F438448

General Info

Members Datasets Scaffolds Average Seq Length
414 264 830 303

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221587|2643942364
Length 341
Sequence EFVSVRNNPRQWTRPFGSSRAKLSSVRHVIALDVGGTGMKAALVGADGTLLHEARRATGRDRGPEAVVETILGFAEDLRALGQERYGEPAAAAGVAVPGIVDAENGIAVYAANLGWRDVPMRELLSRRLDGVPVALGHDVRTGGLAEGRIGAGNGADRFLFVPLGTGIAGAIGIGDRIEAGAHGYAGEIGHIVVRPGGTECGCGQRGCLERYASASAVSQAWAGASGDPEADAADCAKAVESGDPTAVRVWQDAVDALADGLVTALTLLDPRTLIIGGGLAEAGETLFTPLRAAVEERVTFQKLPAIVPAALGDTAGCLGAGLLAWDLLAEQRPTDSEVSA

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
7 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
8 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
9 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
10 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
11 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
12 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
13 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
14 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
15 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
16 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
17 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
18 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
19 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
20 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
21 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
26 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
27 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
28 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
29 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
30 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
31 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
32 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
33 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
34 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
35 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
36 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
37 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
38 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
39 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
40 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
41 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
42 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
43 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
44 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
45 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
46 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
47 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
48 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
49 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
50 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
51 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
52 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
53 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
54 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
55 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
56 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
57 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
58 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
59 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
60 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
61 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
62 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
63 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
64 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
65 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
66 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
67 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
68 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
69 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
70 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
71 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
72 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
73 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
74 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
75 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
76 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
77 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
78 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
79 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
80 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
81 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
82 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
83 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
84 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
85 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
86 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
87 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
88 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
89 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
90 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
91 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
92 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
93 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
94 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
95 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
96 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
