F438376

General Info

Members Datasets Scaffolds Average Seq Length
414 220 828 141

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0648900|Ga0395898_0648900_472_936
Length 154
Sequence MSAWQWLLDSAGAVLLLVLCYGLLLVVRRRVLSRNGGTFELSVRIGARGHAPQAGRGWVLGLGRYRDERLEWFRIFSPSPWPRRTWERPSLQITGQREPSGQEAFALYGGHLVVECRTPQGPVELAMSRSALTGLSSWLEAGPPGADWDRRRAH

Samples

Sample ID Description Type Environment
1 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
136 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
137 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
138 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
144 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
145 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
146 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
147 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
148 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
149 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
150 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
151 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
156 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
157 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
160 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
187 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
188 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
189 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
190 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
191 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
192 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
193 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
194 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
195 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
196 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
197 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
200 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
201 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
202 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
203 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
204 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
205 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
206 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
207 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
208 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
211 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
212 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
213 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
214 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
215 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
216 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
217 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
218 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
219 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
220 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 98.31
Metatranscriptomes 1.21
Isolates 0.48

Biome Distribution

Category Percentage (%)
Aerial Root 0.48
Bulb 0
Endosphere 11.11
Nodule 0
Rhizoplane 5.8
Rhizosphere 81.88
Stem 0
Stem Tuber 0
Unclassified 2.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395898_0648900 3300037466 Bacteria 998
2 JGI24740J21852_10004457 3300001979 Bacteria 6025
3 JGI24738J21930_10003394 3300002075 Bacteria 4026
4 JGI24744J21845_10010533 3300002077 Bacteria 1894
5 JGI24744J21845_10036142 3300002077 Bacteria 933
6 rootH1_10140990 3300003323 Bacteria 1154
7 Ga0070658_10044889 3300005327 Bacteria 3572
8 Ga0070658_10504572 3300005327 Bacteria 1045
9 Ga0070658_10558297 3300005327 Bacteria 991
10 Ga0070683_100067936 3300005329 Bacteria 3320
11 Ga0070683_100094590 3300005329 Bacteria 2808
12 Ga0070683_100170123 3300005329 Bacteria 2068
13 Ga0070683_100600185 3300005329 Bacteria 1053
14 Ga0070683_100602180 3300005329 Bacteria 1052
15 Ga0070683_100850245 3300005329 Bacteria 875
16 Ga0070677_10125317 3300005333 Bacteria 1165
17 Ga0070666_10720348 3300005335 Bacteria 732
18 Ga0070666_10735734 3300005335 Unclassified 724
19 Ga0070680_100243062 3300005336 Bacteria 1521
20 Ga0070680_100449103 3300005336 Bacteria 1101
21 Ga0070682_100045846 3300005337 Bacteria 2711
