F438348

General Info

Members Datasets Scaffolds Average Seq Length
414 217 403 320

Family's Representative Sequence

Representative Sequence 3300026075|Ga0207708_10002025|Ga0207708_100020252
Length 372
Sequence MGAQRPISITQHTTRIDIGRCAPVLIRRHEQYSNKHDTHCHVCEIKFLRMRADRLLTIVLLLQAHHQLTSRDLAARLEVSERTIHRDMEALSGAGIPVIALRGTHGGWSLLGEYRTNLTGLNEAEIETLFVTKPSRLLADLKLEKAAEGALLKLLAALPASYQRAAERARRRIHVDVGGWARQEEVAPLLPTLQEAVWLERKLSFSYDRGRECEPAERLCDPLGLVAKGSVWYLVAGVGSDIRTYRVSRILRAEVLQERVVIPDDFDLAAYWEASALKFKSSLPSYTARFRVAPEVFQFLQFAGRFSRVSQTYETDADGWLRVSVRFDVEEMACQFALSFGSKLEVLEPETLRAKVIQAAKETVEFYKQANA

Samples

Sample ID Description Type Environment
1 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
2 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
3 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
4 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
5 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
6 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
7 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
8 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
9 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
10 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
144 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
146 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
147 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
148 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
149 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
152 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
166 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
167 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
168 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
169 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
170 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
171 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
172 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
173 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
174 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
175 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
176 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
189 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
190 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
191 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
192 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
193 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
194 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
195 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
196 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
197 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
198 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
199 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
200 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
201 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
202 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
203 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
204 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
205 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
206 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
209 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
213 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
214 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
215 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
216 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
217 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.86
Metatranscriptomes 0.48
Isolates 2.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.48
Nodule 0.24
Rhizoplane 3.62
Rhizosphere 92.75
Stem 0
Stem Tuber 0
Unclassified 2.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1000680 3300000546 Bacteria 5741
2 rootH1_10022255 3300003323 Bacteria 2877
3 Ga0058860_12050340 3300004801 Unclassified 1471
4 Ga0065715_10190200 3300005293 Bacteria 1420
5 Ga0070658_10012335 3300005327 Bacteria 6862
6 Ga0070658_10050964 3300005327 Bacteria 3355
7 Ga0070676_10138234 3300005328 Bacteria 1548
8 Ga0070683_100010561 3300005329 Bacteria 7939
9 Ga0070683_100019128 3300005329 Bacteria 6078
10 Ga0070683_100033374 3300005329 Bacteria 4694
11 Ga0070683_100166269 3300005329 Bacteria 2093
12 Ga0070690_100008326 3300005330 Bacteria 5968
13 Ga0070670_100008994 3300005331 Bacteria 8532
14 Ga0068869_100021046 3300005334 Bacteria 4483
15 Ga0068869_100044071 3300005334 Unclassified 3208
16 Ga0070666_10010441 3300005335 Bacteria 5810
17 Ga0070680_100000868 3300005336 Bacteria 21466
18 Ga0068868_100015982 3300005338 Bacteria 5565
19 Ga0068868_100068458 3300005338 Bacteria 2827
20 Ga0068868_100114957 3300005338 Bacteria 2190
21 Ga0068868_100182235 3300005338 Bacteria 1743
22 Ga0068868_100204172 3300005338 Unclassified 1649
23 Ga0068868_100499873 3300005338 Bacteria 1065
24 Ga0070660_100196516 3300005339 Unclassified 1635
25 Ga0070687_100003368 3300005343 Bacteria 6195
26 Ga0070661_100028661 3300005344 Bacteria 4017
27 Ga0070661_100048893 3300005344 Unclassified 3096
28 Ga0070661_100127471 3300005344 Bacteria 1910
29 Ga0070661_100185793 3300005344 Bacteria 1583
30 Ga0070669_100030907 3300005353 Bacteria 3866
31 Ga0070669_100152771 3300005353 Unclassified 1788