97 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
98 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
99 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
100 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
101 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
102 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
103 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
104 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
105 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
106 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
107 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
108 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
109 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
110 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
111 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
112 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
113 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
114 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
115 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
116 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
117 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
118 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
119 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
120 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
121 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
122 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
123 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
124 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
125 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
126 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
127 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
128 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
129 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
130 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
131 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
132 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
133 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
134 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
135 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
136 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
140 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
155 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
156 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
157 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
158 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
159 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
160 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
161 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
162 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
166 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
167 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
168 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
169 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
170 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
171 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
172 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
173 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
174 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
175 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
176 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
177 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
178 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
179 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
180 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
181 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
182 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
183 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
184 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
185 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
186 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
187 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
188 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
189 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
190 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
191 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
192 2643221548 Streptomyces sp. Root55 Isolate Unclassified
193 2643221647 Streptomyces sp. Root369 Isolate Unclassified
194 2643221670 Streptomyces sp. Root431 Isolate Unclassified
195 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
196 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
197 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
198 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
199 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
200 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
201 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
202 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
203 2808606448 Streptomyces sp. 193411 Isolate Unclassified
204 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
205 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
206 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
207 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
208 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
209 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
210 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
211 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
212 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
213 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
214 2862574272 Streptomyces sp. AcE210 Isolate Nodule
215 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
216 2867369537 Streptomyces sp. Z26 Isolate Unclassified
217 2867428634 Streptomyces sp. RP5T Isolate Unclassified
218 2867475112 Streptomyces sp. TM32 Isolate Unclassified
219 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
220 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
221 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
222 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
223 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
224 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
225 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
226 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
227 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
228 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
229 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
230 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
231 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
232 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
233 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
234 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
235 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
236 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
237 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
238 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
239 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
240 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
241 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
242 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
243 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
244 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
245 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
246 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
247 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
248 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
249 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
250 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
251 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
252 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
253 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
254 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
255 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
256 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
257 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
258 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
259 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
260 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
261 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
262 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
263 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
264 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.95
Metatranscriptomes 0
Isolates 20.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.8
Nodule 0.72
Rhizoplane 0.97
Rhizosphere 78.26
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10001920 3300003316 Bacteria 14258
2 rootH1_10001920 3300003323 Bacteria 12125
3 rootH2_10014061 3300003320 Bacteria 3000
4 rootH2_10020257 3300003320 Bacteria 5410
5 rootL2_10035952 3300003322 Bacteria 1675
6 rootH1_10002154 3300003316 Bacteria 3761
7 rootH1_10002154 3300003323 Bacteria 7839
8 rootH1_10025203 3300003323 Bacteria 2892
9 JGI25160J50197_1017732 3300003354 Bacteria 2244
10 JGI25160J50197_1033450 3300003354 Bacteria 1292
11 Ga0068853_100025741 3300005539 Bacteria 4938
12 Ga0068856_100165479 3300005614 Bacteria 2223
13 Ga0075368_10014167 3300006042 Bacteria 2941
14 Ga0075363_100056007 3300006048 Bacteria 2113
15 Ga0075363_100076792 3300006048 Bacteria 1822
16 Ga0070715_10104945 3300006163 Bacteria 1324
17 Ga0075367_10000717 3300006178 Bacteria 12816
18 Ga0105243_10475144 3300009148 Bacteria 1178
19 Ga0105241_10106956 3300009174 Bacteria 2233
20 Ga0105246_10004452 3300011119 Bacteria 8528
21 Ga0157372_10311504 3300013307 Bacteria 1832
22 Ga0182006_1042582 3300015261 Bacteria 1778
23 Ga0183367_1005 3300015688 Bacteria 652063
24 Ga0213875_10027957 3300021388 Bacteria 2682
25 Ga0209758_1006604 3300025297 Bacteria 8222
26 Ga0207426_1003083 3300025302 Bacteria 9549
27 Ga0207426_1021712 3300025302 Bacteria 2215
28 Ga0207647_10045901 3300025904 Bacteria 2724
29 Ga0207709_10040321 3300025935 Bacteria 2795
30 Ga0207639_10081099 3300026041 Bacteria 2569
31 Ga0207702_10095542 3300026078 Bacteria 2612
32 Ga0209371_1015397 3300027312 Bacteria 2056
33 Ga0307517_10003190 3300028786 Bacteria 25757
34 Ga0307517_10008770 3300028786 Bacteria 14457
35 Ga0307515_10005593 3300028794 Bacteria 25395
36 Ga0307515_10048336 3300028794 Bacteria 6434
37 Ga0307511_10000262 3300030521 Bacteria 54437
38 Ga0307512_10004180 3300030522 Bacteria 16012
39 Ga0307513_10055386 3300031456 Bacteria 4244
40 Ga0307513_10057612 3300031456 Bacteria 4137
41 Ga0307509_10012491 3300031507 Bacteria 10156
42 Ga0307509_10024253 3300031507 Bacteria 6795
43 Ga0307508_10008636 3300031616 Bacteria 9403
44 Ga0307508_10022018 3300031616 Bacteria 5798
45 Ga0307508_10052488 3300031616 Bacteria 3621
46 Ga0307508_10176883 3300031616 Bacteria 1737