22 Ga0068868_100090337 3300005338 Bacteria 2466
23 Ga0068868_100292226 3300005338 Bacteria 1382
24 Ga0070660_100012707 3300005339 Bacteria 6018
25 Ga0070660_100158869 3300005339 Bacteria 1821
26 Ga0070660_100174971 3300005339 Bacteria 1735
27 Ga0070660_100377682 3300005339 Bacteria 1170
28 Ga0070660_100528791 3300005339 Bacteria 983
29 Ga0070689_100964360 3300005340 Bacteria 757
30 Ga0070691_10040168 3300005341 Bacteria 2211
31 Ga0070687_100079485 3300005343 Bacteria 1785
32 Ga0070687_100270038 3300005343 Bacteria 1065
33 Ga0070661_101530337 3300005344 Bacteria 563
34 Ga0070692_10010592 3300005345 Bacteria 4205
35 Ga0070668_101428574 3300005347 Bacteria 631
36 Ga0070671_101133955 3300005355 Bacteria 687
37 Ga0070673_100033867 3300005364 Bacteria 3860
38 Ga0070688_100362859 3300005365 Bacteria 1063
39 Ga0070659_100025596 3300005366 Bacteria 4534
40 Ga0070659_100194034 3300005366 Bacteria 1670
41 Ga0070659_100849812 3300005366 Bacteria 796
42 Ga0070667_100055435 3300005367 Bacteria 3347
43 Ga0070667_101043841 3300005367 Unclassified 763
44 Ga0070667_101090883 3300005367 Bacteria 746
45 Ga0070714_100278005 3300005435 Bacteria 1555
46 Ga0070701_10013422 3300005438 Bacteria 3726
47 Ga0070701_10494416 3300005438 Bacteria 793
48 Ga0070700_100004772 3300005441 Bacteria 7112
49 Ga0070663_100830532 3300005455 Bacteria 794
50 Ga0070678_100130670 3300005456 Bacteria 1994
51 Ga0070662_100231430 3300005457 Bacteria 1478
52 Ga0070681_10451910 3300005458 Bacteria 1197
53 Ga0068867_100010226 3300005459 Bacteria 6619
54 Ga0068867_100094461 3300005459 Bacteria 2274
55 Ga0070685_10017612 3300005466 Bacteria 3826
56 Ga0070685_10463652 3300005466 Bacteria 890
57 Ga0070679_100017442 3300005530 Bacteria 6949
58 Ga0070679_100362867 3300005530 Bacteria 1396
59 Ga0070684_100042367 3300005535 Bacteria 3929
60 Ga0070684_100081861 3300005535 Bacteria 2857
61 Ga0070684_100193203 3300005535 Bacteria 1853
62 Ga0070684_101011896 3300005535 Bacteria 780
63 Ga0068853_100044256 3300005539 Bacteria 3810
64 Ga0070672_100001435 3300005543 Bacteria 14737
65 Ga0070695_101579046 3300005545 Bacteria 547
66 Ga0068855_100098154 3300005563 Bacteria 3375
67 Ga0068855_101373996 3300005563 Unclassified 729
68 Ga0070664_100138590 3300005564 Bacteria 2141
69 Ga0070664_100166749 3300005564 Bacteria 1952
70 Ga0070664_101751580 3300005564 Bacteria 589
71 Ga0070664_102062598 3300005564 Bacteria 541
72 Ga0068854_100574698 3300005578 Bacteria 959
73 Ga0068856_100287675 3300005614 Bacteria 1660
74 Ga0070702_100038483 3300005615 Bacteria 2663
75 Ga0068852_100001572 3300005616 Bacteria 15504
76 Ga0068852_100485623 3300005616 Bacteria 1228
77 Ga0068852_101144564 3300005616 Bacteria 799
78 Ga0068852_101295148 3300005616 Unclassified 750
79 Ga0068864_100106265 3300005618 Bacteria 2496
80 Ga0068864_100281967 3300005618 Bacteria 1551
81 Ga0068866_10006228 3300005718 Bacteria 4967
82 Ga0068866_10291835 3300005718 Bacteria 1015
83 Ga0068861_100002879 3300005719 Bacteria 11337
84 Ga0068861_101572596 3300005719 Bacteria 647
85 Ga0068863_101584168 3300005841 Bacteria 664
86 Ga0068858_100659695 3300005842 Bacteria 1017
87 Ga0068862_101105808 3300005844 Bacteria 788
88 Ga0075365_10006271 3300006038 Bacteria 6523
89 Ga0075365_10152057 3300006038 Bacteria 1610
90 Ga0075365_10692530 3300006038 Bacteria 720
91 Ga0075368_10008812 3300006042 Bacteria 3612
92 Ga0075363_100004653 3300006048 Bacteria 6034
93 Ga0075363_100154791 3300006048 Bacteria 1295
94 Ga0075364_10014539 3300006051 Bacteria 4865
95 Ga0075364_10020339 3300006051 Bacteria 4175
96 Ga0075364_10082155 3300006051 Bacteria 2131
97 Ga0075364_10150991 3300006051 Bacteria 1566
98 Ga0075364_10273341 3300006051 Bacteria 1149
99 Ga0075364_10281907 3300006051 Bacteria 1130
100 Ga0075364_10373902 3300006051 Bacteria 972
101 Ga0075364_10968277 3300006051 Bacteria 579
102 Ga0075362_10029354 3300006177 Bacteria 2369
103 Ga0075362_10132428 3300006177 Bacteria 1187
104 Ga0075367_10065407 3300006178 Bacteria 2177
105 Ga0075367_10081753 3300006178 Bacteria 1955
106 Ga0075367_10246090 3300006178 Bacteria 1121
107 Ga0097621_100857636 3300006237 Bacteria 844
108 Ga0075370_10004115 3300006353 Bacteria 7008
109 Ga0075428_100162769 3300006844 Bacteria 2421
110 Ga0111539_10151625 3300009094 Bacteria 2713