32 Ga0070675_100070083 3300005354 Unclassified 2905
33 Ga0070675_100518723 3300005354 Unclassified 1075
34 Ga0070688_100210627 3300005365 Unclassified 1364
35 Ga0070667_100006966 3300005367 Bacteria 9392
36 Ga0070667_100011075 3300005367 Bacteria 7460
37 Ga0070714_100156130 3300005435 Unclassified 2060
38 Ga0070713_100126216 3300005436 Bacteria 2251
39 Ga0070711_100040831 3300005439 Unclassified 3131
40 Ga0070705_100000331 3300005440 Bacteria 27964
41 Ga0070705_100074921 3300005440 Unclassified 2059
42 Ga0070700_100000193 3300005441 Bacteria 34477
43 Ga0070694_100004903 3300005444 Bacteria 8063
44 Ga0070694_100013196 3300005444 Bacteria 5157
45 Ga0070694_100044399 3300005444 Bacteria 2974
46 Ga0070663_100288361 3300005455 Bacteria 1310
47 Ga0070678_100014571 3300005456 Bacteria 4967
48 Ga0070681_10000032 3300005458 Bacteria 99533
49 Ga0070706_100001365 3300005467 Bacteria 25959
50 Ga0070706_100012727 3300005467 Bacteria 7785
51 Ga0070706_100269930 3300005467 Bacteria 1588
52 Ga0070707_100003851 3300005468 Bacteria 14133
53 Ga0070707_100175573 3300005468 Unclassified 2088
54 Ga0070698_100122792 3300005471 Bacteria 2555
55 Ga0070698_100295727 3300005471 Bacteria 1550
56 Ga0070699_100000062 3300005518 Bacteria 101909
57 Ga0070699_100026656 3300005518 Bacteria 4984
58 Ga0070699_100114253 3300005518 Bacteria 2372
59 Ga0070679_100000331 3300005530 Bacteria 40170
60 Ga0070684_100010509 3300005535 Bacteria 7337
61 Ga0070684_100040064 3300005535 Bacteria 4032
62 Ga0070684_100043209 3300005535 Bacteria 3891
63 Ga0070684_100237989 3300005535 Bacteria 1663
64 Ga0068853_100034852 3300005539 Bacteria 4274
65 Ga0068853_100061496 3300005539 Unclassified 3248
66 Ga0070672_100009946 3300005543 Bacteria 6577
67 Ga0070686_100046419 3300005544 Bacteria 2741
68 Ga0070696_100000026 3300005546 Bacteria 68402
69 Ga0070696_100018488 3300005546 Bacteria 4710
70 Ga0070696_100051639 3300005546 Unclassified 2859
71 Ga0070693_100075196 3300005547 Bacteria 1999
72 Ga0070704_100060462 3300005549 Bacteria 2707
73 Ga0070704_100091629 3300005549 Bacteria 2267
74 Ga0070704_100093525 3300005549 Bacteria 2247
75 Ga0068855_100027068 3300005563 Bacteria 6860
76 Ga0068855_100047905 3300005563 Bacteria 5047
77 Ga0068855_100050549 3300005563 Bacteria 4898
78 Ga0068855_100088072 3300005563 Bacteria 3586
79 Ga0068855_100128599 3300005563 Bacteria 2894
80 Ga0068857_100015300 3300005577 Bacteria 6697
81 Ga0068857_100113869 3300005577 Unclassified 2432
82 Ga0068854_100045906 3300005578 Bacteria 3108
83 Ga0068856_100013024 3300005614 Bacteria 8054
84 Ga0068856_100058572 3300005614 Bacteria 3804
85 Ga0068856_100081489 3300005614 Unclassified 3211
86 Ga0068856_100182228 3300005614 Unclassified 2113
87 Ga0068856_100199138 3300005614 Unclassified 2017
88 Ga0068856_100436883 3300005614 Unclassified 1329
89 Ga0068852_100001910 3300005616 Bacteria 14185
90 Ga0068852_100008741 3300005616 Bacteria 7488
91 Ga0068852_100229041 3300005616 Bacteria 1771
92 Ga0068852_100308322 3300005616 Bacteria 1534
93 Ga0068859_100107833 3300005617 Unclassified 2846
94 Ga0068864_100001563 3300005618 Bacteria 18850
95 Ga0068864_100007584 3300005618 Bacteria 8941
96 Ga0068864_100023819 3300005618 Bacteria 5144
97 Ga0068864_100055032 3300005618 Unclassified 3434
98 Ga0068864_100502932 3300005618 Unclassified 1166
99 Ga0068861_100016321 3300005719 Bacteria 5253
100 Ga0068861_100072873 3300005719 Bacteria 2666
101 Ga0068861_100087342 3300005719 Unclassified 2454
102 Ga0068851_10008781 3300005834 Bacteria 4683
103 Ga0068851_10012708 3300005834 Bacteria 3975
104 Ga0068870_10056126 3300005840 Bacteria 2101
105 Ga0068870_10221448 3300005840 Unclassified 1158
106 Ga0068863_100002640 3300005841 Bacteria 17744
107 Ga0068863_100043715 3300005841 Bacteria 4252
108 Ga0068858_100025381 3300005842 Bacteria 5514
109 Ga0068858_100071945 3300005842 Unclassified 3208
110 Ga0068858_100172550 3300005842 Bacteria 2039
111 Ga0068860_100000200 3300005843 Bacteria 95120
112 Ga0068860_100248740 3300005843 Bacteria 1731
113 Ga0070717_10001087 3300006028 Bacteria 18276
114 Ga0070717_10004754 3300006028 Bacteria 9874
115 Ga0070717_10035392 3300006028 Bacteria 4042
116 Ga0070716_100100065 3300006173 Bacteria 1775
117 Ga0097621_100004197 3300006237 Bacteria 9996
118 Ga0097621_100014311 3300006237 Bacteria 5933
119 Ga0068871_100010469 3300006358 Bacteria 6770
120 Ga0068871_100011999 3300006358 Bacteria 6375
121 Ga0068871_100083221 3300006358 Bacteria 2654
122 Ga0075428_100199302 3300006844 Bacteria 2165
123 Ga0075428_100434486 3300006844 Bacteria 1406
124 Ga0075431_100055944 3300006847 Bacteria 4070
125 Ga0075431_100233600 3300006847 Unclassified 1873
126 Ga0075431_100283918 3300006847 Bacteria 1676
127 Ga0075433_10093084 3300006852 Bacteria 2666
128 Ga0075434_100019657 3300006871 Bacteria 6537
129 Ga0075434_100423164 3300006871 Unclassified 1353
130 Ga0068865_100010843 3300006881 Bacteria 5686
131 Ga0097620_100107839 3300006931 Unclassified 2846
132 Ga0105240_10000516 3300009093 Bacteria 71158
133 Ga0105240_10005538 3300009093 Bacteria 18805
134 Ga0105240_10006110 3300009093 Bacteria 17764
135 Ga0105240_10006333 3300009093 Bacteria 17422
136 Ga0105240_10007803 3300009093 Bacteria 15461
137 Ga0105240_10035938 3300009093 Bacteria 6379
138 Ga0105240_10069515 3300009093 Unclassified 4358