47 Ga0307514_10093419 3300031649 Bacteria 2185
48 Ga0307514_10158049 3300031649 Bacteria 1507
49 Ga0307514_10160206 3300031649 Bacteria 1491
50 Ga0307516_10050195 3300031730 Bacteria 4094
51 Ga0307507_10014045 3300033179 Bacteria 9615
52 Ga0307507_10110833 3300033179 Bacteria 2244
53 Ga0307510_10024338 3300033180 Bacteria 6997
54 Ga0307510_10043974 3300033180 Bacteria 4844
55 Ga0307510_10247704 3300033180 Bacteria 1271
56 Ga0395900_0073190 3300037418 Bacteria 3523
57 Ga0395898_0037413 3300037466 Bacteria 4814
58 Ga0395898_0166778 3300037466 Bacteria 2106
59 Ga0395905_0393627 3300037471 Bacteria 1280
60 Ga0436364_0151522 3300037853 Bacteria 4085
61 Ga0395901_0119043 3300038443 Bacteria 2775
62 Ga0439436_0000491 3300041404 Bacteria 10260
63 Ga0439448_0006908 3300042005 Bacteria 3274
64 Ga0439449_0021774 3300042007 Bacteria 2400
65 Ga0439449_0045841 3300042007 Bacteria 1620
66 Ga0439457_002018 3300042014 Bacteria 5958
67 Ga0450894_000035 3300042131 Bacteria 19542
68 Ga0450898_005703 3300042134 Bacteria 1891
69 Ga0450899_000155 3300042135 Bacteria 6593
70 Ga0450900_002295 3300042136 Bacteria 2008
71 Ga0450902_005498 3300042137 Bacteria 1917
72 Ga0450903_000067 3300042138 Bacteria 20805
73 Ga0450903_002769 3300042138 Bacteria 3091
74 Ga0439458_0000619 3300042157 Bacteria 9188
75 Ga0439458_0004618 3300042157 Bacteria 3144
76 Ga0439458_0009226 3300042157 Bacteria 2197
77 Ga0466969_0005328 3300044656 Bacteria 6841
78 Ga0466972_0004010 3300044658 Bacteria 7335
79 Ga0466972_0004844 3300044658 Bacteria 6752
80 Ga0466972_0020617 3300044658 Bacteria 3293
81 Ga0466965_0000512 3300044683 Bacteria 13809
82 Ga0466965_0145102 3300044683 Bacteria 1238
83 Ga0466966_0000876 3300044684 Bacteria 19208
84 Ga0466966_0096038 3300044684 Bacteria 1836
85 Ga0466966_0142934 3300044684 Bacteria 1461
86 Ga0466961_0013555 3300044693 Bacteria 5220
87 Ga0466961_0029854 3300044693 Bacteria 3503
88 Ga0466961_0067060 3300044693 Bacteria 2279
89 Ga0466963_0000687 3300044694 Bacteria 16444
90 Ga0466963_0001071 3300044694 Bacteria 14271
91 Ga0466971_0000608 3300044719 Bacteria 14248
92 Ga0466971_0020884 3300044719 Bacteria 2911
93 Ga0466957_0139404 3300044842 Bacteria 1561
94 Ga0466960_0003180 3300044901 Bacteria 6298
95 Ga0466959_0002551 3300045049 Bacteria 11686
96 Ga0466959_0040929 3300045049 Bacteria 3423
97 Ga0466959_0084113 3300045049 Bacteria 2290
98 Ga0466967_0009089 3300045976 Bacteria 7348
99 Ga0466967_0013005 3300045976 Bacteria 6403
100 Ga0495592_0006582 3300046454 Bacteria 8656
101 Ga0495592_0022771 3300046454 Bacteria 4764
102 Ga0495592_0060209 3300046454 Bacteria 2793
103 Ga0495603_0000270 3300046455 Bacteria 27500
104 Ga0495603_0002461 3300046455 Bacteria 10892
105 Ga0495603_0003315 3300046455 Bacteria 9584
106 Ga0495603_0009629 3300046455 Bacteria 5840
107 Ga0495603_0039132 3300046455 Bacteria 2842
108 Ga0495603_0041688 3300046455 Bacteria 2744
109 Ga0495603_0099148 3300046455 Bacteria 1701
110 Ga0495603_0178484 3300046455 Bacteria 1229
111 Ga0495590_0013944 3300046457 Bacteria 2946
112 Ga0495629_0000848 3300046459 Bacteria 24687
113 Ga0495629_0008592 3300046459 Bacteria 7520
114 Ga0495629_0015724 3300046459 Bacteria 5432
115 Ga0495629_0019026 3300046459 Bacteria 4911
116 Ga0495629_0026348 3300046459 Bacteria 4130
117 Ga0495629_0039302 3300046459 Bacteria 3330
118 Ga0495629_0041908 3300046459 Bacteria 3218
119 Ga0495629_0055584 3300046459 Bacteria 2767
120 Ga0495629_0086765 3300046459 Bacteria 2183
121 Ga0495629_0095548 3300046459 Bacteria 2073
122 Ga0495638_0017639 3300046460 Bacteria 4754
123 Ga0495638_0168496 3300046460 Bacteria 1258
124 Ga0495641_0073763 3300046461 Bacteria 1531
125 Ga0495651_0003025 3300046462 Bacteria 12973
126 Ga0495651_0029191 3300046462 Bacteria 4301
127 Ga0495580_0011350 3300046472 Bacteria 6894
128 Ga0495580_0172798 3300046472 Bacteria 1493
129 Ga0495582_0010005 3300046473 Bacteria 5220
130 Ga0495639_0042752 3300046475 Bacteria 2045
131 Ga0495662_0010539 3300046476 Bacteria 4522
132 Ga0495662_0013701 3300046476 Bacteria 3948
133 Ga0495662_0028210 3300046476 Bacteria 2710
134 Ga0495662_0120932 3300046476 Bacteria 1285
135 Ga0495664_0008955 3300046477 Bacteria 5593
136 Ga0495664_0028359 3300046477 Bacteria 3269
137 Ga0495584_0021505 3300046491 Bacteria 3276
138 Ga0495594_0000685 3300046499 Bacteria 17457
139 Ga0495594_0009988 3300046499 Bacteria 4916
140 Ga0495594_0011728 3300046499 Bacteria 4555
141 Ga0495594_0042487 3300046499 Bacteria 2489
142 Ga0495594_0253470 3300046499 Bacteria 1002
143 Ga0495607_0022333 3300046501 Bacteria 3975
144 Ga0495607_0038639 3300046501 Bacteria 2858
145 Ga0495583_0045900 3300046506 Bacteria 2017
146 Ga0495608_0008678 3300046511 Bacteria 7112
147 Ga0495610_0066956 3300046512 Bacteria 1689
148 Ga0495616_0007630 3300046513 Bacteria 6473
149 Ga0495618_0180870 3300046514 Bacteria 1340
150 Ga0495620_0005316 3300046515 Bacteria 7203
151 Ga0495620_0051637 3300046515 Bacteria 1748
152 Ga0495628_0001215 3300046516 Bacteria 23569
153 Ga0495628_0042943 3300046516 Bacteria 3603
154 Ga0495628_0105731 3300046516 Bacteria 2168
155 Ga0495630_0046386 3300046517 Bacteria 3248
156 Ga0495631_0002692 3300046518 Bacteria 9871
157 Ga0495631_0045372 3300046518 Bacteria 1935
158 Ga0495637_0015798 3300046520 Bacteria 3536
159 Ga0495643_0001898 3300046522 Bacteria 17653
160 Ga0495643_0011742 3300046522 Bacteria 5314
161 Ga0495644_0085394 3300046523 Bacteria 1190
162 Ga0495648_0029132 3300046524 Bacteria 3668
163 Ga0495666_0027501 3300046526 Bacteria 2799