111 Ga0105245_10075157 3300009098 Bacteria 3076
112 Ga0105245_11095398 3300009098 Bacteria 843
113 Ga0105243_10002624 3300009148 Bacteria 14957
114 Ga0105243_10341556 3300009148 Bacteria 1372
115 Ga0105242_10166536 3300009176 Bacteria 1934
116 Ga0105242_10659596 3300009176 Bacteria 1018
117 Ga0105242_10830468 3300009176 Bacteria 917
118 Ga0105248_10017329 3300009177 Bacteria 7938
119 Ga0105248_10067811 3300009177 Bacteria 4005
120 Ga0105248_11024301 3300009177 Bacteria 933
121 Ga0105237_10087694 3300009545 Bacteria 3101
122 Ga0105238_10331747 3300009551 Bacteria 1508
123 Ga0105238_10362188 3300009551 Bacteria 1440
124 Ga0105238_10423860 3300009551 Bacteria 1325
125 Ga0105238_10951115 3300009551 Bacteria 879
126 Ga0105249_10024107 3300009553 Bacteria 5466
127 Ga0105249_10729942 3300009553 Bacteria 1052
128 Ga0105249_11046718 3300009553 Bacteria 885
129 Ga0105249_11216720 3300009553 Bacteria 824
130 Ga0105239_10513206 3300010375 Bacteria 1363
131 Ga0105239_11039363 3300010375 Bacteria 942
132 Ga0105239_11128732 3300010375 Bacteria 903
133 Ga0105239_12514673 3300010375 Bacteria 600
134 Ga0105246_10034216 3300011119 Bacteria 3384
135 Ga0105246_10146836 3300011119 Bacteria 1780
136 Ga0105246_10274214 3300011119 Bacteria 1350
137 Ga0157328_1003892 3300012478 Bacteria 804
138 Ga0157369_10353184 3300013105 Bacteria 1527
139 Ga0163162_11938292 3300013306 Bacteria 675
140 Ga0157372_10102119 3300013307 Bacteria 3275
141 Ga0157372_10167852 3300013307 Bacteria 2538
142 Ga0157372_10237337 3300013307 Bacteria 2115
143 Ga0157372_10340195 3300013307 Bacteria 1748
144 Ga0157372_10659539 3300013307 Bacteria 1218
145 Ga0157372_11122550 3300013307 Bacteria 909
146 Ga0157372_11236092 3300013307 Bacteria 863
147 Ga0157372_11332032 3300013307 Bacteria 828
148 Ga0157375_10450218 3300013308 Bacteria 1453
149 Ga0157375_11473805 3300013308 Archaea 803
150 Ga0163163_11496083 3300014325 Bacteria 736
151 Ga0157380_10063708 3300014326 Bacteria 2957
152 Ga0182008_10032354 3300014497 Bacteria 2628
153 Ga0182008_10192750 3300014497 Bacteria 1035
154 Ga0182008_10615407 3300014497 Bacteria 611
155 Ga0157377_10108310 3300014745 Bacteria 1667
156 Ga0157377_10150098 3300014745 Bacteria 1440
157 Ga0157376_10785505 3300014969 Bacteria 964
158 Ga0163161_10460713 3300017792 Bacteria 1029
159 Ga0206356_11795050 3300020070 Bacteria 694
160 Ga0206354_11494979 3300020081 Bacteria 532
161 Ga0206353_10873897 3300020082 Bacteria 1428
162 Ga0206353_11624263 3300020082 Bacteria 953
163 Ga0224712_10227125 3300022467 Bacteria 856
164 Ga0207642_10025777 3300025899 Bacteria 2384
165 Ga0207688_10052586 3300025901 Bacteria 2283
166 Ga0207688_10086192 3300025901 Bacteria 1799
167 Ga0207647_10016392 3300025904 Bacteria 5058
168 Ga0207647_10253544 3300025904 Bacteria 1009
169 Ga0207643_10009157 3300025908 Bacteria 5318
170 Ga0207705_10722101 3300025909 Bacteria 774
171 Ga0207707_10583900 3300025912 Bacteria 947
172 Ga0207660_10052241 3300025917 Bacteria 2909
173 Ga0207660_10288792 3300025917 Bacteria 1304
174 Ga0207662_10291503 3300025918 Bacteria 1082
175 Ga0207657_10010772 3300025919 Bacteria 9102
176 Ga0207657_10166579 3300025919 Bacteria 1787
177 Ga0207657_10295111 3300025919 Bacteria 1285
178 Ga0207649_10885076 3300025920 Bacteria 700
179 Ga0207652_10026389 3300025921 Bacteria 4838
180 Ga0207652_10738687 3300025921 Bacteria 877
181 Ga0207694_10061807 3300025924 Bacteria 2915
182 Ga0207687_10091981 3300025927 Bacteria 2214
183 Ga0207664_10020601 3300025929 Bacteria 4891
184 Ga0207690_10008534 3300025932 Bacteria 6080
185 Ga0207690_10156398 3300025932 Bacteria 1695
186 Ga0207690_10458960 3300025932 Bacteria 1025
187 Ga0207686_10243100 3300025934 Bacteria 1311
188 Ga0207686_10507542 3300025934 Bacteria 937
189 Ga0207709_10060215 3300025935 Bacteria 2366
190 Ga0207709_10084565 3300025935 Bacteria 2054
191 Ga0207709_10173727 3300025935 Bacteria 1515
192 Ga0207709_10388973 3300025935 Bacteria 1063
193 Ga0207709_10841404 3300025935 Bacteria 743
194 Ga0207670_10298704 3300025936 Bacteria 1260
195 Ga0207669_10571329 3300025937 Bacteria 915
196 Ga0207691_10062368 3300025940 Bacteria 3383
197 Ga0207711_10097208 3300025941 Bacteria 2600
198 Ga0207711_10139603 3300025941 Bacteria 2179
199 Ga0207689_11186457 3300025942 Unclassified 643
200 Ga0207661_10041312 3300025944 Bacteria 3630