139 Ga0105240_10635292 3300009093 Bacteria 1172
140 Ga0111539_10192183 3300009094 Bacteria 2381
141 Ga0111539_10209261 3300009094 Bacteria 2273
142 Ga0105245_10009530 3300009098 Bacteria 8467
143 Ga0105245_10013827 3300009098 Bacteria 7031
144 Ga0114129_10005795 3300009147 Bacteria 17494
145 Ga0114129_10147522 3300009147 Bacteria 3221
146 Ga0105243_10028943 3300009148 Bacteria 4257
147 Ga0105241_10000051 3300009174 Bacteria 95075
148 Ga0105241_10001099 3300009174 Bacteria 20586
149 Ga0105241_10002039 3300009174 Bacteria 15278
150 Ga0105241_10049894 3300009174 Bacteria 3189
151 Ga0105241_10077057 3300009174 Bacteria 2602
152 Ga0105242_10050158 3300009176 Bacteria 3397
153 Ga0105242_10384648 3300009176 Bacteria 1305
154 Ga0105248_10015184 3300009177 Bacteria 8486
155 Ga0105248_10019971 3300009177 Bacteria 7417
156 Ga0105248_10580525 3300009177 Unclassified 1265
157 Ga0105237_10010412 3300009545 Bacteria 9898
158 Ga0105237_10014988 3300009545 Bacteria 8079
159 Ga0105237_10024688 3300009545 Bacteria 6148
160 Ga0105237_10044299 3300009545 Unclassified 4480
161 Ga0105238_10000251 3300009551 Bacteria 59944
162 Ga0105238_10003911 3300009551 Bacteria 14796
163 Ga0105238_10004996 3300009551 Bacteria 13116
164 Ga0105238_10021034 3300009551 Bacteria 6648
165 Ga0105238_10029981 3300009551 Bacteria 5537
166 Ga0105238_10132414 3300009551 Bacteria 2471
167 Ga0105238_10240288 3300009551 Unclassified 1789
168 Ga0105249_10262035 3300009553 Bacteria 1718
169 Ga0105249_10339982 3300009553 Unclassified 1517
170 Ga0105239_10000725 3300010375 Bacteria 46872
171 Ga0105239_10121104 3300010375 Unclassified 2906
172 Ga0105239_10216670 3300010375 Bacteria 2146
173 Ga0105239_10347595 3300010375 Bacteria 1674
174 Ga0105246_10033653 3300011119 Bacteria 3409
175 Ga0157370_10000174 3300013104 Bacteria 79990
176 Ga0157370_10005061 3300013104 Bacteria 14880
177 Ga0157369_10000262 3300013105 Bacteria 71158
178 Ga0157369_10000369 3300013105 Bacteria 59934
179 Ga0157369_10004534 3300013105 Bacteria 16345
180 Ga0157369_10007607 3300013105 Bacteria 12465
181 Ga0157369_10020990 3300013105 Bacteria 7303
182 Ga0157369_10025609 3300013105 Bacteria 6546
183 Ga0157369_10108015 3300013105 Bacteria 2960
184 Ga0157369_10227352 3300013105 Bacteria 1951
185 Ga0157374_10001525 3300013296 Bacteria 19503
186 Ga0157374_10014614 3300013296 Bacteria 6871
187 Ga0157374_10017230 3300013296 Bacteria 6361
188 Ga0157374_10105671 3300013296 Bacteria 2704
189 Ga0157378_10039116 3300013297 Unclassified 4206
190 Ga0157378_10042962 3300013297 Unclassified 4013
191 Ga0157378_10059298 3300013297 Bacteria 3415
192 Ga0157378_10068817 3300013297 Bacteria 3175
193 Ga0163162_10021397 3300013306 Bacteria 6369
194 Ga0163162_10071571 3300013306 Bacteria 3521
195 Ga0163162_10138388 3300013306 Unclassified 2546
196 Ga0163162_10427392 3300013306 Bacteria 1457
197 Ga0157372_10000659 3300013307 Bacteria 37935
198 Ga0157372_10007580 3300013307 Bacteria 11540
199 Ga0157372_10017949 3300013307 Bacteria 7603
200 Ga0157372_10119497 3300013307 Bacteria 3025
201 Ga0157372_10139381 3300013307 Unclassified 2793
202 Ga0157372_10167492 3300013307 Unclassified 2541
203 Ga0157372_10193097 3300013307 Bacteria 2358
204 Ga0157372_10212900 3300013307 Unclassified 2240
205 Ga0157375_10004500 3300013308 Bacteria 12119
206 Ga0157375_10016043 3300013308 Bacteria 6720
207 Ga0157375_10024783 3300013308 Bacteria 5559
208 Ga0163163_10000249 3300014325 Bacteria 54997
209 Ga0163163_10066497 3300014325 Bacteria 3580
210 Ga0163163_10201914 3300014325 Bacteria 2036
211 Ga0157379_10047593 3300014968 Bacteria 3826
212 Ga0157379_10105134 3300014968 Bacteria 2534
213 Ga0157379_10112548 3300014968 Unclassified 2446
214 Ga0157376_10005272 3300014969 Bacteria 9029
215 Ga0157376_10018258 3300014969 Bacteria 5372
216 Ga0157376_10067286 3300014969 Bacteria 3029
217 Ga0157376_10110566 3300014969 Bacteria 2418
218 Ga0157376_10183537 3300014969 Bacteria 1914
219 Ga0207697_10004330 3300025315 Bacteria 6792
220 Ga0207653_10000132 3300025885 Bacteria 53266
221 Ga0207710_10005191 3300025900 Bacteria 5629
222 Ga0207647_10022822 3300025904 Unclassified 4151
223 Ga0207643_10109093 3300025908 Bacteria 1629
224 Ga0207643_10196044 3300025908 Bacteria 1228
225 Ga0207705_10000021 3300025909 Bacteria 309436
226 Ga0207684_10000230 3300025910 Bacteria 85141
227 Ga0207684_10020876 3300025910 Bacteria 5595
228 Ga0207654_10000068 3300025911 Bacteria 67500
229 Ga0207654_10000548 3300025911 Bacteria 21477
230 Ga0207654_10253832 3300025911 Bacteria 1180
231 Ga0207707_10000062 3300025912 Bacteria 108192
232 Ga0207695_10000047 3300025913 Bacteria 422459
233 Ga0207695_10000150 3300025913 Bacteria 207099
234 Ga0207695_10000162 3300025913 Bacteria 198155
235 Ga0207695_10001900 3300025913 Bacteria 32599
236 Ga0207695_10022767 3300025913 Bacteria 7100
237 Ga0207695_10033208 3300025913 Bacteria 5635
238 Ga0207671_10000155 3300025914 Bacteria 106931
239 Ga0207671_10001417 3300025914 Bacteria 27842
240 Ga0207663_10027354 3300025916 Bacteria 3323
241 Ga0207660_10000300 3300025917 Bacteria 32727
242 Ga0207662_10061477 3300025918 Bacteria 2255
243 Ga0207649_10018125 3300025920 Bacteria 3998
244 Ga0207649_10044610 3300025920 Unclassified 2715
245 Ga0207652_10000175 3300025921 Bacteria 68407
246 Ga0207646_10063167 3300025922 Unclassified 3306