164 Ga0495666_0033085 3300046526 Bacteria 2527
165 Ga0495642_0019301 3300046528 Bacteria 2672
166 Ga0495652_0039648 3300046529 Bacteria 4072
167 Ga0495652_0200731 3300046529 Bacteria 1513
168 Ga0495665_0006128 3300046531 Bacteria 6494
169 Ga0495640_0006459 3300046533 Bacteria 9271
170 Ga0495640_0020459 3300046533 Bacteria 4869
171 Ga0495640_0100199 3300046533 Bacteria 1902
172 Ga0495586_0081541 3300046535 Bacteria 1778
173 Ga0495587_0181086 3300046536 Bacteria 1195
174 Ga0495645_0039901 3300046543 Bacteria 3424
175 Ga0495622_0020181 3300046557 Bacteria 3103
176 Ga0495622_0060998 3300046557 Bacteria 1747
177 Ga0495633_0021711 3300046558 Bacteria 3207
178 Ga0495667_0030124 3300046559 Bacteria 3649
179 Ga0495667_0097599 3300046559 Bacteria 1902
180 Ga0495656_0087593 3300046615 Bacteria 1418
181 Ga0495634_0010274 3300046642 Bacteria 6859
182 Ga0495611_0007972 3300046648 Bacteria 4498
183 Ga0495625_0024035 3300046660 Bacteria 4645
184 Ga0495625_0162058 3300046660 Bacteria 1498
185 Ga0495635_0068262 3300046663 Bacteria 2439
186 Ga0495635_0209490 3300046663 Bacteria 1320
187 Ga0495661_0038762 3300046665 Bacteria 2965
188 Ga0495588_0053871 3300046674 Bacteria 2075
189 Ga0495657_0012598 3300046675 Bacteria 6275
190 Ga0495657_0031794 3300046675 Bacteria 3686
191 Ga0495657_0172014 3300046675 Bacteria 1333
192 Ga0495599_0136725 3300046678 Bacteria 1521
193 Ga0495623_0064896 3300046679 Bacteria 2284
194 Ga0495623_0076645 3300046679 Bacteria 2075
195 Ga0495623_0099394 3300046679 Bacteria 1774
196 Ga0495613_0002098 3300046689 Bacteria 15139
197 Ga0495613_0006880 3300046689 Bacteria 8486
198 Ga0495613_0013495 3300046689 Bacteria 6068
199 Ga0495613_0026173 3300046689 Bacteria 4346
200 Ga0495613_0027324 3300046689 Bacteria 4246
201 Ga0495613_0055425 3300046689 Bacteria 2912
202 Ga0495624_0057033 3300046690 Bacteria 2456
203 Ga0495670_0048559 3300046691 Bacteria 2123
204 Ga0495670_0142730 3300046691 Bacteria 1253
205 Ga0495671_0001574 3300046692 Bacteria 15105
206 Ga0495671_0035408 3300046692 Bacteria 2535
207 Ga0495671_0094172 3300046692 Bacteria 1466
208 Ga0495649_0082700 3300046694 Bacteria 1715
209 Ga0495589_0029053 3300046794 Bacteria 2787
210 Ga0495589_0031036 3300046794 Bacteria 2690
211 Ga0495589_0068471 3300046794 Bacteria 1736
212 Ga0495600_0010539 3300046809 Bacteria 5740
213 Ga0495600_0015328 3300046809 Bacteria 4844
214 Ga0495660_0079346 3300046810 Bacteria 1724
215 Ga0495581_0027125 3300047315 Bacteria 3322
216 Ga0495581_0162485 3300047315 Bacteria 1306
217 Ga0495604_0002884 3300047317 Bacteria 13771
218 Ga0495604_0023056 3300047317 Bacteria 4967
219 Ga0495604_0050514 3300047317 Bacteria 3228
220 Ga0495604_0071715 3300047317 Bacteria 2619
221 Ga0495636_0001927 3300047318 Bacteria 7940
222 Ga0495636_0002613 3300047318 Bacteria 6930
223 Ga0495636_0012537 3300047318 Bacteria 3356
224 Ga0495674_0089557 3300047319 Bacteria 2630
225 Ga0495676_0004818 3300047321 Bacteria 12369
226 Ga0495676_0011812 3300047321 Bacteria 7877
227 Ga0495676_0016897 3300047321 Bacteria 6460
228 Ga0495676_0054039 3300047321 Bacteria 3195
229 Ga0495676_0059091 3300047321 Bacteria 3013
230 Ga0495680_0006200 3300047322 Bacteria 11145
231 Ga0495683_0017219 3300047323 Bacteria 3747
232 Ga0495683_0110694 3300047323 Bacteria 1311
233 Ga0495687_001373 3300047443 Bacteria 22509
234 Ga0495687_003246 3300047443 Bacteria 12000
235 Ga0495687_049062 3300047443 Bacteria 1806
236 Ga0495675_0037009 3300047444 Bacteria 3109
237 Ga0495675_0069780 3300047444 Bacteria 2218
238 Ga0495675_0085566 3300047444 Bacteria 1982
239 Ga0495677_0017702 3300047445 Bacteria 2582
240 Ga0495685_002628 3300047447 Bacteria 5656
241 Ga0495681_0000410 3300047470 Bacteria 33110
242 Ga0495681_0020081 3300047470 Bacteria 3632
243 Ga0495681_0062181 3300047470 Bacteria 1717
244 Ga0495686_0054101 3300047472 Bacteria 2514
245 Ga0495593_0011498 3300047673 Bacteria 5082
246 Ga0495593_0084017 3300047673 Bacteria 1644
247 Ga0495602_0132990 3300048088 Bacteria 1981
248 Ga0495614_0002050 3300048089 Bacteria 8863
249 Ga0495614_0039409 3300048089 Bacteria 2027
250 Ga0495614_0043174 3300048089 Bacteria 1933
251 Ga0495614_0106913 3300048089 Bacteria 1226
252 Ga0496109_0128003 3300048912 Bacteria 2369
253 Ga0496110_0394617 3300048913 Bacteria 1261
254 Ga0496113_0272024 3300048916 Bacteria 1354
255 Ga0501031_0025983 3300049568 Bacteria 3820
256 Ga0501031_0026818 3300049568 Bacteria 3755
257 Ga0501031_0054128 3300049568 Bacteria 2615
258 Ga0501031_0163583 3300049568 Bacteria 1454
259 Ga0501032_0001212 3300049569 Bacteria 20635
260 Ga0501032_0020809 3300049569 Bacteria 4567
261 Ga0501032_0156927 3300049569 Bacteria 1494
262 Ga0501033_0011025 3300049570 Bacteria 6921
263 Ga0501033_0073379 3300049570 Bacteria 2512
264 Ga0501033_0103931 3300049570 Bacteria 2071
265 Ga0501034_0008222 3300049571 Bacteria 11049
266 Ga0501034_0017553 3300049571 Bacteria 7339
267 Ga0501034_0035602 3300049571 Bacteria 5046
268 Ga0501034_0048658 3300049571 Bacteria 4279
269 Ga0501036_0005926 3300049572 Bacteria 9902
270 Ga0501036_0029871 3300049572 Bacteria 4606
271 Ga0501036_0053534 3300049572 Bacteria 3417
272 Ga0501036_0099546 3300049572 Bacteria 2458
273 Ga0501037_0000836 3300049573 Bacteria 23004
274 Ga0501038_0003858 3300049574 Bacteria 13935
275 Ga0501038_0015424 3300049574 Bacteria 6944
276 Ga0501038_0020866 3300049574 Bacteria 5888
277 Ga0501039_0005294 3300049575 Bacteria 9757
278 Ga0501039_0071699 3300049575 Bacteria 2692
