248 3300005617 Bacteria 1211
101 Ga0068864_100046716 3300005618 Bacteria 3716
102 Ga0068864_100071525 3300005618 Unclassified 3021
103 Ga0068864_100087696 3300005618 Bacteria 2740
104 Ga0068864_100229109 3300005618 Bacteria 1718
105 Ga0068866_10014277 3300005718 Unclassified 3504
106 Ga0068866_10193404 3300005718 Bacteria 1210
107 Ga0068861_100031415 3300005719 Bacteria 3902
108 Ga0068861_100118101 3300005719 Bacteria 2136
109 Ga0068851_10003512 3300005834 Bacteria 6977
110 Ga0068870_10018128 3300005840 Bacteria 3394
111 Ga0068863_100117720 3300005841 Bacteria 2532
112 Ga0068858_100000316 3300005842 Bacteria 51458
113 Ga0068858_100260258 3300005842 Bacteria 1649
114 Ga0068858_100358986 3300005842 Bacteria 1396
115 Ga0068860_100009781 3300005843 Bacteria 9521
116 Ga0068860_100018513 3300005843 Bacteria 6774
117 Ga0068860_100026526 3300005843 Bacteria 5584
118 Ga0068860_100056608 3300005843 Bacteria 3727
119 Ga0068862_100015469 3300005844 Bacteria 6337
120 Ga0068862_100044734 3300005844 Bacteria 3776
121 Ga0068862_100606084 3300005844 Unclassified 1052
122 Ga0081539_10018276 3300005985 Unclassified 4873
123 Ga0075366_10002297 3300006195 Bacteria 9763
124 Ga0075366_10008021 3300006195 Bacteria 5852
125 Ga0097621_100021765 3300006237 Bacteria 4967
126 Ga0097621_100707633 3300006237 Bacteria 928
127 Ga0068871_100032048 3300006358 Bacteria 4148
128 Ga0068865_100113517 3300006881 Bacteria 2003
129 Ga0068865_100259209 3300006881 Bacteria 1376
130 Ga0068865_100349537 3300006881 Bacteria 1197
131 Ga0097620_100000436 3300006931 Bacteria 41890
132 Ga0097620_100020344 3300006931 Bacteria 6662
133 Ga0097620_100035756 3300006931 Bacteria 4985
134 Ga0097620_100146141 3300006931 Bacteria 2439
135 Ga0097620_100152280 3300006931 Bacteria 2388
136 Ga0097620_100158644 3300006931 Bacteria 2341
137 Ga0097620_100163845 3300006931 Bacteria 2302
138 Ga0097620_100405620 3300006931 Bacteria 1459
139 Ga0097620_100584208 3300006931 Bacteria 1211
140 Ga0105240_10233891 3300009093 Unclassified 2134
141 Ga0105240_10843635 3300009093 Bacteria 990
142 Ga0111539_10095585 3300009094 Bacteria 3490
143 Ga0105247_10014191 3300009101 Bacteria 4780
144 Ga0105247_10025441 3300009101 Bacteria 3570
145 Ga0105243_10072179 3300009148 Bacteria 2793
146 Ga0105243_10677873 3300009148 Bacteria 1002
147 Ga0105242_10027558 3300009176 Bacteria 4513
148 Ga0105242_10159032 3300009176 Bacteria 1976
149 Ga0105242_10344692 3300009176 Bacteria 1374
150 Ga0105237_10000056 3300009545 Bacteria 151313
151 Ga0105237_10000176 3300009545 Bacteria 90175
152 Ga0105237_10002520 3300009545 Bacteria 22687
153 Ga0105237_10049057 3300009545 Bacteria 4245
154 Ga0105237_10418478 3300009545 Bacteria 1345
155 Ga0105238_10010374 3300009551 Bacteria 9351
156 Ga0105238_10130224 3300009551 Unclassified 2494
157 Ga0105249_10013964 3300009553 Bacteria 7099
158 Ga0105249_10017914 3300009553 Bacteria 6294
159 Ga0105249_10018429 3300009553 Bacteria 6211
160 Ga0105249_10879450 3300009553 Unclassified 962
161 Ga0105239_10001693 3300010375 Bacteria 29061
162 Ga0105239_10028378 3300010375 Bacteria 6156
163 Ga0105239_10204296 3300010375 Bacteria 2214
164 Ga0105246_10114326 3300011119 Bacteria 1988
165 Ga0157373_10178052 3300013100 Bacteria 1497
166 Ga0157370_10149237 3300013104 Bacteria 2176
167 Ga0157374_10222604 3300013296 Bacteria 1852
168 Ga0157378_10001986 3300013297 Bacteria 18311
169 Ga0157378_10019929 3300013297 Bacteria 5898
170 Ga0157378_10106410 3300013297 Bacteria 2566
171 Ga0157378_10124137 3300013297 Bacteria 2383
172 Ga0157378_10182880 3300013297 Bacteria 1973
173 Ga0163162_10000535 3300013306 Bacteria 35127
174 Ga0163162_10031920 3300013306 Bacteria 5227
175 Ga0163162_10095635 3300013306 Bacteria 3058
176 Ga0163162_10108006 3300013306 Bacteria 2879
177 Ga0163162_10291654 3300013306 Bacteria 1763
178 Ga0163162_10313448 3300013306 Unclassified 1701
179 Ga0157372_10753343 3300013307 Bacteria 1132
180 Ga0157372_10919294 3300013307 Bacteria 1015
181 Ga0157375_10143059 3300013308 Unclassified 2520
182 Ga0163163_10001643 3300014325 Bacteria 18815
183 Ga0163163_10001884 3300014325 Bacteria 17736
184 Ga0163163_10256119 3300014325 Bacteria 1801
185 Ga0157380_10004292 3300014326 Bacteria 9874
186 Ga0157380_10006281 3300014326 Bacteria 8343
187 Ga0157380_10068990 3300014326 Bacteria 2851
188 Ga0157380_10079598 3300014326 Bacteria 2676
189 Ga0157377_10015183 3300014745 Bacteria 3932
190 Ga0157379_10008833 3300014968 Bacteria 8789
191 Ga0157379_10181727 3300014968 Bacteria 1900
192 Ga0157379_10325244 3300014968 Bacteria 1404
193 Ga0157376_10848003 3300014969 Unclassified 929
194 Ga0163161_10236037 3300017792 Unclassified 1420
195 Ga0213876_10000206 3300021384 Bacteria 59646
196 Ga0209455_1003182 3300025272 Bacteria 5953
197 Ga0207697_10013031 3300025315 Bacteria 3474
198 Ga0207653_10013461 3300025885 Unclassified 2561
199 Ga0207642_10147343 3300025899 Bacteria 1249
200 Ga0207688_10045869 3300025901 Bacteria 2439
201 Ga0207688_10227463 3300025901 Bacteria 1125
202 Ga0207647_10035789 3300025904 Unclassified 3161
203 Ga0207645_10029275 3300025907 Bacteria 3551