247 Ga0207681_10222921 3300025923 Unclassified 1460
248 Ga0207681_10281570 3300025923 Bacteria 1309
249 Ga0207694_10000142 3300025924 Bacteria 74189
250 Ga0207694_10000146 3300025924 Bacteria 72706
251 Ga0207694_10001885 3300025924 Bacteria 17384
252 Ga0207694_10018855 3300025924 Bacteria 5215
253 Ga0207694_10139608 3300025924 Bacteria 1948
254 Ga0207650_10006669 3300025925 Bacteria 7878
255 Ga0207687_10041670 3300025927 Bacteria 3154
256 Ga0207687_10343679 3300025927 Bacteria 1214
257 Ga0207706_10011628 3300025933 Bacteria 8021
258 Ga0207706_10078359 3300025933 Bacteria 2906
259 Ga0207709_10022876 3300025935 Bacteria 3551
260 Ga0207670_10000558 3300025936 Bacteria 20611
261 Ga0207665_10096411 3300025939 Bacteria 2057
262 Ga0207691_10012511 3300025940 Bacteria 8136
263 Ga0207711_10261415 3300025941 Unclassified 1591
264 Ga0207689_10004516 3300025942 Bacteria 12596
265 Ga0207689_10115435 3300025942 Bacteria 2207
266 Ga0207689_10140118 3300025942 Unclassified 1992
267 Ga0207667_10003680 3300025949 Bacteria 18901
268 Ga0207667_10041966 3300025949 Bacteria 4865
269 Ga0207667_10053586 3300025949 Bacteria 4244
270 Ga0207667_10066930 3300025949 Bacteria 3743
271 Ga0207667_10080320 3300025949 Bacteria 3379
272 Ga0207667_10151048 3300025949 Unclassified 2391
273 Ga0207651_10099387 3300025960 Bacteria 2155
274 Ga0207712_10121615 3300025961 Bacteria 1976
275 Ga0207668_10350091 3300025972 Unclassified 1235
276 Ga0207658_10000693 3300025986 Bacteria 29296
277 Ga0207677_10001259 3300026023 Bacteria 13650
278 Ga0207677_10019180 3300026023 Bacteria 4124
279 Ga0207677_10050023 3300026023 Bacteria 2825
280 Ga0207677_10406870 3300026023 Unclassified 1155
281 Ga0207703_10017859 3300026035 Bacteria 5540
282 Ga0207703_10041771 3300026035 Unclassified 3676
283 Ga0207639_10018233 3300026041 Unclassified 4985
284 Ga0207639_10020161 3300026041 Bacteria 4770
285 Ga0207639_10180232 3300026041 Unclassified 1796
286 Ga0207708_10000069 3300026075 Bacteria 82187
287 Ga0207708_10002025 3300026075 Bacteria 14944
288 Ga0207702_10008441 3300026078 Bacteria 8691
289 Ga0207702_10054551 3300026078 Unclassified 3387
290 Ga0207702_10063963 3300026078 Bacteria 3147
291 Ga0207702_10117865 3300026078 Unclassified 2371
292 Ga0207702_10126917 3300026078 Bacteria 2292
293 Ga0207702_10206607 3300026078 Bacteria 1823
294 Ga0207641_10002156 3300026088 Bacteria 18538
295 Ga0207641_10476358 3300026088 Bacteria 1209
296 Ga0207648_10031257 3300026089 Bacteria 4707
297 Ga0207648_10168376 3300026089 Unclassified 1936
298 Ga0207676_10015720 3300026095 Bacteria 5468
299 Ga0207676_10064271 3300026095 Bacteria 2918
300 Ga0207676_10215737 3300026095 Bacteria 1705
301 Ga0207676_10482439 3300026095 Unclassified 1174
302 Ga0207674_10001977 3300026116 Bacteria 25960
303 Ga0207674_10010049 3300026116 Bacteria 10766
304 Ga0207674_10066101 3300026116 Unclassified 3643
305 Ga0207674_10108660 3300026116 Unclassified 2750
306 Ga0207674_10140412 3300026116 Unclassified 2375
307 Ga0207674_10206100 3300026116 Bacteria 1915
308 Ga0207675_100012904 3300026118 Bacteria 7803
309 Ga0207675_100069232 3300026118 Unclassified 3298
310 Ga0207683_10002332 3300026121 Bacteria 16648
311 Ga0207698_10000082 3300026142 Bacteria 62831
312 Ga0207698_10000241 3300026142 Bacteria 33787
313 Ga0207698_10061003 3300026142 Bacteria 2936
314 Ga0207698_10092959 3300026142 Bacteria 2475
315 Ga0207698_10102929 3300026142 Unclassified 2372
316 Ga0268264_10004090 3300028381 Bacteria 12487
317 Ga0265338_10192327 3300028800 Bacteria 1546
318 Ga0265760_10017599 3300031090 Unclassified 2053
319 Ga0265320_10035764 3300031240 Unclassified 2516
320 Ga0265325_10075741 3300031241 Bacteria 1680
321 Ga0265340_10127905 3300031247 Unclassified 1166
322 Ga0265339_10001021 3300031249 Bacteria 21326
323 Ga0265316_10056394 3300031344 Bacteria 3069
324 Ga0265316_10116478 3300031344 Unclassified 2020
325 Ga0307408_100013261 3300031548 Bacteria 5469
326 Ga0316579_10001728 3300031691 Bacteria 8021
327 Ga0265342_10002201 3300031712 Bacteria 17135
328 Ga0307405_10162985 3300031731 Bacteria 1582
329 Ga0307406_10003022 3300031901 Bacteria 9149
330 Ga0307407_10094679 3300031903 Bacteria 1839
331 Ga0307412_10018785 3300031911 Bacteria 4169
332 Ga0307412_10055903 3300031911 Bacteria 2628
333 Ga0307409_100299912 3300031995 Bacteria 1494
334 Ga0307416_100002178 3300032002 Bacteria 11111
335 Ga0307411_10008157 3300032005 Bacteria 5404
336 Ga0307415_100010829 3300032126 Bacteria 5183
337 Ga0373956_0031670 3300035119 Bacteria 2319
338 Ga0373937_0004389 3300036401 Bacteria 11985
339 Ga0373937_0347903 3300036401 Bacteria 1404
340 Ga0316584_0011853 3300036712 Bacteria 6141
341 Ga0316584_0072022 3300036712 Unclassified 2590
342 Ga0395898_0267923 3300037466 Bacteria 1629
343 Ga0466969_0031599 3300044656 Bacteria 2694
344 Ga0466966_0006082 3300044684 Bacteria 7973
345 Ga0466963_0037741 3300044694 Unclassified 3157
346 Ga0466971_0085208 3300044719 Bacteria 1444
347 Ga0466959_0001977 3300045049 Bacteria 12912
348 Ga0466958_0025600 3300045836 Bacteria 3480
349 Ga0466967_0000838 3300045976 Bacteria 16230
350 Ga0466967_0116878 3300045976 Bacteria 2458
351 Ga0495580_0013972 3300046472 Bacteria 6108
352 Ga0495582_0148595 3300046473 Bacteria 1330
353 Ga0495664_0078598 3300046477 Bacteria 1976
354 Ga0495645_0037456 3300046543 Bacteria 3535