279 Ga0501040_0101170 3300049576 Bacteria 2010
280 Ga0501041_0047300 3300049577 Bacteria 2618
281 Ga0501042_0062830 3300049578 Bacteria 2653
282 Ga0501043_0005839 3300049579 Bacteria 9902
283 Ga0501043_0009902 3300049579 Bacteria 7472
284 Ga0501043_0039014 3300049579 Bacteria 3733
285 Ga0501043_0071570 3300049579 Bacteria 2723
286 Ga0501047_0000072 3300049581 Bacteria 126542
287 Ga0501047_0001607 3300049581 Bacteria 22028
288 Ga0501047_0012241 3300049581 Bacteria 8123
289 Ga0501047_0157715 3300049581 Bacteria 2142
290 Ga0501047_0281013 3300049581 Bacteria 1509
291 Ga0501048_0049669 3300049582 Bacteria 2989
292 Ga0501048_0154213 3300049582 Bacteria 1624
293 Ga0501069_0044638 3300049585 Bacteria 2453
294 Ga0501071_0000108 3300049587 Bacteria 32155
295 Ga0501072_0004716 3300049588 Bacteria 10389
296 Ga0501074_0026157 3300049590 Bacteria 4231
297 Ga0501076_0010598 3300049592 Bacteria 6845
298 Ga0501077_0016724 3300049593 Bacteria 4625
299 Ga0501079_0004100 3300049741 Bacteria 10781
300 Ga0501080_0025990 3300049742 Bacteria 5440
301 Ga0501080_0067402 3300049742 Bacteria 3328
302 Ga0501083_0013397 3300049744 Bacteria 5731
303 Ga0501035_0024109 3300049822 Bacteria 5581
304 Ga0501035_0033450 3300049822 Bacteria 4676
305 Ga0501035_0048089 3300049822 Bacteria 3826
306 Ga0501035_0050311 3300049822 Bacteria 3734
307 Ga0501035_0057034 3300049822 Bacteria 3482
308 Ga0501035_0118381 3300049822 Bacteria 2317
309 Ga0501044_0015774 3300049823 Bacteria 8134
310 Ga0501044_0020475 3300049823 Bacteria 7063
311 Ga0501044_0064992 3300049823 Bacteria 3721
312 Ga0501044_0174704 3300049823 Bacteria 2118
313 Ga0501044_0185289 3300049823 Bacteria 2047
314 nmdc:mga06z11_629_c1 3300050494 Bacteria 12831
315 Ga0495601_0069865 3300053077 Bacteria 2240
316 Ga0495655_0046346 3300053083 Bacteria 1133
317 Ga0500578_0116017 3300053086 Bacteria 1685
318 Ga0500660_024713 3300053100 Bacteria 3177
319 Ga0500553_131121 3300053101 Bacteria 1010
320 Ga0500560_033361 3300053107 Bacteria 1572
321 Ga0500569_021206 3300053109 Bacteria 1715
322 Ga0500652_091837 3300053131 Bacteria 1267
323 Ga0500658_0045030 3300053134 Bacteria 1782
324 Ga0500561_0005347 3300053137 Bacteria 2378
325 Ga0500579_067137 3300053143 Bacteria 2092
326 Ga0500600_0056486 3300053149 Bacteria 2206
327 Ga0500616_0045671 3300053153 Bacteria 2332
328 Ga0500633_0004085 3300053160 Bacteria 3297
329 Ga0500634_0058063 3300053161 Bacteria 2062
330 Ga0500587_005946 3300053739 Bacteria 1631
331 Ga0501084_0008714 3300054114 Bacteria 8386
332 Ga0501082_0006335 3300060353 Bacteria 10264
333 Ga0530510_0092022 3300061734 Bacteria 2213
334 2643942364 2643221587 Bacteria 7586415
335 2554257752 2554235005 Bacteria 6457341
336 2585299231 2582581312 Bacteria 7308206
337 2585308885 2582581313 Bacteria 10042643
338 2585313573 2582581314 Bacteria 11452267
339 2616694994 2616644814 Bacteria 11555299
340 2616904559 2616644941 Bacteria 8510691
341 2643765038 2643221548 Bacteria 8053412
342 2643942914 2643221587 Bacteria 7586415
343 2644262376 2643221647 Bacteria 10741251
344 2644389994 2643221670 Bacteria 6497041
345 2644429444 2643221677 Bacteria 7584031
346 2644430373 2643221677 Bacteria 7584031
347 2644461123 2643221682 Bacteria 6743283
348 2784588655 2784132148 Bacteria 8627943
349 2785343198 2784746763 Bacteria 9783172
350 2785369597 2784746768 Bacteria 10036182
351 2786670687 2786546132 Bacteria 10419719
352 2793976179 2791355406 Bacteria 11364898
353 2804846896 2802429296 Bacteria 7227771
354 2809232265 2808606448 Bacteria 8656184
355 2812358000 2811994879 Bacteria 9313447
356 2812480444 2811994917 Bacteria 7761064
357 2819695492 2818991463 Bacteria 7948711
358 2819745240 2818991472 Bacteria 10089953
359 2852636568 2852635781 Bacteria 8251373
360 2862179389 2862178590 Bacteria 8583590
361 2862285743 2862281513 Bacteria 9621493
362 2862294801 2862290372 Bacteria 7471434
363 2862390285 2862382967 Bacteria 10317375
364 2862511724 2862507626 Bacteria 9425308
365 2862579170 2862574272 Bacteria 10567477
366 2863404509 2863404153 Bacteria 9672205
367 2867371964 2867369537 Bacteria 6501581
368 2867431772 2867428634 Bacteria 9590268
369 2867479913 2867475112 Bacteria 6909112
370 2873155646 2873151551 Bacteria 8625867
371 2875395630 2875391855 Bacteria 7600475
372 2877681030 2877676314 Bacteria 9512378
373 2912719858 2912715099 Bacteria 9460473
374 2912724276 2912723979 Bacteria 8557534
375 2912760870 2912757875 Bacteria 7940295
376 2918505499 2918501144 Bacteria 8668083
377 2918508726 2918501144 Bacteria 8668083
378 2919469443 2919468124 Bacteria 9133025
379 2935393332 2935390628 Bacteria 7043367
380 2946067843 2946064051 Bacteria 8957905
381 2946075985 2946072368 Bacteria 8999607
382 2947229152 2947224130 Bacteria 9938529
383 2954007288 2954002825 Bacteria 9173742
384 2954386139 2954380949 Bacteria 10050426
385 2954677011 2954673503 Bacteria 9685905
386 2954687146 2954682443 Bacteria 9862841
387 2954696777 2954691527 Bacteria 10720516
388 2954705361 2954701450 Bacteria 10834262
389 2954716156 2954711539 Bacteria 10867210
390 2954726099 2954721474 Bacteria 10456478
391 2954735711 2954731030 Bacteria 10243860
392 2954745025 2954740390 Bacteria 10229294
393 2954754567 2954749733 Bacteria 10366972
394 2954763997 2954759201 Bacteria 9358192
395 2966601731 2966598605 Bacteria 7676064
396 2990063177 2990059506 Bacteria 9321252
397 2997457765 2997451912 Bacteria 8492419
398 2997600345 2997600082 Bacteria 9896405
399 3006324981 3006321560 Bacteria 8247479
400 3006488577 3006486233 Bacteria 8157040