204 Ga0207645_10297357 3300025907 Unclassified 1074
205 Ga0207645_10343771 3300025907 Bacteria 998
206 Ga0207643_10013053 3300025908 Bacteria 4491
207 Ga0207643_10128911 3300025908 Bacteria 1503
208 Ga0207705_10088856 3300025909 Unclassified 2260
209 Ga0207705_10191787 3300025909 Unclassified 1546
210 Ga0207695_10015351 3300025913 Bacteria 9018
211 Ga0207671_10000172 3300025914 Bacteria 99486
212 Ga0207671_10001166 3300025914 Bacteria 31300
213 Ga0207671_10001997 3300025914 Bacteria 22478
214 Ga0207671_10003766 3300025914 Bacteria 14911
215 Ga0207671_10063312 3300025914 Bacteria 2748
216 Ga0207662_10007822 3300025918 Bacteria 5824
217 Ga0207662_10039893 3300025918 Bacteria 2756
218 Ga0207649_10001318 3300025920 Bacteria 14782
219 Ga0207652_10187642 3300025921 Unclassified 1859
220 Ga0207681_10520113 3300025923 Bacteria 976
221 Ga0207694_10121612 3300025924 Bacteria 2085
222 Ga0207650_10000005 3300025925 Bacteria 663190
223 Ga0207650_10007263 3300025925 Bacteria 7546
224 Ga0207650_10103282 3300025925 Unclassified 2197
225 Ga0207700_10015311 3300025928 Bacteria 5053
226 Ga0207664_10000501 3300025929 Bacteria 27913
227 Ga0207664_10639749 3300025929 Bacteria 956
228 Ga0207644_10026019 3300025931 Bacteria 4028
229 Ga0207690_10000668 3300025932 Bacteria 21960
230 Ga0207690_10002344 3300025932 Bacteria 11495
231 Ga0207706_10178010 3300025933 Bacteria 1868
232 Ga0207706_10216238 3300025933 Bacteria 1679
233 Ga0207686_10133245 3300025934 Bacteria 1707
234 Ga0207691_10525389 3300025940 Bacteria 1004
235 Ga0207711_10063278 3300025941 Bacteria 3193
236 Ga0207711_10107708 3300025941 Bacteria 2475
237 Ga0207711_10235168 3300025941 Bacteria 1679
238 Ga0207689_10016707 3300025942 Bacteria 6210
239 Ga0207689_10075274 3300025942 Unclassified 2775
240 Ga0207689_10076584 3300025942 Bacteria 2750
241 Ga0207689_10346500 3300025942 Bacteria 1234
242 Ga0207661_10001242 3300025944 Bacteria 17032
243 Ga0207661_10084543 3300025944 Bacteria 2629
244 Ga0207679_10000182 3300025945 Bacteria 51887
245 Ga0207679_10091067 3300025945 Bacteria 2359
246 Ga0207679_10358170 3300025945 Bacteria 1273
247 Ga0207679_10561684 3300025945 Unclassified 1025
248 Ga0207651_10147865 3300025960 Bacteria 1825
249 Ga0207651_10185545 3300025960 Bacteria 1654
250 Ga0207651_10268002 3300025960 Bacteria 1405
251 Ga0207712_10001780 3300025961 Bacteria 14326
252 Ga0207712_10064142 3300025961 Bacteria 2618
253 Ga0207668_10021774 3300025972 Bacteria 4092
254 Ga0207640_10142467 3300025981 Bacteria 1749
255 Ga0207658_10010211 3300025986 Bacteria 6378
256 Ga0207677_10399599 3300026023 Bacteria 1165
257 Ga0207703_10005005 3300026035 Bacteria 10749
258 Ga0207703_10067585 3300026035 Unclassified 2941
259 Ga0207703_10192229 3300026035 Bacteria 1808
260 Ga0207703_10201586 3300026035 Bacteria 1768
261 Ga0207639_10322572 3300026041 Bacteria 1372
262 Ga0207678_10051879 3300026067 Bacteria 3540
263 Ga0207708_10303609 3300026075 Bacteria 1299
264 Ga0207708_10430617 3300026075 Bacteria 1095
265 Ga0207702_10039537 3300026078 Bacteria 3953
266 Ga0207641_10142844 3300026088 Bacteria 2162
267 Ga0207641_10221250 3300026088 Bacteria 1756
268 Ga0207648_10000394 3300026089 Bacteria 48433
269 Ga0207648_10014563 3300026089 Bacteria 7264
270 Ga0207648_10019162 3300026089 Bacteria 6174
271 Ga0207648_10147497 3300026089 Bacteria 2075
272 Ga0207648_10159667 3300026089 Bacteria 1991
273 Ga0207648_10250811 3300026089 Bacteria 1578
274 Ga0207648_10715064 3300026089 Unclassified 929
275 Ga0207676_10068704 3300026095 Bacteria 2835
276 Ga0207676_10408303 3300026095 Bacteria 1271
277 Ga0207676_10647707 3300026095 Bacteria 1019
278 Ga0207674_10003912 3300026116 Bacteria 18125
279 Ga0207674_10008888 3300026116 Bacteria 11553
280 Ga0207674_10053054 3300026116 Bacteria 4133
281 Ga0207674_10401895 3300026116 Bacteria 1324
282 Ga0207675_100000820 3300026118 Bacteria 30929
283 Ga0207675_100023593 3300026118 Bacteria 5724
284 Ga0207675_100032380 3300026118 Bacteria 4869
285 Ga0207675_100198262 3300026118 Bacteria 1927
286 Ga0207675_100225015 3300026118 Bacteria 1808
287 Ga0207683_10032094 3300026121 Bacteria 4561
288 Ga0207683_10056097 3300026121 Bacteria 3455
289 Ga0207698_10265581 3300026142 Bacteria 1579
290 Ga0207698_10386653 3300026142 Bacteria 1333
291 Ga0207698_10726253 3300026142 Bacteria 990
292 Ga0268265_10031033 3300028380 Bacteria 3856
293 Ga0268265_10160700 3300028380 Unclassified 1908
294 Ga0268265_10254718 3300028380 Bacteria 1557
295 Ga0268265_10717617 3300028380 Bacteria 967
296 Ga0268264_10006942 3300028381 Bacteria 9500
297 Ga0268264_10025826 3300028381 Bacteria 4797
298 Ga0268264_10050736 3300028381 Bacteria 3456
299 Ga0268264_10085240 3300028381 Bacteria 2711
300 Ga0307515_10000300 3300028794 Bacteria 122040
301 Ga0316183_1086246 3300030742 Bacteria 40321
302 Ga0316181_1280322 3300030744 Bacteria 32733
303 Ga0265316_10055693 3300031344 Bacteria 3091
304 Ga0307408_100086688 3300031548 Bacteria 2354
305 Ga0316576_10005467 3300031727 Bacteria 7770
306 Ga0316578_10064318 3300031728 Bacteria 2165
307 Ga0307405_10079763 3300031731 Bacteria 2135