355 Ga0495613_0062652 3300046689 Unclassified 2721
356 Ga0495674_0157752 3300047319 Bacteria 1900
357 Ga0496101_0070860 3300048904 Unclassified 2554
358 Ga0496101_0185538 3300048904 Unclassified 1603
359 Ga0496102_0165642 3300048905 Bacteria 2080
360 Ga0496104_0021844 3300048907 Bacteria 5878
361 Ga0496104_0047063 3300048907 Bacteria 4064
362 Ga0496105_0174828 3300048908 Bacteria 1759
363 Ga0496106_0153717 3300048909 Unclassified 1816
364 Ga0496109_0029454 3300048912 Unclassified 4917
365 Ga0496112_0026496 3300048915 Bacteria 5578
366 Ga0496112_0489306 3300048915 Bacteria 1166
367 Ga0496113_0185136 3300048916 Bacteria 1651
368 Ga0496114_0004599 3300048917 Bacteria 10718
369 Ga0496115_0008224 3300048918 Bacteria 7708
370 Ga0496115_0020619 3300048918 Bacteria 5085
371 Ga0496115_0284509 3300048918 Bacteria 1357
372 Ga0496116_0029471 3300048919 Unclassified 3956
373 Ga0496117_0001060 3300048920 Bacteria 41966
374 Ga0496122_0003610 3300048925 Bacteria 20148
375 Ga0496123_0008957 3300048926 Bacteria 9098
376 Ga0501297_003222 3300049520 Bacteria 1616
377 Ga0501298_002279 3300049521 Bacteria 2896
378 Ga0501299_009299 3300049522 Bacteria 1617
379 Ga0501299_012578 3300049522 Bacteria 1446
380 Ga0501202_003950 3300049652 Bacteria 2568
381 Ga0501216_001377 3300049660 Bacteria 3272
382 Ga0501217_046458 3300049661 Bacteria 1121
383 Ga0501223_001018 3300049663 Bacteria 6627
384 Ga0501223_017647 3300049663 Bacteria 1408
385 Ga0501227_000705 3300049665 Bacteria 7286
386 Ga0501227_010095 3300049665 Bacteria 2043
387 Ga0501230_002783 3300049667 Bacteria 2254
388 Ga0501233_001068 3300049668 Bacteria 4647
389 Ga0501253_008139 3300049683 Bacteria 1497
390 Ga0501225_0003415 3300049705 Bacteria 4818
391 Ga0501081_0198383 3300049743 Unclassified 1455
392 Ga0501283_001660 3300049779 Unclassified 2898
393 nmdc:mga06z11_75015_c1 3300050494 Bacteria 1799
394 nmdc:mga05p37_135701_c1 3300050507 Bacteria 3018
395 nmdc:mga05p37_537265_c1 3300050507 Bacteria 1334
396 nmdc:mga09592_17921_c2 3300050508 Bacteria 3933
397 nmdc:mga0qj67_1557_c1 3300050509 Bacteria 16106
398 nmdc:mga06r32_108374_c1 3300050510 Bacteria 2731
399 nmdc:mga08y16_542685_c1 3300050511 Bacteria 1177
400 nmdc:mga0a205_40010_c1 3300050515 Unclassified 4513
401 Ga0500616_0000113 3300053153 Bacteria 150722
402 Ga0590075_013945 3300059424 Bacteria 1963
403 Ga0590077_004033 3300059426 Bacteria 3024

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009177 Ga0105248_10580525 Ga0105248_105805252 284
2 3300013105 Ga0157369_10020990 Ga0157369_100209906 284
3 3300013306 Ga0163162_10071571 Ga0163162_100715714 284
4 3300014325 Ga0163163_10066497 Ga0163163_100664973 284
5 3300014969 Ga0157376_10110566 Ga0157376_101105663 284
6 3300048904 Ga0496101_0070860 Ga0496101_0070860_441_1337 284
7 3300048905 Ga0496102_0165642 Ga0496102_0165642_822_1718 284
8 3300048907 Ga0496104_0047063 Ga0496104_0047063_852_1748 284
9 3300048912 Ga0496109_0029454 Ga0496109_0029454_626_1522 284
10 3300048915 Ga0496112_0026496 Ga0496112_0026496_1576_2472 284
11 3300048916 Ga0496113_0185136 Ga0496113_0185136_20_916 284
12 3300048918 Ga0496115_0008224 Ga0496115_0008224_731_1627 284
13 3300026023 Ga0207677_10406870 Ga0207677_104068701 289
14 iso_pu_bacteria 2512564013 2512641378 290
15 iso_pu_bacteria 2857460504 2857461973 290
16 iso_pu_bacteria 2915597211 2915603400 290
17 iso_pu_bacteria 2929183550 2929188508 290
18 3300031731 Ga0307405_10162985 Ga0307405_101629853 291
19 3300048919 Ga0496116_0029471 Ga0496116_0029471_1007_1987 291
20 3300004801 Ga0058860_12050340 Ga0058860_120503402 292
21 3300005618 Ga0068864_100502932 Ga0068864_1005029322 292
22 3300026095 Ga0207676_10482439 Ga0207676_104824392 292
23 3300044656 Ga0466969_0031599 Ga0466969_0031599_293_1342 292
24 3300044684 Ga0466966_0006082 Ga0466966_0006082_4853_5902 292
25 3300044719 Ga0466971_0085208 Ga0466971_0085208_21_1070 292
26 3300045049 Ga0466959_0001977 Ga0466959_0001977_9686_10735 292
27 3300045836 Ga0466958_0025600 Ga0466958_0025600_2007_3056 292
28 3300048920 Ga0496117_0001060 Ga0496117_0001060_4084_5040 292
29 3300048925 Ga0496122_0003610 Ga0496122_0003610_19143_20099 292
30 3300048926 Ga0496123_0008957 Ga0496123_0008957_2076_3032 292
31 3300053153 Ga0500616_0000113 Ga0500616_0000113_86360_87316 292
32 iso_pu_bacteria 2915606848 2915608292 292
33 iso_pu_bacteria 8057345674 8057347655 292
34 3300005444 Ga0070694_100004903 Ga0070694_1000049036 293
35 3300005468 Ga0070707_100175573 Ga0070707_1001755731 293
36 3300005577 Ga0068857_100113869 Ga0068857_1001138692 293
37 3300006847 Ga0075431_100055944 Ga0075431_1000559441 293
38 3300006871 Ga0075434_100423164 Ga0075434_1004231641 293
39 3300009147 Ga0114129_10147522 Ga0114129_101475221 293
40 3300025922 Ga0207646_10063167 Ga0207646_100631674 293
41 3300026116 Ga0207674_10140412 Ga0207674_101404122 293
42 3300050507 nmdc:mga05p37_537265_c1 nmdc:mga05p37_537265_c1_312_1283 293
43 3300050509 nmdc:mga0qj67_1557_c1 nmdc:mga0qj67_1557_c1_14860_15831 293
44 3300050510 nmdc:mga06r32_108374_c1 nmdc:mga06r32_108374_c1_1484_2455 293
45 iso_pu_bacteria 2510917027 2511178979 293
46 3300005328 Ga0070676_10138234 Ga0070676_101382341 294
47 3300005330 Ga0070690_100008326 Ga0070690_1000083261 294
48 3300005334 Ga0068869_100044071 Ga0068869_1000440712 294
49 3300005335 Ga0070666_10010441 Ga0070666_100104412 294