401 3006500836 3006493962 Bacteria 8825450
402 8008567192 8008558824 Bacteria 10610750
403 8008578812 8008574985 Bacteria 7815457
404 8023629822 8023623736 Bacteria 8593882
405 8025417834 8025413630 Bacteria 7014048
406 8025481833 8025478263 Bacteria 8209203
407 8025537932 8025530807 Bacteria 8495698
408 8047898035 8047893842 Bacteria 11723082
409 8048137308 8048127548 Bacteria 11053136
410 8048360858 8048356638 Bacteria 11044339
411 8048374998 8048369669 Bacteria 11666822
412 8048383208 8048379754 Bacteria 11877923
413 8048412658 8048406513 Bacteria 8936924
414 8054161796 8054160619 Bacteria 7783213
415 8056671199 8056667051 Bacteria 6953971
416 8056833540 8056829672 Bacteria 9045328
417 rootH1_10001920
418 rootH2_10014061
419 rootH2_10020257
420 rootL2_10035952
421 rootH1_10002154
422 rootH1_10025203
423 JGI25160J50197_1017732
424 JGI25160J50197_1033450
425 Ga0068853_100025741
426 Ga0068856_100165479
427 Ga0075368_10014167
428 Ga0075363_100056007
429 Ga0075363_100076792
430 Ga0070715_10104945
431 Ga0075367_10000717
432 Ga0105243_10475144
433 Ga0105241_10106956
434 Ga0105246_10004452
435 Ga0157372_10311504
436 Ga0182006_1042582
437 Ga0183367_1005
438 Ga0213875_10027957
439 Ga0209758_1006604
440 Ga0207426_1003083
441 Ga0207426_1021712
442 Ga0207647_10045901
443 Ga0207709_10040321
444 Ga0207639_10081099
445 Ga0207702_10095542
446 Ga0209371_1015397
447 Ga0307517_10003190
448 Ga0307517_10008770
449 Ga0307515_10005593
450 Ga0307515_10048336
451 Ga0307511_10000262
452 Ga0307512_10004180
453 Ga0307513_10055386
454 Ga0307513_10057612
455 Ga0307509_10012491
456 Ga0307509_10024253
457 Ga0307508_10008636
458 Ga0307508_10022018
459 Ga0307508_10052488
460 Ga0307508_10176883
461 Ga0307514_10093419
462 Ga0307514_10158049
463 Ga0307514_10160206
464 Ga0307516_10050195
465 Ga0307507_10014045
466 Ga0307507_10110833
467 Ga0307510_10024338
468 Ga0307510_10043974
469 Ga0307510_10247704
470 Ga0395900_0073190
471 Ga0395898_0037413
472 Ga0395898_0166778
473 Ga0395905_0393627
474 Ga0436364_0151522
475 Ga0395901_0119043
476 Ga0439436_0000491
477 Ga0439448_0006908
478 Ga0439449_0021774
479 Ga0439449_0045841
480 Ga0439457_002018
481 Ga0450894_000035
482 Ga0450898_005703
483 Ga0450899_000155
484 Ga0450900_002295
485 Ga0450902_005498
486 Ga0450903_000067
487 Ga0450903_002769
488 Ga0439458_0000619
489 Ga0439458_0004618
490 Ga0439458_0009226
491 Ga0466969_0005328
492 Ga0466972_0004010
493 Ga0466972_0004844
494 Ga0466972_0020617
495 Ga0466965_0000512
496 Ga0466965_0145102
497 Ga0466966_0000876
498 Ga0466966_0096038
499 Ga0466966_0142934
500 Ga0466961_0013555
501 Ga0466961_0029854
502 Ga0466961_0067060
503 Ga0466963_0000687
504 Ga0466963_0001071
505 Ga0466971_0000608
506 Ga0466971_0020884
507 Ga0466957_0139404
508 Ga0466960_0003180
509 Ga0466959_0002551
510 Ga0466959_0040929
511 Ga0466959_0084113
512 Ga0466967_0009089
513 Ga0466967_0013005
514 Ga0495592_0006582
515 Ga0495592_0022771
516 Ga0495592_0060209
517 Ga0495603_0000270
518 Ga0495603_0002461
519 Ga0495603_0003315
520 Ga0495603_0009629
521 Ga0495603_0039132
522 Ga0495603_0041688
523 Ga0495603_0099148
524 Ga0495603_0178484
525 Ga0495590_0013944
526 Ga0495629_0000848
527 Ga0495629_0008592
528 Ga0495629_0015724
529 Ga0495629_0019026
530 Ga0495629_0026348
531 Ga0495629_0039302
532 Ga0495629_0041908
533 Ga0495629_0055584
534 Ga0495629_0086765
535 Ga0495629_0095548
536 Ga0495638_0017639
537 Ga0495638_0168496
538 Ga0495641_0073763
539 Ga0495651_0003025
540 Ga0495651_0029191
541 Ga0495580_0011350
542 Ga0495580_0172798
543 Ga0495582_0010005
544 Ga0495639_0042752
545 Ga0495662_0010539
546 Ga0495662_0013701
547 Ga0495662_0028210
548 Ga0495662_0120932
549 Ga0495664_0008955
550 Ga0495664_0028359
551 Ga0495584_0021505
552 Ga0495594_0000685
553 Ga0495594_0009988
554 Ga0495594_0011728
555 Ga0495594_0042487
556 Ga0495594_0253470
557 Ga0495607_0022333
558 Ga0495607_0038639
559 Ga0495583_0045900
560 Ga0495608_0008678
561 Ga0495610_0066956
562 Ga0495616_0007630
563 Ga0495618_0180870
564 Ga0495620_0005316
565 Ga0495620_0051637
566 Ga0495628_0001215
567 Ga0495628_0042943
568 Ga0495628_0105731
569 Ga0495630_0046386
570 Ga0495631_0002692
571 Ga0495631_0045372
572 Ga0495637_0015798
573 Ga0495643_0001898
574 Ga0495643_0011742
575 Ga0495644_0085394
576 Ga0495648_0029132
577 Ga0495666_0027501
578 Ga0495666_0033085
579 Ga0495642_0019301
580 Ga0495652_0039648
581 Ga0495652_0200731
582 Ga0495665_0006128
583 Ga0495640_0006459
584 Ga0495640_0020459
585 Ga0495640_0100199
586 Ga0495586_0081541
587 Ga0495587_0181086
588 Ga0495645_0039901
589 Ga0495622_0020181
590 Ga0495622_0060998
591 Ga0495633_0021711
592 Ga0495667_0030124
593 Ga0495667_0097599
594 Ga0495656_0087593
595 Ga0495634_0010274
596 Ga0495611_0007972
597 Ga0495625_0024035
598 Ga0495625_0162058
599 Ga0495635_0068262
600 Ga0495635_0209490
601 Ga0495661_0038762
602 Ga0495588_0053871
603 Ga0495657_0012598
604 Ga0495657_0031794
605 Ga0495657_0172014
606 Ga0495599_0136725
607 Ga0495623_0064896
608 Ga0495623_0076645
609 Ga0495623_0099394
610 Ga0495613_0002098
611 Ga0495613_0006880
612 Ga0495613_0013495
613 Ga0495613_0026173
614 Ga0495613_0027324
615 Ga0495613_0055425
616 Ga0495624_0057033
617 Ga0495670_0048559
618 Ga0495670_0142730
619 Ga0495671_0001574
620 Ga0495671_0035408
621 Ga0495671_0094172
622 Ga0495649_0082700
623 Ga0495589_0029053
624 Ga0495589_0031036
625 Ga0495589_0068471
626 Ga0495600_0010539
627 Ga0495600_0015328
628 Ga0495660_0079346
629 Ga0495581_0027125
630 Ga0495581_0162485
631 Ga0495604_0002884