308 Ga0307413_10021370 3300031824 Bacteria 3463
309 Ga0307410_10014549 3300031852 Bacteria 4634
310 Ga0307406_10048290 3300031901 Bacteria 2687
311 Ga0307412_10014697 3300031911 Bacteria 4626
312 Ga0307409_100042540 3300031995 Bacteria 3403
313 Ga0307409_100395884 3300031995 Bacteria 1318
314 Ga0307416_100026082 3300032002 Bacteria 4300
315 Ga0307411_10014316 3300032005 Bacteria 4408
316 Ga0373941_0003580 3300035115 Bacteria 3533
317 Ga0373941_0021717 3300035115 Bacteria 1815
318 Ga0316574_0383774 3300035398 Unclassified 886
319 Ga0373927_0312547 3300035695 Bacteria 1034
320 Ga0316582_0260552 3300036647 Unclassified 1189
321 Ga0316584_0074183 3300036712 Bacteria 2551
322 Ga0436365_0880687 3300039437 Bacteria 59690
323 Ga0439436_0025789 3300041404 Bacteria 1726
324 Ga0439449_0013498 3300042007 Bacteria 3074
325 Ga0439457_034118 3300042014 Bacteria 1130
326 Ga0451577_0217415 3300042876 Unclassified 1727
327 Ga0451577_0438348 3300042876 Unclassified 1186
328 Ga0466972_0000007 3300044658 Bacteria 277010
329 Ga0453683_0000139 3300044673 Bacteria 105329
330 Ga0453684_0000256 3300044712 Bacteria 228862
331 Ga0453684_0174344 3300044712 Bacteria 2531
332 Ga0453684_0637302 3300044712 Bacteria 1164
333 Ga0453684_0934220 3300044712 Bacteria 927
334 Ga0495641_0076134 3300046461 Bacteria 1504
335 Ga0495606_0007762 3300046507 Bacteria 9498
336 Ga0495633_0000167 3300046558 Bacteria 86373
337 Ga0495668_0079160 3300046616 Bacteria 1804
338 Ga0495687_023321 3300047443 Bacteria 2956
339 Ga0495684_0181123 3300047471 Bacteria 1562
340 Ga0495686_0000607 3300047472 Bacteria 49581
341 Ga0496100_0020346 3300048903 Bacteria 3977
342 Ga0496100_0088594 3300048903 Bacteria 2107
343 Ga0496102_0061989 3300048905 Bacteria 3424
344 Ga0496106_0272802 3300048909 Bacteria 1354
345 Ga0496107_0017233 3300048910 Bacteria 5080
346 Ga0496115_0032866 3300048918 Bacteria 4095
347 Ga0496121_0000026 3300048924 Bacteria 450157
348 Ga0495678_012209 3300049459 Bacteria 4079
349 Ga0501296_014953 3300049519 Unclassified 955
350 Ga0501298_013446 3300049521 Bacteria 1450
351 Ga0501031_0104397 3300049568 Bacteria 1849
352 Ga0501032_0034630 3300049569 Bacteria 3455
353 Ga0501033_0045063 3300049570 Unclassified 3283
354 Ga0501034_0010869 3300049571 Bacteria 9455
355 Ga0501034_0130307 3300049571 Bacteria 2498
356 Ga0501036_0115614 3300049572 Unclassified 2266
357 Ga0501037_0014266 3300049573 Bacteria 5855
358 Ga0501038_0012080 3300049574 Bacteria 7885
359 Ga0501039_0022435 3300049575 Unclassified 4846
360 Ga0501039_0029553 3300049575 Bacteria 4221
361 Ga0501043_0192998 3300049579 Bacteria 1583
362 Ga0501046_0030308 3300049580 Bacteria 4391
363 Ga0501047_0034670 3300049581 Unclassified 4873
364 Ga0501048_0087480 3300049582 Bacteria 2198
365 Ga0501067_0018261 3300049583 Bacteria 3885
366 Ga0501068_0014361 3300049584 Bacteria 4525
367 Ga0501070_0109113 3300049586 Bacteria 2286
368 Ga0501072_0233991 3300049588 Bacteria 1463
369 Ga0501073_0013517 3300049589 Bacteria 5936
370 Ga0501074_0017043 3300049590 Bacteria 5270
371 Ga0501199_002791 3300049650 Bacteria 1650
372 Ga0501199_006095 3300049650 Unclassified 1222
373 Ga0501202_002075 3300049652 Bacteria 3324
374 Ga0501209_027106 3300049656 Bacteria 1420
375 Ga0501216_033775 3300049660 Bacteria 955
376 Ga0501217_011708 3300049661 Bacteria 1944
377 Ga0501223_004436 3300049663 Unclassified 3002
378 Ga0501224_005348 3300049664 Bacteria 1837
379 Ga0501227_009701 3300049665 Bacteria 2079
380 Ga0501230_009755 3300049667 Bacteria 1483
381 Ga0501233_017690 3300049668 Bacteria 1490
382 Ga0501233_034144 3300049668 Bacteria 1165
383 Ga0501235_006902 3300049669 Unclassified 2471
384 Ga0501236_001070 3300049670 Unclassified 3114
385 Ga0501239_008630 3300049672 Bacteria 1093
386 Ga0501243_013385 3300049675 Bacteria 1302
387 Ga0501256_003619 3300049685 Bacteria 1293
388 Ga0501257_007283 3300049686 Unclassified 2472
389 Ga0501257_027341 3300049686 Bacteria 1365
390 Ga0501258_011299 3300049687 Bacteria 955
391 Ga0501221_001645 3300049704 Bacteria 3715
392 Ga0501225_0003020 3300049705 Bacteria 5137
393 Ga0501225_0008606 3300049705 Bacteria 2924
394 Ga0501225_0014743 3300049705 Bacteria 2180
395 Ga0501229_013963 3300049706 Bacteria 1032
396 Ga0501234_002797 3300049707 Bacteria 2746
397 Ga0501245_004622 3300049708 Bacteria 1894
398 Ga0501083_0030741 3300049744 Bacteria 3687
399 Ga0501264_000865 3300049761 Plasmid 3903
400 Ga0501266_013306 3300049763 Bacteria 1069
401 Ga0501273_000984 3300049770 Bacteria 2548
402 Ga0501035_0035768 3300049822 Unclassified 4506
403 Ga0501044_0002454 3300049823 Bacteria 21139
404 Ga0501226_005308 3300049853 Bacteria 1473
405 nmdc:mga0k408_177_c3 3300050493 Bacteria 27094
406 nmdc:mga08y16_75632_c1 3300050511 Bacteria 3510
407 Ga0495655_0023353 3300053083 Bacteria 1425
408 Ga0500583_0000334 3300053092 Bacteria 15648
409 Ga0500651_0145503 3300053093 Eukaryota 1426
410 Ga0500608_002770 3300053122 Bacteria 6458
411 Ga0500568_0001098 3300053139 Bacteria 18219
412 Ga0500616_0055590 3300053153 Bacteria 2069
413 Ga0500637_0145182 3300053178 Eukaryota 1372