50 3300005336 Ga0070680_100000868 Ga0070680_10000086814 294
51 3300005338 Ga0068868_100068458 Ga0068868_1000684584 294
52 3300005338 Ga0068868_100182235 Ga0068868_1001822352 294
53 3300005338 Ga0068868_100204172 Ga0068868_1002041722 294
54 3300005338 Ga0068868_100499873 Ga0068868_1004998731 294
55 3300005343 Ga0070687_100003368 Ga0070687_1000033681 294
56 3300005344 Ga0070661_100185793 Ga0070661_1001857932 294
57 3300005353 Ga0070669_100030907 Ga0070669_1000309072 294
58 3300005353 Ga0070669_100152771 Ga0070669_1001527711 294
59 3300005354 Ga0070675_100070083 Ga0070675_1000700832 294
60 3300005354 Ga0070675_100518723 Ga0070675_1005187231 294
61 3300005365 Ga0070688_100210627 Ga0070688_1002106271 294
62 3300005367 Ga0070667_100006966 Ga0070667_1000069664 294
63 3300005440 Ga0070705_100074921 Ga0070705_1000749212 294
64 3300005441 Ga0070700_100000193 Ga0070700_1000001939 294
65 3300005444 Ga0070694_100013196 Ga0070694_1000131963 294
66 3300005444 Ga0070694_100044399 Ga0070694_1000443993 294
67 3300005456 Ga0070678_100014571 Ga0070678_1000145716 294
68 3300005458 Ga0070681_10000032 Ga0070681_100000324 294
69 3300005467 Ga0070706_100012727 Ga0070706_1000127274 294
70 3300005467 Ga0070706_100269930 Ga0070706_1002699302 294
71 3300005468 Ga0070707_100003851 Ga0070707_1000038514 294
72 3300005471 Ga0070698_100122792 Ga0070698_1001227922 294
73 3300005518 Ga0070699_100026656 Ga0070699_1000266564 294
74 3300005518 Ga0070699_100114253 Ga0070699_1001142531 294
75 3300005530 Ga0070679_100000331 Ga0070679_1000003317 294
76 3300005543 Ga0070672_100009946 Ga0070672_1000099462 294
77 3300005544 Ga0070686_100046419 Ga0070686_1000464192 294
78 3300005546 Ga0070696_100018488 Ga0070696_1000184885 294
79 3300005546 Ga0070696_100051639 Ga0070696_1000516391 294
80 3300005547 Ga0070693_100075196 Ga0070693_1000751962 294
81 3300005549 Ga0070704_100060462 Ga0070704_1000604623 294
82 3300005549 Ga0070704_100091629 Ga0070704_1000916292 294
83 3300005617 Ga0068859_100107833 Ga0068859_1001078332 294
84 3300005618 Ga0068864_100007584 Ga0068864_1000075843 294
85 3300005618 Ga0068864_100023819 Ga0068864_1000238194 294
86 3300005618 Ga0068864_100055032 Ga0068864_1000550322 294
87 3300005719 Ga0068861_100016321 Ga0068861_1000163215 294
88 3300005719 Ga0068861_100072873 Ga0068861_1000728732 294
89 3300005719 Ga0068861_100087342 Ga0068861_1000873422 294
90 3300005834 Ga0068851_10008781 Ga0068851_100087814 294
91 3300005840 Ga0068870_10056126 Ga0068870_100561262 294
92 3300005840 Ga0068870_10221448 Ga0068870_102214481 294
93 3300005841 Ga0068863_100043715 Ga0068863_1000437152 294
94 3300005842 Ga0068858_100071945 Ga0068858_1000719452 294
95 3300005842 Ga0068858_100172550 Ga0068858_1001725503 294
96 3300005843 Ga0068860_100248740 Ga0068860_1002487403 294
97 3300006028 Ga0070717_10004754 Ga0070717_100047547 294
98 3300006173 Ga0070716_100100065 Ga0070716_1001000652 294
99 3300006237 Ga0097621_100004197 Ga0097621_1000041977 294
100 3300006237 Ga0097621_100014311 Ga0097621_1000143114 294
101 3300006358 Ga0068871_100011999 Ga0068871_1000119991 294
102 3300006844 Ga0075428_100199302 Ga0075428_1001993022 294
103 3300006844 Ga0075428_100434486 Ga0075428_1004344862 294
104 3300006847 Ga0075431_100233600 Ga0075431_1002336002 294
105 3300006847 Ga0075431_100283918 Ga0075431_1002839182 294
106 3300006852 Ga0075433_10093084 Ga0075433_100930844 294
107 3300006871 Ga0075434_100019657 Ga0075434_1000196577 294
108 3300006881 Ga0068865_100010843 Ga0068865_1000108434 294
109 3300006931 Ga0097620_100107839 Ga0097620_1001078392 294
110 3300009094 Ga0111539_10192183 Ga0111539_101921831 294
111 3300009094 Ga0111539_10209261 Ga0111539_102092611 294
112 3300009148 Ga0105243_10028943 Ga0105243_100289434 294
113 3300009176 Ga0105242_10050158 Ga0105242_100501583 294
114 3300009177 Ga0105248_10015184 Ga0105248_100151844 294
115 3300009545 Ga0105237_10010412 Ga0105237_100104128 294
116 3300009553 Ga0105249_10262035 Ga0105249_102620351 294
117 3300009553 Ga0105249_10339982 Ga0105249_103399822 294
118 3300011119 Ga0105246_10033653 Ga0105246_100336534 294
119 3300013296 Ga0157374_10017230 Ga0157374_100172303 294
120 3300013297 Ga0157378_10039116 Ga0157378_100391164 294
121 3300013306 Ga0163162_10021397 Ga0163162_100213975 294
122 3300013306 Ga0163162_10138388 Ga0163162_101383882 294
123 3300013306 Ga0163162_10427392 Ga0163162_104273922 294
124 3300013308 Ga0157375_10024783 Ga0157375_100247831 294
125 3300014325 Ga0163163_10201914 Ga0163163_102019142 294
126 3300014968 Ga0157379_10047593 Ga0157379_100475935 294
127 3300014969 Ga0157376_10067286 Ga0157376_100672864 294
128 3300014969 Ga0157376_10183537 Ga0157376_101835372 294
129 3300025315 Ga0207697_10004330 Ga0207697_100043306 294
130 3300025908 Ga0207643_10109093 Ga0207643_101090932 294
131 3300025908 Ga0207643_10196044 Ga0207643_101960441 294
132 3300025910 Ga0207684_10020876 Ga0207684_100208764 294
133 3300025912 Ga0207707_10000062 Ga0207707_1000006294 294
134 3300025917 Ga0207660_10000300 Ga0207660_100003007 294
135 3300025918 Ga0207662_10061477 Ga0207662_100614772 294
136 3300025921 Ga0207652_10000175 Ga0207652_100001757 294
137 3300025923 Ga0207681_10222921 Ga0207681_102229211 294
138 3300025923 Ga0207681_10281570 Ga0207681_102815702 294
139 3300025933 Ga0207706_10011628 Ga0207706_100116284 294