632 Ga0495604_0023056
633 Ga0495604_0050514
634 Ga0495604_0071715
635 Ga0495636_0001927
636 Ga0495636_0002613
637 Ga0495636_0012537
638 Ga0495674_0089557
639 Ga0495676_0004818
640 Ga0495676_0011812
641 Ga0495676_0016897
642 Ga0495676_0054039
643 Ga0495676_0059091
644 Ga0495680_0006200
645 Ga0495683_0017219
646 Ga0495683_0110694
647 Ga0495687_001373
648 Ga0495687_003246
649 Ga0495687_049062
650 Ga0495675_0037009
651 Ga0495675_0069780
652 Ga0495675_0085566
653 Ga0495677_0017702
654 Ga0495685_002628
655 Ga0495681_0000410
656 Ga0495681_0020081
657 Ga0495681_0062181
658 Ga0495686_0054101
659 Ga0495593_0011498
660 Ga0495593_0084017
661 Ga0495602_0132990
662 Ga0495614_0002050
663 Ga0495614_0039409
664 Ga0495614_0043174
665 Ga0495614_0106913
666 Ga0496109_0128003
667 Ga0496110_0394617
668 Ga0496113_0272024
669 Ga0501031_0025983
670 Ga0501031_0026818
671 Ga0501031_0054128
672 Ga0501031_0163583
673 Ga0501032_0001212
674 Ga0501032_0020809
675 Ga0501032_0156927
676 Ga0501033_0011025
677 Ga0501033_0073379
678 Ga0501033_0103931
679 Ga0501034_0008222
680 Ga0501034_0017553
681 Ga0501034_0035602
682 Ga0501034_0048658
683 Ga0501036_0005926
684 Ga0501036_0029871
685 Ga0501036_0053534
686 Ga0501036_0099546
687 Ga0501037_0000836
688 Ga0501038_0003858
689 Ga0501038_0015424
690 Ga0501038_0020866
691 Ga0501039_0005294
692 Ga0501039_0071699
693 Ga0501040_0101170
694 Ga0501041_0047300
695 Ga0501042_0062830
696 Ga0501043_0005839
697 Ga0501043_0009902
698 Ga0501043_0039014
699 Ga0501043_0071570
700 Ga0501047_0000072
701 Ga0501047_0001607
702 Ga0501047_0012241
703 Ga0501047_0157715
704 Ga0501047_0281013
705 Ga0501048_0049669
706 Ga0501048_0154213
707 Ga0501069_0044638
708 Ga0501071_0000108
709 Ga0501072_0004716
710 Ga0501074_0026157
711 Ga0501076_0010598
712 Ga0501077_0016724
713 Ga0501079_0004100
714 Ga0501080_0025990
715 Ga0501080_0067402
716 Ga0501083_0013397
717 Ga0501035_0024109
718 Ga0501035_0033450
719 Ga0501035_0048089
720 Ga0501035_0050311
721 Ga0501035_0057034
722 Ga0501035_0118381
723 Ga0501044_0015774
724 Ga0501044_0020475
725 Ga0501044_0064992
726 Ga0501044_0174704
727 Ga0501044_0185289
728 nmdc:mga06z11_629_c1
729 Ga0495601_0069865
730 Ga0495655_0046346
731 Ga0500578_0116017
732 Ga0500660_024713
733 Ga0500553_131121
734 Ga0500560_033361
735 Ga0500569_021206
736 Ga0500652_091837
737 Ga0500658_0045030
738 Ga0500561_0005347
739 Ga0500579_067137
740 Ga0500600_0056486
741 Ga0500616_0045671
742 Ga0500633_0004085
743 Ga0500634_0058063
744 Ga0500587_005946
745 Ga0501084_0008714
746 Ga0501082_0006335
747 Ga0530510_0092022
748 2643942364
749 2554257752
750 2585299231
751 2585308885
752 2585313573
753 2616694994
754 2616904559
755 2643765038
756 2643942914
757 2644262376
758 2644389994
759 2644429444
760 2644430373
761 2644461123
762 2784588655
763 2785343198
764 2785369597
765 2786670687
766 2793976179
767 2804846896
768 2809232265
769 2812358000
770 2812480444
771 2819695492
772 2819745240
773 2852636568
774 2862179389
775 2862285743
776 2862294801
777 2862390285
778 2862511724
779 2862579170
780 2863404509
781 2867371964
782 2867431772
783 2867479913
784 2873155646
785 2875395630
786 2877681030
787 2912719858
788 2912724276
789 2912760870
790 2918505499
791 2918508726
792 2919469443
793 2935393332
794 2946067843
795 2946075985
796 2947229152
797 2954007288
798 2954386139
799 2954677011
800 2954687146
801 2954696777
802 2954705361
803 2954716156
804 2954726099
805 2954735711
806 2954745025
807 2954754567
808 2954763997
809 2966601731
810 2990063177
811 2997457765
812 2997600345
813 3006324981
814 3006488577
815 3006500836
816 8008567192
817 8008578812
818 8023629822
819 8025417834
820 8025481833
821 8025537932
822 8047898035
823 8048137308
824 8048360858
825 8048374998
826 8048383208
827 8048412658
828 8054161796
829 8056671199
830 8056833540

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00480

ROK

ROK family

29

327

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p48-assembly1.cif.gz_k staphylococcus aureus ribosome in complex with sal(b) 0.9324 3 30
2oqb-assembly1.cif.gz_B crystal structure of the n-terminal domain of coactivator-associated methyltransferase 1 (carm1) 0.9089 5 31
3ezw-assembly2.cif.gz_C crystal structure of a hyperactive escherichia coli glycerol kinase mutant gly230 --> asp obtained using microfluidic crystallization devices 0.9073 2 32
1qhw-assembly1.cif.gz_A purple acid phosphatase from rat bone 0.9063 3 32
3ezw-assembly2.cif.gz_D crystal structure of a hyperactive escherichia coli glycerol kinase mutant gly230 --> asp obtained using microfluidic crystallization devices 0.9015 2 32
ID Description Score Start End Superfamily
af_Q558S4_217_518_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9851 5 30 3.60.21.10
af_Q54PM7_5_120_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9705 5 32 3.30.420.40
af_K7VRG2_61_286_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9617 1 32 3.60.21.10
af_A0A2R8Q7Q3_23_327_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9265 5 32 3.60.21.10
5nckB02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9264 102 291 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A2P7PLV0-F1-model_v4 deleted 0.9835 178 292
AF-A0A6B3GVD7-F1-model_v4 ROK family protein 0.9829 185 277 GO:0003824
AF-A0A6G3PF92-F1-model_v4 ROK family protein 0.9682 128 292 GO:0003824
AF-A0A6G3X894-F1-model_v4 ROK family protein 0.9482 123 301 GO:0003824
AF-A0A6B3GVD7-F1-model_v4 ROK family protein 0.9334 185 277 GO:0003824

Map