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_0438348 Ga0451577_0438348_526_1155 199
2 3300005437 Ga0070710_10191364 Ga0070710_101913642 213
3 3300048905 Ga0496102_0061989 Ga0496102_0061989_2389_3102 215
4 3300048909 Ga0496106_0272802 Ga0496106_0272802_624_1337 215
5 3300048918 Ga0496115_0032866 Ga0496115_0032866_1548_2261 215
6 3300005435 Ga0070714_100272531 Ga0070714_1002725312 216
7 3300025929 Ga0207664_10639749 Ga0207664_106397492 216
8 3300005436 Ga0070713_100148132 Ga0070713_1001481322 223
9 3300025928 Ga0207700_10015311 Ga0207700_100153113 223
10 3300005344 Ga0070661_100452281 Ga0070661_1004522811 227
11 3300005535 Ga0070684_100023366 Ga0070684_1000233663 227
12 3300005547 Ga0070693_100248533 Ga0070693_1002485331 230
13 3300053093 Ga0500651_0145503 Ga0500651_0145503_300_1022 231
14 3300053178 Ga0500637_0145182 Ga0500637_0145182_15_737 231
15 3300048924 Ga0496121_0000026 Ga0496121_0000026_92044_92787 232
16 iso_pu_bacteria 2852623160 2852624431 232
17 iso_pu_bacteria 2884933994 2884936700 232
18 3300046461 Ga0495641_0076134 Ga0495641_0076134_541_1377 233
19 3300047471 Ga0495684_0181123 Ga0495684_0181123_370_1206 233
20 3300005355 Ga0070671_100267872 Ga0070671_1002678721 235
21 3300005367 Ga0070667_100840440 Ga0070667_1008404401 235
22 3300005617 Ga0068859_100000436 Ga0068859_10000043635 235
23 3300005842 Ga0068858_100000316 Ga0068858_1000003166 235
24 3300006931 Ga0097620_100000436 Ga0097620_10000043635 235
25 3300009101 Ga0105247_10014191 Ga0105247_100141916 235
26 3300013308 Ga0157375_10143059 Ga0157375_101430592 235
27 3300014968 Ga0157379_10008833 Ga0157379_100088334 235
28 3300025981 Ga0207640_10142467 Ga0207640_101424672 235
29 3300026035 Ga0207703_10005005 Ga0207703_100050058 235
30 3300005614 Ga0068856_100032315 Ga0068856_1000323152 236
31 3300009093 Ga0105240_10233891 Ga0105240_102338912 236
32 3300009093 Ga0105240_10843635 Ga0105240_108436352 236
33 3300009545 Ga0105237_10000176 Ga0105237_1000017625 236
34 3300009545 Ga0105237_10049057 Ga0105237_100490575 236
35 3300009551 Ga0105238_10130224 Ga0105238_101302243 236
36 3300009553 Ga0105249_10879450 Ga0105249_108794502 236
37 3300010375 Ga0105239_10001693 Ga0105239_1000169315 236
38 3300010375 Ga0105239_10028378 Ga0105239_100283783 236
39 3300013306 Ga0163162_10000535 Ga0163162_1000053511 236
40 3300025272 Ga0209455_1003182 Ga0209455_10031825 236
41 3300025913 Ga0207695_10015351 Ga0207695_100153516 236
42 3300025914 Ga0207671_10000172 Ga0207671_1000017286 236
43 3300025914 Ga0207671_10063312 Ga0207671_100633122 236
44 3300025929 Ga0207664_10000501 Ga0207664_100005015 236
45 3300026078 Ga0207702_10039537 Ga0207702_100395372 236
46 3300047443 Ga0495687_023321 Ga0495687_023321_81_791 236
47 3300049459 Ga0495678_012209 Ga0495678_012209_333_1043 236
48 3300049672 Ga0501239_008630 Ga0501239_008630_258_1004 236
49 3300053122 Ga0500608_002770 Ga0500608_002770_1283_1993 236
50 3300003320 rootH2_10234768 rootH2_102347681 237
51 3300005618 Ga0068864_100087696 Ga0068864_1000876963 238
52 3300009545 Ga0105237_10418478 Ga0105237_104184781 238
53 3300009553 Ga0105249_10013964 Ga0105249_100139648 238
54 3300013104 Ga0157370_10149237 Ga0157370_101492371 238
55 3300014325 Ga0163163_10256119 Ga0163163_102561192 238
56 3300025914 Ga0207671_10001997 Ga0207671_1000199713 238
57 3300031548 Ga0307408_100086688 Ga0307408_1000866882 238
58 3300031731 Ga0307405_10079763 Ga0307405_100797632 238
59 3300031824 Ga0307413_10021370 Ga0307413_100213703 238
60 3300032002 Ga0307416_100026082 Ga0307416_1000260826 238
61 3300049521 Ga0501298_013446 Ga0501298_013446_11_739 238
62 3300049650 Ga0501199_002791 Ga0501199_002791_11_739 238
63 3300049652 Ga0501202_002075 Ga0501202_002075_1143_1871 238
64 3300049656 Ga0501209_027106 Ga0501209_027106_151_879 238
65 3300049663 Ga0501223_004436 Ga0501223_004436_1175_1903 238
66 3300049668 Ga0501233_034144 Ga0501233_034144_145_873 238
67 3300049686 Ga0501257_027341 Ga0501257_027341_236_964 238
68 3300049704 Ga0501221_001645 Ga0501221_001645_1021_1749 238
69 3300049705 Ga0501225_0008606 Ga0501225_0008606_967_1695 238
70 3300049707 Ga0501234_002797 Ga0501234_002797_618_1346 238
71 3300049708 Ga0501245_004622 Ga0501245_004622_1094_1822 238
72 3300049763 Ga0501266_013306 Ga0501266_013306_186_914 238
73 3300014969 Ga0157376_10848003 Ga0157376_108480031 239
74 3300031727 Ga0316576_10005467 Ga0316576_100054672 239
75 3300031728 Ga0316578_10064318 Ga0316578_100643182 239
76 3300036647 Ga0316582_0260552 Ga0316582_0260552_256_978 239
77 3300036712 Ga0316584_0074183 Ga0316584_0074183_1784_2524 239
78 3300042876 Ga0451577_0217415 Ga0451577_0217415_40_771 239
79 3300044712 Ga0453684_0174344 Ga0453684_0174344_716_1447 239
80 3300003320 rootH2_10202275 rootH2_102022752 240
81 3300003322 rootL2_10013519 rootL2_100135193 240
82 3300044712 Ga0453684_0000256 Ga0453684_0000256_198628_199380 240
83 3300003322 rootL2_10087964 rootL2_100879642 241
84 3300005328 Ga0070676_10384447 Ga0070676_103844471 241
85 3300005334 Ga0068869_100066797 Ga0068869_1000667973 241
86 3300005459 Ga0068867_100012692 Ga0068867_1000126922 241
87 3300005530 Ga0070679_100048260 Ga0070679_1000482602 241
88 3300005616 Ga0068852_100287747 Ga0068852_1002877472 241
89 3300005718 Ga0068866_10014277 Ga0068866_100142772 241
90 3300005843 Ga0068860_100056608 Ga0068860_1000566084 241
91 3300006881 Ga0068865_100259209 Ga0068865_1002592092 241
92 3300009176 Ga0105242_10344692 Ga0105242_103446921 241
93 3300025907 Ga0207645_10297357 Ga0207645_102973572 241
94 3300025940 Ga0207691_10525389 Ga0207691_105253891 241
95 3300025942 Ga0207689_10075274 Ga0207689_100752743 241
96 3300026089 Ga0207648_10000394 Ga0207648_100003945 241
97 3300028380 Ga0268265_10160700 Ga0268265_101607003 241
98 3300028381 Ga0268264_10050736 Ga0268264_100507364 241
99 3300035115 Ga0373941_0003580 Ga0373941_0003580_2656_3381 241
100 3300053153 Ga0500616_0055590 Ga0500616_0055590_869_1600 241
101 3300003322 rootL2_10040286 rootL2_100402868 242
102 3300003323 rootH1_10024356 rootH1_1002435614 242
103 3300005289 Ga0065704_10125251 Ga0065704_101252512 242
104 3300005295 Ga0065707_10172990 Ga0065707_101729901 242
105 3300005329 Ga0070683_100020132 Ga0070683_1000201325 242