140 3300025933 Ga0207706_10078359 Ga0207706_100783591 294
141 3300025935 Ga0207709_10022876 Ga0207709_100228762 294
142 3300025936 Ga0207670_10000558 Ga0207670_1000055814 294
143 3300025939 Ga0207665_10096411 Ga0207665_100964111 294
144 3300025940 Ga0207691_10012511 Ga0207691_100125114 294
145 3300025942 Ga0207689_10115435 Ga0207689_101154352 294
146 3300025942 Ga0207689_10140118 Ga0207689_101401182 294
147 3300025949 Ga0207667_10080320 Ga0207667_100803204 294
148 3300025960 Ga0207651_10099387 Ga0207651_100993872 294
149 3300025961 Ga0207712_10121615 Ga0207712_101216151 294
150 3300025972 Ga0207668_10350091 Ga0207668_103500911 294
151 3300026023 Ga0207677_10050023 Ga0207677_100500234 294
152 3300026035 Ga0207703_10041771 Ga0207703_100417711 294
153 3300026041 Ga0207639_10180232 Ga0207639_101802321 294
154 3300026075 Ga0207708_10000069 Ga0207708_1000006951 294
155 3300026075 Ga0207708_10002025 Ga0207708_100020252 294
156 3300026078 Ga0207702_10126917 Ga0207702_101269173 294
157 3300026088 Ga0207641_10476358 Ga0207641_104763581 294
158 3300026089 Ga0207648_10031257 Ga0207648_100312574 294
159 3300026089 Ga0207648_10168376 Ga0207648_101683762 294
160 3300026095 Ga0207676_10015720 Ga0207676_100157204 294
161 3300026095 Ga0207676_10064271 Ga0207676_100642714 294
162 3300026095 Ga0207676_10215737 Ga0207676_102157372 294
163 3300026116 Ga0207674_10066101 Ga0207674_100661012 294
164 3300026116 Ga0207674_10206100 Ga0207674_102061001 294
165 3300026118 Ga0207675_100012904 Ga0207675_1000129042 294
166 3300026118 Ga0207675_100069232 Ga0207675_1000692323 294
167 3300026121 Ga0207683_10002332 Ga0207683_100023328 294
168 3300026142 Ga0207698_10092959 Ga0207698_100929593 294
169 3300028800 Ga0265338_10192327 Ga0265338_101923272 294
170 3300031240 Ga0265320_10035764 Ga0265320_100357643 294
171 3300031344 Ga0265316_10056394 Ga0265316_100563944 294
172 3300031548 Ga0307408_100013261 Ga0307408_1000132614 294
173 3300031901 Ga0307406_10003022 Ga0307406_100030227 294
174 3300031903 Ga0307407_10094679 Ga0307407_100946792 294
175 3300031911 Ga0307412_10018785 Ga0307412_100187854 294
176 3300031911 Ga0307412_10055903 Ga0307412_100559032 294
177 3300031995 Ga0307409_100299912 Ga0307409_1002999122 294
178 3300032002 Ga0307416_100002178 Ga0307416_1000021785 294
179 3300032005 Ga0307411_10008157 Ga0307411_100081573 294
180 3300032126 Ga0307415_100010829 Ga0307415_1000108293 294
181 3300036401 Ga0373937_0347903 Ga0373937_0347903_285_1259 294
182 3300037466 Ga0395898_0267923 Ga0395898_0267923_303_1289 294
183 3300046472 Ga0495580_0013972 Ga0495580_0013972_3524_4498 294
184 3300047319 Ga0495674_0157752 Ga0495674_0157752_574_1548 294
185 3300049520 Ga0501297_003222 Ga0501297_003222_480_1433 294
186 3300049521 Ga0501298_002279 Ga0501298_002279_536_1489 294
187 3300049522 Ga0501299_009299 Ga0501299_009299_167_1084 294
188 3300049522 Ga0501299_012578 Ga0501299_012578_228_1199 294
189 3300049652 Ga0501202_003950 Ga0501202_003950_942_1895 294
190 3300049660 Ga0501216_001377 Ga0501216_001377_1770_2723 294
191 3300049661 Ga0501217_046458 Ga0501217_046458_43_996 294
192 3300049663 Ga0501223_001018 Ga0501223_001018_3047_4033 294
193 3300049663 Ga0501223_017647 Ga0501223_017647_200_1117 294
194 3300049665 Ga0501227_000705 Ga0501227_000705_3356_4342 294
195 3300049665 Ga0501227_010095 Ga0501227_010095_808_1761 294
196 3300049667 Ga0501230_002783 Ga0501230_002783_532_1485 294
197 3300049668 Ga0501233_001068 Ga0501233_001068_2146_3132 294
198 3300049683 Ga0501253_008139 Ga0501253_008139_453_1424 294
199 3300049705 Ga0501225_0003415 Ga0501225_0003415_1330_2316 294
200 3300049743 Ga0501081_0198383 Ga0501081_0198383_50_1039 294
201 3300049779 Ga0501283_001660 Ga0501283_001660_43_1014 294
202 3300050508 nmdc:mga09592_17921_c2 nmdc:mga09592_17921_c2_1584_2549 294
203 3300050511 nmdc:mga08y16_542685_c1 nmdc:mga08y16_542685_c1_196_1164 294
204 3300050515 nmdc:mga0a205_40010_c1 nmdc:mga0a205_40010_c1_313_1245 294
205 iso_pu_bacteria 2980182181 2980187559 294
206 iso_pu_bacteria 3006826541 3006828246 294
207 3300005471 Ga0070698_100295727 Ga0070698_1002957272 295
208 iso_pu_bacteria 2857453340 2857454906 295
209 iso_pu_bacteria 8056533031 8056533718 295
210 3300005293 Ga0065715_10190200 Ga0065715_101902001 296
211 3300005440 Ga0070705_100000331 Ga0070705_1000003316 296
212 3300005467 Ga0070706_100001365 Ga0070706_10000136516 296
213 3300005518 Ga0070699_100000062 Ga0070699_10000006222 296
214 3300005546 Ga0070696_100000026 Ga0070696_10000002676 296
215 3300005549 Ga0070704_100093525 Ga0070704_1000935252 296
216 3300009147 Ga0114129_10005795 Ga0114129_100057954 296
217 3300025885 Ga0207653_10000132 Ga0207653_1000013239 296
218 3300025910 Ga0207684_10000230 Ga0207684_1000023016 296
219 3300031249 Ga0265339_10001021 Ga0265339_1000102114 296
220 3300031712 Ga0265342_10002201 Ga0265342_1000220111 296
221 3300046477 Ga0495664_0078598 Ga0495664_0078598_720_1667 296
222 3300048915 Ga0496112_0489306 Ga0496112_0489306_77_1072 296
223 3300050507 nmdc:mga05p37_135701_c1 nmdc:mga05p37_135701_c1_1734_2720 296
224 3300005436 Ga0070713_100126216 Ga0070713_1001262162 297
225 3300013307 Ga0157372_10212900 Ga0157372_102129003 297
226 3300014968 Ga0157379_10105134 Ga0157379_101051343 297
227 3300048918 Ga0496115_0284509 Ga0496115_0284509_348_1298 297