201 Ga0207661_10117959 3300025944 Bacteria 2255
202 Ga0207661_10184524 3300025944 Bacteria 1825
203 Ga0207661_10253101 3300025944 Bacteria 1566
204 Ga0207661_10287467 3300025944 Bacteria 1471
205 Ga0207661_10300835 3300025944 Bacteria 1438
206 Ga0207661_10424907 3300025944 Bacteria 1207
207 Ga0207661_10575201 3300025944 Bacteria 1033
208 Ga0207679_10022401 3300025945 Bacteria 4301
209 Ga0207679_10082038 3300025945 Bacteria 2467
210 Ga0207667_10821925 3300025949 Unclassified 925
211 Ga0207651_10279011 3300025960 Bacteria 1380
212 Ga0207712_10021143 3300025961 Bacteria 4269
213 Ga0207712_10497917 3300025961 Bacteria 1041
214 Ga0207668_10839266 3300025972 Bacteria 815
215 Ga0207640_10064841 3300025981 Bacteria 2435
216 Ga0207658_10755432 3300025986 Unclassified 881
217 Ga0207703_10608881 3300026035 Bacteria 1034
218 Ga0207639_10027370 3300026041 Bacteria 4154
219 Ga0207678_10209592 3300026067 Bacteria 1667
220 Ga0207678_10283085 3300026067 Bacteria 1423
221 Ga0207708_10000521 3300026075 Bacteria 29697
222 Ga0207702_10222786 3300026078 Bacteria 1758
223 Ga0207648_10034156 3300026089 Bacteria 4485
224 Ga0207648_10174913 3300026089 Bacteria 1898
225 Ga0207648_11274682 3300026089 Bacteria 690
226 Ga0207648_11293942 3300026089 Bacteria 685
227 Ga0207676_10121855 3300026095 Bacteria 2201
228 Ga0207676_10174717 3300026095 Bacteria 1875
229 Ga0207674_10491947 3300026116 Bacteria 1185
230 Ga0207675_100005382 3300026118 Bacteria 12281
231 Ga0207675_100536066 3300026118 Bacteria 1168
232 Ga0207675_100590618 3300026118 Bacteria 1113
233 Ga0207698_10381330 3300026142 Bacteria 1341
234 Ga0207698_10843707 3300026142 Bacteria 921
235 Ga0209813_10005278 3300027866 Bacteria 3127
236 Ga0209813_10210807 3300027866 Bacteria 723
237 Ga0268266_10003554 3300028379 Bacteria 15459
238 Ga0268265_11162411 3300028380 Bacteria 768
239 Ga0307408_100953593 3300031548 Bacteria 788
240 Ga0307413_10869211 3300031824 Unclassified 763
241 Ga0307410_10163847 3300031852 Unclassified 1669
242 Ga0307406_10807888 3300031901 Bacteria 792
243 Ga0307409_100329626 3300031995 Bacteria 1432
244 Ga0307409_100336287 3300031995 Bacteria 1419
245 Ga0307409_101138973 3300031995 Bacteria 802
246 Ga0307416_100255801 3300032002 Bacteria 1708
247 Ga0307416_100801030 3300032002 Bacteria 1038
248 Ga0307416_101226199 3300032002 Unclassified 856
249 Ga0307416_103197570 3300032002 Bacteria 548
250 Ga0307411_10670689 3300032005 Unclassified 900
251 Ga0373950_0014668 3300034818 Bacteria 1321
252 Ga0373960_0228953 3300035121 Bacteria 668
253 Ga0373931_0228376 3300035691 Bacteria 1124
254 Ga0373947_0259639 3300035725 Bacteria 1151
255 Ga0395899_0030426 3300037312 Bacteria 4061
256 Ga0395900_0365645 3300037418 Bacteria 1413
257 Ga0395898_0878514 3300037466 Bacteria 835
258 Ga0395901_0083153 3300038443 Bacteria 3346
259 Ga0395901_0934884 3300038443 Bacteria 847
260 Ga0436365_1133208 3300039437 Bacteria 2058
261 Ga0451800_0830220 3300041459 Bacteria 562
262 Ga0451837_1635224 3300041494 Bacteria 589
263 Ga0439448_0156996 3300042005 Bacteria 791
264 Ga0439448_0302578 3300042005 Bacteria 568
265 Ga0439448_0343381 3300042005 Bacteria 532
266 Ga0439464_0091054 3300042439 Bacteria 919
267 Ga0466972_0249524 3300044658 Bacteria 830
268 Ga0466965_0353284 3300044683 Bacteria 805
269 Ga0466966_0092820 3300044684 Bacteria 1872
270 Ga0466963_0023429 3300044694 Bacteria 3921
271 Ga0466963_0169039 3300044694 Bacteria 1524
272 Ga0466963_0207107 3300044694 Bacteria 1372
273 Ga0466963_0260872 3300044694 Bacteria 1217
274 Ga0466971_0111765 3300044719 Bacteria 1261
275 Ga0466959_0027904 3300045049 Bacteria 4187
276 Ga0466958_0030740 3300045836 Bacteria 3191
277 Ga0466958_0094595 3300045836 Bacteria 1852
278 Ga0466967_0025380 3300045976 Bacteria 4886
279 Ga0466967_0029372 3300045976 Bacteria 4600
280 Ga0466967_0067181 3300045976 Bacteria 3197
281 Ga0495603_0206636 3300046455 Bacteria 1134
282 Ga0495641_0117664 3300046461 Bacteria 1185
283 Ga0495639_0075381 3300046475 Bacteria 1564
284 Ga0495634_0751492 3300046642 Bacteria 558
285 Ga0495657_0658056 3300046675 Bacteria 604
286 Ga0495615_0317786 3300048090 Bacteria 508
287 Ga0496101_0007834 3300048904 Bacteria 6947
288 Ga0496102_0056449 3300048905 Bacteria 3582
289 Ga0496102_0328777 3300048905 Bacteria 1440