106 3300005347 Ga0070668_100065466 Ga0070668_1000654664 242
107 3300005355 Ga0070671_100183658 Ga0070671_1001836582 242
108 3300005456 Ga0070678_100568609 Ga0070678_1005686091 242
109 3300005459 Ga0068867_100028134 Ga0068867_1000281345 242
110 3300005564 Ga0070664_100011463 Ga0070664_1000114635 242
111 3300005718 Ga0068866_10193404 Ga0068866_101934041 242
112 3300005841 Ga0068863_100117720 Ga0068863_1001177203 242
113 3300005843 Ga0068860_100009781 Ga0068860_1000097817 242
114 3300006195 Ga0075366_10002297 Ga0075366_100022979 242
115 3300009148 Ga0105243_10072179 Ga0105243_100721793 242
116 3300009176 Ga0105242_10027558 Ga0105242_100275583 242
117 3300013296 Ga0157374_10222604 Ga0157374_102226041 242
118 3300025899 Ga0207642_10147343 Ga0207642_101473431 242
119 3300025907 Ga0207645_10343771 Ga0207645_103437711 242
120 3300025934 Ga0207686_10133245 Ga0207686_101332452 242
121 3300025972 Ga0207668_10021774 Ga0207668_100217742 242
122 3300026088 Ga0207641_10142844 Ga0207641_101428442 242
123 3300026089 Ga0207648_10250811 Ga0207648_102508112 242
124 3300026142 Ga0207698_10386653 Ga0207698_103866532 242
125 3300028381 Ga0268264_10006942 Ga0268264_100069427 242
126 3300044658 Ga0466972_0000007 Ga0466972_0000007_21998_22729 242
127 3300044673 Ga0453683_0000139 Ga0453683_0000139_31003_31734 242
128 3300044712 Ga0453684_0637302 Ga0453684_0637302_385_1116 242
129 3300046558 Ga0495633_0000167 Ga0495633_0000167_13633_14361 242
130 3300048903 Ga0496100_0020346 Ga0496100_0020346_1817_2614 242
131 3300048910 Ga0496107_0017233 Ga0496107_0017233_1608_2402 242
132 3300049568 Ga0501031_0104397 Ga0501031_0104397_552_1319 242
133 3300049569 Ga0501032_0034630 Ga0501032_0034630_1582_2349 242
134 3300049571 Ga0501034_0130307 Ga0501034_0130307_1561_2328 242
135 3300049574 Ga0501038_0012080 Ga0501038_0012080_1318_2085 242
136 3300049575 Ga0501039_0029553 Ga0501039_0029553_31_798 242
137 3300049580 Ga0501046_0030308 Ga0501046_0030308_3486_4253 242
138 3300049582 Ga0501048_0087480 Ga0501048_0087480_82_849 242
139 3300049583 Ga0501067_0018261 Ga0501067_0018261_300_1067 242
140 3300049584 Ga0501068_0014361 Ga0501068_0014361_3354_4121 242
141 3300049586 Ga0501070_0109113 Ga0501070_0109113_1275_2042 242
142 3300049588 Ga0501072_0233991 Ga0501072_0233991_141_908 242
143 3300049589 Ga0501073_0013517 Ga0501073_0013517_245_1012 242
144 3300049590 Ga0501074_0017043 Ga0501074_0017043_3120_3887 242
145 3300049670 Ga0501236_001070 Ga0501236_001070_1369_2097 242
146 3300049744 Ga0501083_0030741 Ga0501083_0030741_1229_1996 242
147 3300049761 Ga0501264_000865 Ga0501264_000865_741_1469 242
148 3300050493 nmdc:mga0k408_177_c3 nmdc:mga0k408_177_c3_1455_2183 242
149 3300002459 JGI24751J29686_10000296 JGI24751J29686_1000029613 243
150 3300003322 rootL2_10049588 rootL2_100495883 243
151 3300003322 rootL2_10305785 rootL2_103057851 243
152 3300003323 rootH1_10278093 rootH1_102780932 243
153 3300005293 Ga0065715_10119774 Ga0065715_101197742 243
154 3300005327 Ga0070658_10112149 Ga0070658_101121493 243
155 3300005327 Ga0070658_10130252 Ga0070658_101302521 243
156 3300005327 Ga0070658_10173283 Ga0070658_101732833 243
157 3300005329 Ga0070683_100000369 Ga0070683_10000036921 243
158 3300005329 Ga0070683_100502883 Ga0070683_1005028832 243
159 3300005330 Ga0070690_100006820 Ga0070690_1000068202 243
160 3300005331 Ga0070670_100001499 Ga0070670_10000149913 243
161 3300005331 Ga0070670_100040947 Ga0070670_1000409474 243
162 3300005331 Ga0070670_100191099 Ga0070670_1001910992 243
163 3300005331 Ga0070670_100413172 Ga0070670_1004131721 243
164 3300005334 Ga0068869_100230197 Ga0068869_1002301971 243
165 3300005337 Ga0070682_100019814 Ga0070682_1000198142 243
166 3300005337 Ga0070682_100042571 Ga0070682_1000425714 243
167 3300005338 Ga0068868_100946825 Ga0068868_1009468251 243
168 3300005340 Ga0070689_100065606 Ga0070689_1000656063 243
169 3300005343 Ga0070687_100005111 Ga0070687_1000051114 243
170 3300005344 Ga0070661_100002729 Ga0070661_10000272911 243
171 3300005345 Ga0070692_10008616 Ga0070692_100086167 243
172 3300005353 Ga0070669_100071498 Ga0070669_1000714983 243
173 3300005353 Ga0070669_100367514 Ga0070669_1003675141 243
174 3300005354 Ga0070675_100026841 Ga0070675_1000268413 243
175 3300005355 Ga0070671_100207988 Ga0070671_1002079884 243
176 3300005356 Ga0070674_100048772 Ga0070674_1000487722 243
177 3300005364 Ga0070673_100035190 Ga0070673_1000351902 243
178 3300005364 Ga0070673_100098390 Ga0070673_1000983902 243
179 3300005365 Ga0070688_100016767 Ga0070688_1000167672 243
180 3300005366 Ga0070659_100000542 Ga0070659_1000005428 243
181 3300005366 Ga0070659_100002724 Ga0070659_10000272412 243
182 3300005367 Ga0070667_100024409 Ga0070667_1000244091 243
183 3300005440 Ga0070705_100004849 Ga0070705_1000048496 243
184 3300005444 Ga0070694_100004601 Ga0070694_1000046015 243
185 3300005444 Ga0070694_100029789 Ga0070694_1000297892 243
186 3300005456 Ga0070678_100133942 Ga0070678_1001339422 243
187 3300005456 Ga0070678_100405459 Ga0070678_1004054591 243
188 3300005457 Ga0070662_100389263 Ga0070662_1003892632 243
189 3300005459 Ga0068867_100012940 Ga0068867_1000129401 243
190 3300005459 Ga0068867_100074772 Ga0068867_1000747722 243
191 3300005471 Ga0070698_100023649 Ga0070698_1000236495 243
192 3300005530 Ga0070679_100036518 Ga0070679_1000365184 243
193 3300005530 Ga0070679_100196143 Ga0070679_1001961432 243
194 3300005535 Ga0070684_100001473 Ga0070684_10000147317 243
195 3300005535 Ga0070684_100386574 Ga0070684_1003865742 243
196 3300005544 Ga0070686_100008908 Ga0070686_1000089085 243
197 3300005545 Ga0070695_100157544 Ga0070695_1001575441 243
198 3300005547 Ga0070693_100007482 Ga0070693_10000748210 243
199 3300005549 Ga0070704_100036985 Ga0070704_1000369854 243
200 3300005549 Ga0070704_100147095 Ga0070704_1001470952 243
201 3300005549 Ga0070704_100555364 Ga0070704_1005553641 243
202 3300005564 Ga0070664_100000744 Ga0070664_1000007442 243
203 3300005564 Ga0070664_100030222 Ga0070664_1000302226 243
204 3300005564 Ga0070664_100260382 Ga0070664_1002603821 243
205 3300005564 Ga0070664_100616073 Ga0070664_1006160732 243
206 3300005577 Ga0068857_100001073 Ga0068857_10000107314 243
207 3300005577 Ga0068857_100222988 Ga0068857_1002229882 243
208 3300005577 Ga0068857_100682415 Ga0068857_1006824151 243
209 3300005578 Ga0068854_100083273 Ga0068854_1000832733 243
210 3300005615 Ga0070702_100004452 Ga0070702_1000044526 243
211 3300005616 Ga0068852_100319687 Ga0068852_1003196872 243
212 3300005616 Ga0068852_100394259 Ga0068852_1003942592 243
213 3300005617 Ga0068859_100020344 Ga0068859_1000203442 243
214 3300005617 Ga0068859_100035757 Ga0068859_1000357577 243
215 3300005617 Ga0068859_100152280 Ga0068859_1001522803 243
216 3300005617 Ga0068859_100158655 Ga0068859_1001586551 243
217 3300005617 Ga0068859_100163855 Ga0068859_1001638552 243
218 3300005617 Ga0068859_100405648 Ga0068859_1004056482 243
219 3300005617 Ga0068859_100584248 Ga0068859_1005842481 243
220 3300005618 Ga0068864_100046716 Ga0068864_1000467165 243
221 3300005618 Ga0068864_100071525 Ga0068864_1000715252 243
222 3300005618 Ga0068864_100229109 Ga0068864_1002291091 243
223 3300005719 Ga0068861_100031415 Ga0068861_1000314152 243
224 3300005719 Ga0068861_100118101 Ga0068861_1001181012 243
225 3300005834 Ga0068851_10003512 Ga0068851_100035124 243
226 3300005840 Ga0068870_10018128 Ga0068870_100181282 243
227 3300005842 Ga0068858_100260258 Ga0068858_1002602582 243
228 3300005842 Ga0068858_100358986 Ga0068858_1003589862 243
229 3300005843 Ga0068860_100018513 Ga0068860_1000185135 243
230 3300005843 Ga0068860_100026526 Ga0068860_1000265262 243
231 3300005844 Ga0068862_100015469 Ga0068862_1000154692 243
232 3300005844 Ga0068862_100044734 Ga0068862_1000447344 243
233 3300005844 Ga0068862_100606084 Ga0068862_1006060842 243
234 3300005985 Ga0081539_10018276 Ga0081539_100182764 243
235 3300006195 Ga0075366_10008021 Ga0075366_100080213 243
236 3300006237 Ga0097621_100021765 Ga0097621_1000217653 243
237 3300006237 Ga0097621_100707633 Ga0097621_1007076331 243
238 3300006358 Ga0068871_100032048 Ga0068871_1000320483 243
239 3300006881 Ga0068865_100113517 Ga0068865_1001135173 243
240 3300006881 Ga0068865_100349537 Ga0068865_1003495372 243
241 3300006931 Ga0097620_100020344 Ga0097620_1000203446 243
242 3300006931 Ga0097620_100035756 Ga0097620_1000357562 243
243 3300006931 Ga0097620_100146141 Ga0097620_1001461413 243
244 3300006931 Ga0097620_100152280 Ga0097620_1001522803 243
245 3300006931 Ga0097620_100158644 Ga0097620_1001586442 243
246 3300006931 Ga0097620_100163845 Ga0097620_1001638452 243
247 3300006931 Ga0097620_100405620 Ga0097620_1004056202 243
248 3300006931 Ga0097620_100584208 Ga0097620_1005842081 243
249 3300009094 Ga0111539_10095585 Ga0111539_100955852 243
250 3300009101 Ga0105247_10025441 Ga0105247_100254412 243
251 3300009148 Ga0105243_10677873 Ga0105243_106778731 243
252 3300009176 Ga0105242_10159032 Ga0105242_101590321 243
253 3300009545 Ga0105237_10000056 Ga0105237_1000005655 243
254 3300009545 Ga0105237_10002520 Ga0105237_1000252012 243
255 3300009551 Ga0105238_10010374 Ga0105238_100103742 243
256 3300009553 Ga0105249_10017914 Ga0105249_100179144 243
257 3300009553 Ga0105249_10018429 Ga0105249_100184294 243
258 3300010375 Ga0105239_10204296 Ga0105239_102042962 243
259 3300011119 Ga0105246_10114326 Ga0105246_101143262 243
260 3300013100 Ga0157373_10178052 Ga0157373_101780521 243
261 3300013297 Ga0157378_10001986 Ga0157378_1000198615 243
262 3300013297 Ga0157378_10019929 Ga0157378_100199293 243
263 3300013297 Ga0157378_10106410 Ga0157378_101064102 243
264 3300013297 Ga0157378_10124137 Ga0157378_101241373 243
265 3300013297 Ga0157378_10182880 Ga0157378_101828801 243
266 3300013306 Ga0163162_10031920 Ga0163162_100319202 243
267 3300013306 Ga0163162_10095635 Ga0163162_100956353 243
268 3300013306 Ga0163162_10108006 Ga0163162_101080062 243
269 3300013306 Ga0163162_10291654 Ga0163162_102916542 243
270 3300013306 Ga0163162_10313448 Ga0163162_103134482 243
271 3300013307 Ga0157372_10753343 Ga0157372_107533432 243
272 3300013307 Ga0157372_10919294 Ga0157372_109192941 243
273 3300014325 Ga0163163_10001643 Ga0163163_1000164312 243
274 3300014325 Ga0163163_10001884 Ga0163163_100018842 243
275 3300014326 Ga0157380_10004292 Ga0157380_100042925 243
276 3300014326 Ga0157380_10006281 Ga0157380_100062813 243
277 3300014326 Ga0157380_10068990 Ga0157380_100689902 243
278 3300014326 Ga0157380_10079598 Ga0157380_100795982 243
279 3300014745 Ga0157377_10015183 Ga0157377_100151832 243
280 3300014968 Ga0157379_10181727 Ga0157379_101817272 243
281 3300014968 Ga0157379_10325244 Ga0157379_103252441 243
282 3300017792 Ga0163161_10236037 Ga0163161_102360371 243
283 3300021384 Ga0213876_10000206 Ga0213876_1000020643 243
284 3300025315 Ga0207697_10013031 Ga0207697_100130312 243
285 3300025885 Ga0207653_10013461 Ga0207653_100134611 243
286 3300025901 Ga0207688_10045869 Ga0207688_100458693 243
287 3300025901 Ga0207688_10227463 Ga0207688_102274631 243
288 3300025904 Ga0207647_10035789 Ga0207647_100357892 243
289 3300025907 Ga0207645_10029275 Ga0207645_100292752 243
290 3300025908 Ga0207643_10013053 Ga0207643_100130533 243
291 3300025908 Ga0207643_10128911 Ga0207643_101289112 243
292 3300025909 Ga0207705_10088856 Ga0207705_100888564 243
293 3300025909 Ga0207705_10191787 Ga0207705_101917872 243
294 3300025914 Ga0207671_10001166 Ga0207671_1000116626 243
295 3300025914 Ga0207671_10003766 Ga0207671_100037668 243
296 3300025918 Ga0207662_10007822 Ga0207662_100078224 243
297 3300025918 Ga0207662_10039893 Ga0207662_100398932 243
298 3300025920 Ga0207649_10001318 Ga0207649_100013185 243
299 3300025921 Ga0207652_10187642 Ga0207652_101876422 243
300 3300025923 Ga0207681_10520113 Ga0207681_105201131 243
301 3300025924 Ga0207694_10121612 Ga0207694_101216122 243
302 3300025925 Ga0207650_10000005 Ga0207650_10000005477 243
303 3300025925 Ga0207650_10007263 Ga0207650_100072639 243
304 3300025925 Ga0207650_10103282 Ga0207650_101032822 243
305 3300025931 Ga0207644_10026019 Ga0207644_100260194 243
306 3300025932 Ga0207690_10000668 Ga0207690_100006684 243
307 3300025932 Ga0207690_10002344 Ga0207690_1000234410 243
308 3300025933 Ga0207706_10178010 Ga0207706_101780102 243
309 3300025933 Ga0207706_10216238 Ga0207706_102162382 243
310 3300025941 Ga0207711_10063278 Ga0207711_100632781 243
311 3300025941 Ga0207711_10107708 Ga0207711_101077082 243
312 3300025941 Ga0207711_10235168 Ga0207711_102351682 243
313 3300025942 Ga0207689_10016707 Ga0207689_100167076 243