290 Ga0496103_0034526 3300048906 Bacteria 3093
291 Ga0496103_0276271 3300048906 Bacteria 1081
292 Ga0496104_0465216 3300048907 Bacteria 1176
293 Ga0496105_0226577 3300048908 Bacteria 1520
294 Ga0496106_0002008 3300048909 Bacteria 15300
295 Ga0496106_0156337 3300048909 Bacteria 1801
296 Ga0496106_0696752 3300048909 Unclassified 810
297 Ga0496107_0043327 3300048910 Bacteria 3233
298 Ga0496107_0304266 3300048910 Bacteria 1187
299 Ga0496108_0074205 3300048911 Bacteria 2872
300 Ga0496108_0302383 3300048911 Bacteria 1393
301 Ga0496108_1535442 3300048911 Bacteria 553
302 Ga0496109_0318502 3300048912 Bacteria 1467
303 Ga0496110_0035781 3300048913 Bacteria 4310
304 Ga0496110_0125908 3300048913 Bacteria 2312
305 Ga0496111_0116171 3300048914 Bacteria 1973
306 Ga0496112_0434877 3300048915 Bacteria 1250
307 Ga0496114_0055138 3300048917 Bacteria 3315
308 Ga0496114_0298388 3300048917 Bacteria 1422
309 Ga0496114_1013568 3300048917 Bacteria 714
310 Ga0501031_0064519 3300049568 Bacteria 2385
311 Ga0501031_0296224 3300049568 Bacteria 1049
312 Ga0501031_0364995 3300049568 Bacteria 934
313 Ga0501034_0047995 3300049571 Bacteria 4309
314 Ga0501034_0173708 3300049571 Bacteria 2121
315 Ga0501036_0184572 3300049572 Bacteria 1755
316 Ga0501036_0185467 3300049572 Bacteria 1751
317 Ga0501037_0405387 3300049573 Bacteria 935
318 Ga0501038_0329559 3300049574 Bacteria 1193
319 Ga0501039_0133621 3300049575 Bacteria 1948
320 Ga0501039_0160096 3300049575 Bacteria 1769
321 Ga0501039_0508686 3300049575 Bacteria 946
322 Ga0501040_0411025 3300049576 Bacteria 972
323 Ga0501042_0192108 3300049578 Bacteria 1473
324 Ga0501042_0295169 3300049578 Bacteria 1171
325 Ga0501042_0529379 3300049578 Bacteria 856
326 Ga0501043_0150764 3300049579 Bacteria 1820
327 Ga0501046_0086544 3300049580 Bacteria 2416
328 Ga0501047_0308291 3300049581 Bacteria 1424
329 Ga0501048_0458185 3300049582 Bacteria 913
330 Ga0501067_0001805 3300049583 Bacteria 11762
331 Ga0501067_0004041 3300049583 Bacteria 8094
332 Ga0501067_0039668 3300049583 Bacteria 2614
333 Ga0501067_0044221 3300049583 Bacteria 2474
334 Ga0501067_0109650 3300049583 Bacteria 1535
335 Ga0501067_0111504 3300049583 Bacteria 1521
336 Ga0501068_0001043 3300049584 Bacteria 14664
337 Ga0501068_0024426 3300049584 Bacteria 3549
338 Ga0501069_0072191 3300049585 Bacteria 1935
339 Ga0501069_0083995 3300049585 Bacteria 1796
340 Ga0501069_0088250 3300049585 Bacteria 1752
341 Ga0501069_0089782 3300049585 Bacteria 1737
342 Ga0501069_0172861 3300049585 Bacteria 1247
343 Ga0501069_0193837 3300049585 Bacteria 1176
344 Ga0501070_0002400 3300049586 Bacteria 16438
345 Ga0501070_0015798 3300049586 Bacteria 6348
346 Ga0501070_0021005 3300049586 Bacteria 5477
347 Ga0501070_0027181 3300049586 Bacteria 4799
348 Ga0501070_0046411 3300049586 Bacteria 3613
349 Ga0501070_0184716 3300049586 Bacteria 1715
350 Ga0501070_0445540 3300049586 Bacteria 1044
351 Ga0501071_0052997 3300049587 Bacteria 2925
352 Ga0501071_0351299 3300049587 Bacteria 1122
353 Ga0501071_0983575 3300049587 Bacteria 652
354 Ga0501071_1326350 3300049587 Bacteria 556
355 Ga0501072_0008525 3300049588 Bacteria 7775
356 Ga0501072_0028242 3300049588 Bacteria 4380
357 Ga0501072_0571938 3300049588 Bacteria 892
358 Ga0501073_0013006 3300049589 Bacteria 6068
359 Ga0501074_0006675 3300049590 Bacteria 8335
360 Ga0501074_0007583 3300049590 Bacteria 7851
361 Ga0501074_0011144 3300049590 Bacteria 6532
362 Ga0501074_0642830 3300049590 Bacteria 750
363 Ga0501075_0468223 3300049591 Bacteria 961
364 Ga0501075_1134522 3300049591 Bacteria 593
365 Ga0501076_0062224 3300049592 Bacteria 2972
366 Ga0501076_0722682 3300049592 Bacteria 822
367 Ga0501077_0173565 3300049593 Bacteria 1370
368 Ga0501077_0242130 3300049593 Bacteria 1147
369 Ga0501079_0011570 3300049741 Bacteria 6736
370 Ga0501080_0010051 3300049742 Bacteria 8649
371 Ga0501080_0018168 3300049742 Bacteria 6508
372 Ga0501080_0131200 3300049742 Bacteria 2320
373 Ga0501080_0539165 3300049742 Bacteria 1040
374 Ga0501081_0293001 3300049743 Bacteria 1193
375 Ga0501081_0821539 3300049743 Bacteria 700
376 Ga0501083_0017881 3300049744 Bacteria 4945
377 Ga0501035_0293512 3300049822 Bacteria 1372
378 Ga0501035_0350138 3300049822 Bacteria 1236
379 nmdc:mga03683_174626_c1 3300050489 Bacteria 978
380 nmdc:mga03683_227199_c1 3300050489 Bacteria 862