314 3300025942 Ga0207689_10076584 Ga0207689_100765842 243
315 3300025942 Ga0207689_10346500 Ga0207689_103465002 243
316 3300025944 Ga0207661_10001242 Ga0207661_100012422 243
317 3300025944 Ga0207661_10084543 Ga0207661_100845433 243
318 3300025945 Ga0207679_10000182 Ga0207679_1000018223 243
319 3300025945 Ga0207679_10091067 Ga0207679_100910672 243
320 3300025945 Ga0207679_10358170 Ga0207679_103581701 243
321 3300025945 Ga0207679_10561684 Ga0207679_105616841 243
322 3300025960 Ga0207651_10147865 Ga0207651_101478652 243
323 3300025960 Ga0207651_10185545 Ga0207651_101855454 243
324 3300025960 Ga0207651_10268002 Ga0207651_102680022 243
325 3300025961 Ga0207712_10001780 Ga0207712_100017804 243
326 3300025961 Ga0207712_10064142 Ga0207712_100641423 243
327 3300025986 Ga0207658_10010211 Ga0207658_100102115 243
328 3300026023 Ga0207677_10399599 Ga0207677_103995992 243
329 3300026035 Ga0207703_10067585 Ga0207703_100675852 243
330 3300026035 Ga0207703_10192229 Ga0207703_101922295 243
331 3300026035 Ga0207703_10201586 Ga0207703_102015861 243
332 3300026041 Ga0207639_10322572 Ga0207639_103225723 243
333 3300026067 Ga0207678_10051879 Ga0207678_100518794 243
334 3300026075 Ga0207708_10303609 Ga0207708_103036091 243
335 3300026075 Ga0207708_10430617 Ga0207708_104306171 243
336 3300026088 Ga0207641_10221250 Ga0207641_102212502 243
337 3300026089 Ga0207648_10014563 Ga0207648_100145634 243
338 3300026089 Ga0207648_10019162 Ga0207648_100191622 243
339 3300026089 Ga0207648_10147497 Ga0207648_101474972 243
340 3300026089 Ga0207648_10159667 Ga0207648_101596671 243
341 3300026089 Ga0207648_10715064 Ga0207648_107150641 243
342 3300026095 Ga0207676_10068704 Ga0207676_100687043 243
343 3300026095 Ga0207676_10408303 Ga0207676_104083032 243
344 3300026095 Ga0207676_10647707 Ga0207676_106477071 243
345 3300026116 Ga0207674_10003912 Ga0207674_100039127 243
346 3300026116 Ga0207674_10008888 Ga0207674_100088882 243
347 3300026116 Ga0207674_10053054 Ga0207674_100530543 243
348 3300026116 Ga0207674_10401895 Ga0207674_104018952 243
349 3300026118 Ga0207675_100000820 Ga0207675_10000082017 243
350 3300026118 Ga0207675_100023593 Ga0207675_1000235938 243
351 3300026118 Ga0207675_100032380 Ga0207675_1000323804 243
352 3300026118 Ga0207675_100198262 Ga0207675_1001982622 243
353 3300026118 Ga0207675_100225015 Ga0207675_1002250151 243
354 3300026121 Ga0207683_10032094 Ga0207683_100320943 243
355 3300026121 Ga0207683_10056097 Ga0207683_100560975 243
356 3300026142 Ga0207698_10265581 Ga0207698_102655812 243
357 3300026142 Ga0207698_10726253 Ga0207698_107262531 243
358 3300028380 Ga0268265_10031033 Ga0268265_100310332 243
359 3300028380 Ga0268265_10254718 Ga0268265_102547182 243
360 3300028380 Ga0268265_10717617 Ga0268265_107176171 243
361 3300028381 Ga0268264_10025826 Ga0268264_100258264 243
362 3300028381 Ga0268264_10085240 Ga0268264_100852404 243
363 3300028794 Ga0307515_10000300 Ga0307515_1000030043 243
364 3300030742 Ga0316183_1086246 Ga0316183_108624628 243
365 3300030744 Ga0316181_1280322 Ga0316181_128032220 243
366 3300031344 Ga0265316_10055693 Ga0265316_100556931 243
367 3300031852 Ga0307410_10014549 Ga0307410_100145495 243
368 3300031901 Ga0307406_10048290 Ga0307406_100482902 243
369 3300031911 Ga0307412_10014697 Ga0307412_100146975 243
370 3300031995 Ga0307409_100042540 Ga0307409_1000425402 243
371 3300031995 Ga0307409_100395884 Ga0307409_1003958842 243
372 3300032005 Ga0307411_10014316 Ga0307411_100143164 243
373 3300035115 Ga0373941_0021717 Ga0373941_0021717_150_896 243
374 3300035398 Ga0316574_0383774 Ga0316574_0383774_77_811 243
375 3300035695 Ga0373927_0312547 Ga0373927_0312547_230_961 243
376 3300039437 Ga0436365_0880687 Ga0436365_0880687_2337_3068 243
377 3300041404 Ga0439436_0025789 Ga0439436_0025789_593_1327 243
378 3300042007 Ga0439449_0013498 Ga0439449_0013498_2299_3033 243
379 3300042014 Ga0439457_034118 Ga0439457_034118_104_838 243
380 3300044712 Ga0453684_0934220 Ga0453684_0934220_96_836 243
381 3300046507 Ga0495606_0007762 Ga0495606_0007762_5418_6152 243
382 3300046616 Ga0495668_0079160 Ga0495668_0079160_63_794 243
383 3300047472 Ga0495686_0000607 Ga0495686_0000607_47814_48548 243
384 3300048903 Ga0496100_0088594 Ga0496100_0088594_504_1262 243
385 3300049519 Ga0501296_014953 Ga0501296_014953_35_811 243
386 3300049570 Ga0501033_0045063 Ga0501033_0045063_1292_2044 243
387 3300049571 Ga0501034_0010869 Ga0501034_0010869_7109_7861 243
388 3300049572 Ga0501036_0115614 Ga0501036_0115614_1114_1866 243
389 3300049573 Ga0501037_0014266 Ga0501037_0014266_258_1010 243
390 3300049575 Ga0501039_0022435 Ga0501039_0022435_2725_3477 243
391 3300049579 Ga0501043_0192998 Ga0501043_0192998_571_1323 243
392 3300049581 Ga0501047_0034670 Ga0501047_0034670_3234_3986 243
393 3300049650 Ga0501199_006095 Ga0501199_006095_12_788 243
394 3300049660 Ga0501216_033775 Ga0501216_033775_94_870 243
395 3300049661 Ga0501217_011708 Ga0501217_011708_508_1284 243
396 3300049664 Ga0501224_005348 Ga0501224_005348_985_1761 243
397 3300049665 Ga0501227_009701 Ga0501227_009701_614_1390 243
398 3300049667 Ga0501230_009755 Ga0501230_009755_428_1204 243
399 3300049668 Ga0501233_017690 Ga0501233_017690_242_1018 243
400 3300049669 Ga0501235_006902 Ga0501235_006902_86_862 243
401 3300049675 Ga0501243_013385 Ga0501243_013385_205_981 243
402 3300049685 Ga0501256_003619 Ga0501256_003619_227_1003 243
403 3300049686 Ga0501257_007283 Ga0501257_007283_1185_1961 243
404 3300049687 Ga0501258_011299 Ga0501258_011299_77_844 243
405 3300049705 Ga0501225_0003020 Ga0501225_0003020_1723_2454 243
406 3300049705 Ga0501225_0014743 Ga0501225_0014743_622_1398 243
407 3300049706 Ga0501229_013963 Ga0501229_013963_50_826 243
408 3300049770 Ga0501273_000984 Ga0501273_000984_222_998 243
409 3300049822 Ga0501035_0035768 Ga0501035_0035768_1328_2080 243
410 3300049823 Ga0501044_0002454 Ga0501044_0002454_1306_2058 243
411 3300049853 Ga0501226_005308 Ga0501226_005308_40_816 243
412 3300050511 nmdc:mga08y16_75632_c1 nmdc:mga08y16_75632_c1_1909_2643 243
413 3300053083 Ga0495655_0023353 Ga0495655_0023353_138_869 243
414 3300053092 Ga0500583_0000334 Ga0500583_0000334_12350_13084 243
415 3300053139 Ga0500568_0001098 Ga0500568_0001098_10870_11604 243

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

6

187

0.84

PF08659

KR

KR domain

6

106

0.82

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

12

206

0.78

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

8

170

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rd5-assembly1.cif.gz_A crystal structure of a putative uncharacterized protein from mycobacterium paratuberculosis 0.8466 1 243
5o98-assembly2.cif.gz_B binary complex of catharanthus roseus vitrosamine synthase with nadp+ 0.8465 2 216
1n5d-assembly1.cif.gz_A crystal structure of porcine testicular carbonyl reductase/ 20beta-hydroxysteroid dehydrogenase 0.8463 2 216
6rnw-assembly1.cif.gz_A the crystal structure of thermosynechococcus elongatus protochlorophyllide oxidoreductase (por) in complex with nadp. 0.8441 2 239
3rd5-assembly1.cif.gz_A crystal structure of a putative uncharacterized protein from mycobacterium paratuberculosis 0.8433 1 243
ID Description Score Start End Superfamily
af_Q9XVS9_38_332_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9058 2 239 3.40.50.720
af_Q54NY5_29_328_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8866 2 239 3.40.50.720
af_Q9XVS9_38_332_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8845 2 239 3.40.50.720
af_Q9LDY7_24_316_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8823 2 239 3.40.50.720
af_A0PJE2_34_316_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8816 3 239 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4Q3G4I4-F1-model_v4 deleted 0.9982 1 101
AF-A0A2P8G4T9-F1-model_v4 Short-subunit dehydrogenase 0.998 1 243
AF-A0A5N7UXH5-F1-model_v4 deleted 0.9959 1 86
AF-A0A2P8G4T9-F1-model_v4 Short-subunit dehydrogenase 0.9939 1 243
AF-A0A4R2WC41-F1-model_v4 deleted 0.9937 1 243

Feature Viewer

pLDDT pTM Quality
94.23 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map