381 nmdc:mga03n38_118823_c1 3300050490 Bacteria 1297
382 nmdc:mga03n38_164944_c1 3300050490 Bacteria 1124
383 nmdc:mga03n38_2634_c1 3300050490 Bacteria 5600
384 nmdc:mga00v17_267655_c1 3300050491 Bacteria 1109
385 nmdc:mga00v17_361180_c1 3300050491 Bacteria 944
386 nmdc:mga00v17_7696_c1 3300050491 Bacteria 5764
387 nmdc:mga00v17_7959_c1 3300050491 Bacteria 5681
388 nmdc:mga00v17_99251_c1 3300050491 Bacteria 1837
389 nmdc:mga0yw44_1197546_c1 3300050492 Bacteria 512
390 nmdc:mga0yw44_33432_c1 3300050492 Bacteria 3005
391 nmdc:mga0yw44_93254_c1 3300050492 Bacteria 1906
392 nmdc:mga0yw44_96614_c1 3300050492 Bacteria 1876
393 nmdc:mga06z11_104949_c1 3300050494 Bacteria 1556
394 nmdc:mga06z11_155970_c1 3300050494 Bacteria 1302
395 nmdc:mga04h51_133035_c1 3300050495 Bacteria 937
396 nmdc:mga04h51_29254_c1 3300050495 Bacteria 1725
397 nmdc:mga07m45_106032_c1 3300050496 Bacteria 1616
398 nmdc:mga07m45_8365_c1 3300050496 Bacteria 5316
399 nmdc:mga08y16_124167_c1 3300050511 Bacteria 2686
400 nmdc:mga08y16_381131_c1 3300050511 Bacteria 1445
401 Ga0495619_0523044 3300053085 Bacteria 815
402 Ga0500644_0000291 3300053088 Bacteria 27174
403 Ga0500655_063884 3300053133 Bacteria 744
404 Ga0500568_0279503 3300053139 Bacteria 607
405 Ga0500604_0291014 3300053151 Bacteria 566
406 Ga0501084_0111800 3300054114 Bacteria 2295
407 Ga0501084_0272933 3300054114 Bacteria 1428
408 Ga0501084_0465645 3300054114 Bacteria 1069
409 Ga0501082_0057127 3300060353 Bacteria 3362
410 Ga0501082_0915648 3300060353 Bacteria 767
411 Ga0466962_0044479 3300061719 Bacteria 2124
412 Ga0530510_0176691 3300061734 Bacteria 1583
413 2984576832 2984576629 Bacteria 4248407
414 2990258580 2990256926 Bacteria 4252839
415 Ga0395898_0648900
416 JGI24740J21852_10004457
417 JGI24738J21930_10003394
418 JGI24744J21845_10010533
419 JGI24744J21845_10036142
420 rootH1_10140990
421 Ga0070658_10044889
422 Ga0070658_10504572
423 Ga0070658_10558297
424 Ga0070683_100067936
425 Ga0070683_100094590
426 Ga0070683_100170123
427 Ga0070683_100600185
428 Ga0070683_100602180
429 Ga0070683_100850245
430 Ga0070677_10125317
431 Ga0070666_10720348
432 Ga0070666_10735734
433 Ga0070680_100243062
434 Ga0070680_100449103
435 Ga0070682_100045846
436 Ga0068868_100090337
437 Ga0068868_100292226
438 Ga0070660_100012707
439 Ga0070660_100158869
440 Ga0070660_100174971
441 Ga0070660_100377682
442 Ga0070660_100528791
443 Ga0070689_100964360
444 Ga0070691_10040168
445 Ga0070687_100079485
446 Ga0070687_100270038
447 Ga0070661_101530337
448 Ga0070692_10010592
449 Ga0070668_101428574
450 Ga0070671_101133955
451 Ga0070673_100033867
452 Ga0070688_100362859
453 Ga0070659_100025596
454 Ga0070659_100194034
455 Ga0070659_100849812
456 Ga0070667_100055435
457 Ga0070667_101043841
458 Ga0070667_101090883
459 Ga0070714_100278005
460 Ga0070701_10013422
461 Ga0070701_10494416
462 Ga0070700_100004772
463 Ga0070663_100830532
464 Ga0070678_100130670
465 Ga0070662_100231430
466 Ga0070681_10451910
467 Ga0068867_100010226
468 Ga0068867_100094461
469 Ga0070685_10017612
470 Ga0070685_10463652
471 Ga0070679_100017442
472 Ga0070679_100362867
473 Ga0070684_100042367
474 Ga0070684_100081861
475 Ga0070684_100193203
476 Ga0070684_101011896
477 Ga0068853_100044256
478 Ga0070672_100001435
479 Ga0070695_101579046
480 Ga0068855_100098154
481 Ga0068855_101373996
482 Ga0070664_100138590
483 Ga0070664_100166749
484 Ga0070664_101751580
485 Ga0070664_102062598
486 Ga0068854_100574698
487 Ga0068856_100287675
488 Ga0070702_100038483
489 Ga0068852_100001572
490 Ga0068852_100485623
491 Ga0068852_101144564
492 Ga0068852_101295148
493 Ga0068864_100106265
494 Ga0068864_100281967
495 Ga0068866_10006228
496 Ga0068866_10291835
497 Ga0068861_100002879
498 Ga0068861_101572596
499 Ga0068863_101584168
500 Ga0068858_100659695
501 Ga0068862_101105808
502 Ga0075365_10006271
503 Ga0075365_10152057
504 Ga0075365_10692530
505 Ga0075368_10008812
506 Ga0075363_100004653
507 Ga0075363_100154791
508 Ga0075364_10014539
509 Ga0075364_10020339
510 Ga0075364_10082155
511 Ga0075364_10150991
512 Ga0075364_10273341
513 Ga0075364_10281907
514 Ga0075364_10373902
515 Ga0075364_10968277
516 Ga0075362_10029354
517 Ga0075362_10132428
518 Ga0075367_10065407
519 Ga0075367_10081753
520 Ga0075367_10246090
521 Ga0097621_100857636
522 Ga0075370_10004115
523 Ga0075428_100162769
524 Ga0111539_10151625
525 Ga0105245_10075157
526 Ga0105245_11095398
527 Ga0105243_10002624
528 Ga0105243_10341556
529 Ga0105242_10166536
530 Ga0105242_10659596
531 Ga0105242_10830468
532 Ga0105248_10017329
533 Ga0105248_10067811
534 Ga0105248_11024301
535 Ga0105237_10087694
536 Ga0105238_10331747
537 Ga0105238_10362188
538 Ga0105238_10423860
539 Ga0105238_10951115
540 Ga0105249_10024107
541 Ga0105249_10729942
542 Ga0105249_11046718
543 Ga0105249_11216720
544 Ga0105239_10513206
545 Ga0105239_11039363
546 Ga0105239_11128732
547 Ga0105239_12514673
548 Ga0105246_10034216
549 Ga0105246_10146836
550 Ga0105246_10274214
551 Ga0157328_1003892
552 Ga0157369_10353184
553 Ga0163162_11938292
554 Ga0157372_10102119
555 Ga0157372_10167852
556 Ga0157372_10237337
557 Ga0157372_10340195
558 Ga0157372_10659539
559 Ga0157372_11122550
560 Ga0157372_11236092
561 Ga0157372_11332032
562 Ga0157375_10450218
563 Ga0157375_11473805
564 Ga0163163_11496083
565 Ga0157380_10063708
566 Ga0182008_10032354
567 Ga0182008_10192750
568 Ga0182008_10615407
569 Ga0157377_10108310
570 Ga0157377_10150098
571 Ga0157376_10785505
572 Ga0163161_10460713
573 Ga0206356_11795050
574 Ga0206354_11494979
575 Ga0206353_10873897
576 Ga0206353_11624263
577 Ga0224712_10227125
578 Ga0207642_10025777
579 Ga0207688_10052586
580 Ga0207688_10086192
581 Ga0207647_10016392
582 Ga0207647_10253544
583 Ga0207643_10009157
584 Ga0207705_10722101
585 Ga0207707_10583900
586 Ga0207660_10052241
587 Ga0207660_10288792
588 Ga0207662_10291503
589 Ga0207657_10010772
590 Ga0207657_10166579
591 Ga0207657_10295111
592 Ga0207649_10885076
593 Ga0207652_10026389
594 Ga0207652_10738687
595 Ga0207694_10061807
596 Ga0207687_10091981
597 Ga0207664_10020601
598 Ga0207690_10008534
599 Ga0207690_10156398
600 Ga0207690_10458960
601 Ga0207686_10243100
602 Ga0207686_10507542
603 Ga0207709_10060215
604 Ga0207709_10084565
605 Ga0207709_10173727
606 Ga0207709_10388973
607 Ga0207709_10841404
608 Ga0207670_10298704
609 Ga0207669_10571329
610 Ga0207691_10062368
611 Ga0207711_10097208
612 Ga0207711_10139603
613 Ga0207689_11186457
614 Ga0207661_10041312
615 Ga0207661_10117959
616 Ga0207661_10184524
617 Ga0207661_10253101
618 Ga0207661_10287467
619 Ga0207661_10300835
620 Ga0207661_10424907
621 Ga0207661_10575201
622 Ga0207679_10022401
623 Ga0207679_10082038
624 Ga0207667_10821925
625 Ga0207651_10279011
626 Ga0207712_10021143
627 Ga0207712_10497917
628 Ga0207668_10839266
629 Ga0207640_10064841
630 Ga0207658_10755432
631 Ga0207703_10608881
632 Ga0207639_10027370
633 Ga0207678_10209592
634 Ga0207678_10283085
635 Ga0207708_10000521
636 Ga0207702_10222786
637 Ga0207648_10034156
638 Ga0207648_10174913
639 Ga0207648_11274682
640 Ga0207648_11293942
641 Ga0207676_10121855
642 Ga0207676_10174717
643 Ga0207674_10491947
644 Ga0207675_100005382
645 Ga0207675_100536066
646 Ga0207675_100590618
647 Ga0207698_10381330
648 Ga0207698_10843707
649 Ga0209813_10005278
650 Ga0209813_10210807
651 Ga0268266_10003554
652 Ga0268265_11162411
653 Ga0307408_100953593
654 Ga0307413_10869211
655 Ga0307410_10163847
656 Ga0307406_10807888
657 Ga0307409_100329626
658 Ga0307409_100336287
659 Ga0307409_101138973
660 Ga0307416_100255801
661 Ga0307416_100801030
662 Ga0307416_101226199
663 Ga0307416_103197570
664 Ga0307411_10670689
665 Ga0373950_0014668
666 Ga0373960_0228953
667 Ga0373931_0228376
668 Ga0373947_0259639
669 Ga0395899_0030426
670 Ga0395900_0365645
671 Ga0395898_0878514
672 Ga0395901_0083153
673 Ga0395901_0934884
674 Ga0436365_1133208
675 Ga0451800_0830220
676 Ga0451837_1635224
677 Ga0439448_0156996
678 Ga0439448_0302578
679 Ga0439448_0343381
680 Ga0439464_0091054
681 Ga0466972_0249524
682 Ga0466965_0353284
683 Ga0466966_0092820
684 Ga0466963_0023429
685 Ga0466963_0169039
686 Ga0466963_0207107
687 Ga0466963_0260872
688 Ga0466971_0111765
689 Ga0466959_0027904
690 Ga0466958_0030740
691 Ga0466958_0094595
692 Ga0466967_0025380
693 Ga0466967_0029372
694 Ga0466967_0067181
695 Ga0495603_0206636
696 Ga0495641_0117664
697 Ga0495639_0075381
698 Ga0495634_0751492
699 Ga0495657_0658056
700 Ga0495615_0317786
701 Ga0496101_0007834
702 Ga0496102_0056449
703 Ga0496102_0328777
704 Ga0496103_0034526
705 Ga0496103_0276271
706 Ga0496104_0465216
707 Ga0496105_0226577
708 Ga0496106_0002008
709 Ga0496106_0156337
710 Ga0496106_0696752
711 Ga0496107_0043327
712 Ga0496107_0304266
713 Ga0496108_0074205
714 Ga0496108_0302383
715 Ga0496108_1535442
716 Ga0496109_0318502
717 Ga0496110_0035781
718 Ga0496110_0125908
719 Ga0496111_0116171
720 Ga0496112_0434877
721 Ga0496114_0055138
722 Ga0496114_0298388
723 Ga0496114_1013568
724 Ga0501031_0064519
725 Ga0501031_0296224
726 Ga0501031_0364995
727 Ga0501034_0047995
728 Ga0501034_0173708
729 Ga0501036_0184572
730 Ga0501036_0185467
731 Ga0501037_0405387
732 Ga0501038_0329559
733 Ga0501039_0133621
734 Ga0501039_0160096
735 Ga0501039_0508686
736 Ga0501040_0411025
737 Ga0501042_0192108
738 Ga0501042_0295169
739 Ga0501042_0529379
740 Ga0501043_0150764
741 Ga0501046_0086544
742 Ga0501047_0308291
743 Ga0501048_0458185
744 Ga0501067_0001805
745 Ga0501067_0004041
746 Ga0501067_0039668
747 Ga0501067_0044221
748 Ga0501067_0109650
749 Ga0501067_0111504
750 Ga0501068_0001043
751 Ga0501068_0024426
752 Ga0501069_0072191
753 Ga0501069_0083995
754 Ga0501069_0088250
755 Ga0501069_0089782
756 Ga0501069_0172861
757 Ga0501069_0193837
758 Ga0501070_0002400
759 Ga0501070_0015798
760 Ga0501070_0021005
761 Ga0501070_0027181
762 Ga0501070_0046411
763 Ga0501070_0184716
764 Ga0501070_0445540
765 Ga0501071_0052997
766 Ga0501071_0351299
767 Ga0501071_0983575
768 Ga0501071_1326350
769 Ga0501072_0008525
770 Ga0501072_0028242
771 Ga0501072_0571938
772 Ga0501073_0013006
773 Ga0501074_0006675
774 Ga0501074_0007583
775 Ga0501074_0011144
776 Ga0501074_0642830
777 Ga0501075_0468223
778 Ga0501075_1134522
779 Ga0501076_0062224
780 Ga0501076_0722682
781 Ga0501077_0173565
782 Ga0501077_0242130
783 Ga0501079_0011570
784 Ga0501080_0010051
785 Ga0501080_0018168
786 Ga0501080_0131200
787 Ga0501080_0539165
788 Ga0501081_0293001
789 Ga0501081_0821539
790 Ga0501083_0017881
791 Ga0501035_0293512
792 Ga0501035_0350138
793 nmdc:mga03683_174626_c1
794 nmdc:mga03683_227199_c1
795 nmdc:mga03n38_118823_c1
796 nmdc:mga03n38_164944_c1
797 nmdc:mga03n38_2634_c1
798 nmdc:mga00v17_267655_c1
799 nmdc:mga00v17_361180_c1
800 nmdc:mga00v17_7696_c1
801 nmdc:mga00v17_7959_c1
802 nmdc:mga00v17_99251_c1
803 nmdc:mga0yw44_1197546_c1
804 nmdc:mga0yw44_33432_c1
805 nmdc:mga0yw44_93254_c1
806 nmdc:mga0yw44_96614_c1
807 nmdc:mga06z11_104949_c1
808 nmdc:mga06z11_155970_c1
809 nmdc:mga04h51_133035_c1
810 nmdc:mga04h51_29254_c1
811 nmdc:mga07m45_106032_c1
812 nmdc:mga07m45_8365_c1
813 nmdc:mga08y16_124167_c1
814 nmdc:mga08y16_381131_c1
815 Ga0495619_0523044
816 Ga0500644_0000291
817 Ga0500655_063884
818 Ga0500568_0279503
819 Ga0500604_0291014
820 Ga0501084_0111800
821 Ga0501084_0272933
822 Ga0501084_0465645
823 Ga0501082_0057127
824 Ga0501082_0915648
825 Ga0466962_0044479
826 Ga0530510_0176691
827 2984576832
828 2990258580

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10739

DUF2550

Protein of unknown function (DUF2550)

15

145

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i5c-assembly3.cif.gz_C crystal structure of the c-terminal ph domain of pleckstrin in complex with d-myo-ins(1,2,3,4,5)p5 0.7186 23 122
2yf0-assembly1.cif.gz_A-2 human myotubularin related protein 6 (mtmr6) 0.7135 26 122
7byj-assembly1.cif.gz_A crystal structure of the ferm domain of frmpd4 0.6992 21 120
5umr-assembly1.cif.gz_A crystal structure of n-terminal domain of human fact complex subunit ssrp1 0.6985 23 122
1fb8-assembly1.cif.gz_A structure of the pleckstrin homology domain from dapp1/phish 0.6971 21 122
ID Description Score Start End Superfamily
af_P9WM29_10_140_2.40.160.20 Mainly Beta;Beta Barrel;Porin; 0.8256 3 124 2.40.160.20
af_P09833_289_351_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8118 72 117 2.40.50.100
af_P9WM29_10_140_2.40.160.20 Mainly Beta;Beta Barrel;Porin; 0.7748 3 124 2.40.160.20
af_Q8BZ05_483_574_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7422 23 122 2.30.29.30
af_I3ITQ9_642_742_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7379 21 122 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A7Y5XBW2-F1-model_v4 deleted 0.9279 32 129
AF-A0A1C4WE79-F1-model_v4 deleted 0.9193 3 128
AF-A0A4U2YIR8-F1-model_v4 DUF2550 family protein 0.9171 7 129
AF-A0A5D0TIW7-F1-model_v4 DUF2550 family protein 0.9135 3 128 GO:0016020
AF-A0A1K0GCR6-F1-model_v4 DUF2550 domain-containing protein 0.9124 3 126

Map