228 3300050494 nmdc:mga06z11_75015_c1 nmdc:mga06z11_75015_c1_637_1605 297
229 3300059424 Ga0590075_013945 Ga0590075_013945_860_1846 297
230 3300059426 Ga0590077_004033 Ga0590077_004033_765_1751 297
231 3300005334 Ga0068869_100021046 Ga0068869_1000210462 298
232 3300005344 Ga0070661_100127471 Ga0070661_1001274712 298
233 3300005439 Ga0070711_100040831 Ga0070711_1000408313 298
234 3300006028 Ga0070717_10035392 Ga0070717_100353922 298
235 3300009093 Ga0105240_10005538 Ga0105240_1000553810 298
236 3300009551 Ga0105238_10004996 Ga0105238_1000499610 298
237 3300010375 Ga0105239_10347595 Ga0105239_103475951 298
238 3300013308 Ga0157375_10004500 Ga0157375_1000450010 298
239 3300014325 Ga0163163_10000249 Ga0163163_1000024939 298
240 3300025916 Ga0207663_10027354 Ga0207663_100273542 298
241 3300025942 Ga0207689_10004516 Ga0207689_1000451610 298
242 3300005435 Ga0070714_100156130 Ga0070714_1001561302 299
243 3300005563 Ga0068855_100128599 Ga0068855_1001285994 299
244 3300013104 Ga0157370_10005061 Ga0157370_100050619 299
245 3300025909 Ga0207705_10000021 Ga0207705_10000021132 299
246 3300025949 Ga0207667_10053586 Ga0207667_100535867 299
247 3300031691 Ga0316579_10001728 Ga0316579_100017286 299
248 3300036712 Ga0316584_0011853 Ga0316584_0011853_1096_2064 299
249 3300036712 Ga0316584_0072022 Ga0316584_0072022_1249_2217 299
250 3300045976 Ga0466967_0116878 Ga0466967_0116878_153_1109 299
251 3300000546 LJNas_1000680 LJNas_10006803 300
252 3300003323 rootH1_10022255 rootH1_100222552 300
253 3300005327 Ga0070658_10012335 Ga0070658_100123354 300
254 3300005327 Ga0070658_10050964 Ga0070658_100509642 300
255 3300005329 Ga0070683_100010561 Ga0070683_1000105619 300
256 3300005329 Ga0070683_100019128 Ga0070683_1000191287 300
257 3300005329 Ga0070683_100033374 Ga0070683_1000333744 300
258 3300005329 Ga0070683_100166269 Ga0070683_1001662692 300
259 3300005331 Ga0070670_100008994 Ga0070670_1000089948 300
260 3300005338 Ga0068868_100015982 Ga0068868_1000159826 300
261 3300005338 Ga0068868_100114957 Ga0068868_1001149573 300
262 3300005339 Ga0070660_100196516 Ga0070660_1001965162 300
263 3300005344 Ga0070661_100028661 Ga0070661_1000286611 300
264 3300005344 Ga0070661_100048893 Ga0070661_1000488934 300
265 3300005367 Ga0070667_100011075 Ga0070667_1000110756 300
266 3300005455 Ga0070663_100288361 Ga0070663_1002883611 300
267 3300005535 Ga0070684_100010509 Ga0070684_1000105093 300
268 3300005535 Ga0070684_100040064 Ga0070684_1000400642 300
269 3300005535 Ga0070684_100043209 Ga0070684_1000432091 300
270 3300005535 Ga0070684_100237989 Ga0070684_1002379892 300
271 3300005539 Ga0068853_100034852 Ga0068853_1000348526 300
272 3300005539 Ga0068853_100061496 Ga0068853_1000614963 300
273 3300005563 Ga0068855_100027068 Ga0068855_1000270685 300
274 3300005563 Ga0068855_100047905 Ga0068855_1000479055 300
275 3300005563 Ga0068855_100050549 Ga0068855_1000505492 300
276 3300005563 Ga0068855_100088072 Ga0068855_1000880724 300
277 3300005577 Ga0068857_100015300 Ga0068857_1000153003 300
278 3300005578 Ga0068854_100045906 Ga0068854_1000459062 300
279 3300005614 Ga0068856_100013024 Ga0068856_1000130241 300
280 3300005614 Ga0068856_100058572 Ga0068856_1000585723 300
281 3300005614 Ga0068856_100081489 Ga0068856_1000814894 300
282 3300005614 Ga0068856_100182228 Ga0068856_1001822282 300
283 3300005614 Ga0068856_100199138 Ga0068856_1001991382 300
284 3300005614 Ga0068856_100436883 Ga0068856_1004368832 300
285 3300005616 Ga0068852_100001910 Ga0068852_10000191012 300
286 3300005616 Ga0068852_100008741 Ga0068852_1000087412 300
287 3300005616 Ga0068852_100229041 Ga0068852_1002290412 300
288 3300005616 Ga0068852_100308322 Ga0068852_1003083222 300
289 3300005618 Ga0068864_100001563 Ga0068864_10000156318 300
290 3300005834 Ga0068851_10012708 Ga0068851_100127085 300
291 3300005841 Ga0068863_100002640 Ga0068863_1000026406 300
292 3300005842 Ga0068858_100025381 Ga0068858_1000253813 300
293 3300005843 Ga0068860_100000200 Ga0068860_10000020074 300
294 3300006028 Ga0070717_10001087 Ga0070717_100010877 300
295 3300006358 Ga0068871_100010469 Ga0068871_1000104697 300
296 3300006358 Ga0068871_100083221 Ga0068871_1000832213 300
297 3300009093 Ga0105240_10000516 Ga0105240_1000051611 300
298 3300009093 Ga0105240_10006110 Ga0105240_100061104 300
299 3300009093 Ga0105240_10006333 Ga0105240_1000633312 300
300 3300009093 Ga0105240_10007803 Ga0105240_100078034 300
301 3300009093 Ga0105240_10035938 Ga0105240_100359385 300
302 3300009093 Ga0105240_10069515 Ga0105240_100695155 300
303 3300009093 Ga0105240_10635292 Ga0105240_106352921 300
304 3300009098 Ga0105245_10009530 Ga0105245_100095304 300
305 3300009098 Ga0105245_10013827 Ga0105245_100138275 300
306 3300009174 Ga0105241_10000051 Ga0105241_1000005121 300
307 3300009174 Ga0105241_10001099 Ga0105241_1000109911 300
308 3300009174 Ga0105241_10002039 Ga0105241_100020394 300
309 3300009174 Ga0105241_10049894 Ga0105241_100498943 300
310 3300009174 Ga0105241_10077057 Ga0105241_100770573 300
311 3300009176 Ga0105242_10384648 Ga0105242_103846482 300
312 3300009177 Ga0105248_10019971 Ga0105248_100199714 300
313 3300009545 Ga0105237_10014988 Ga0105237_100149888 300
314 3300009545 Ga0105237_10024688 Ga0105237_100246885 300
315 3300009545 Ga0105237_10044299 Ga0105237_100442995 300
316 3300009551 Ga0105238_10000251 Ga0105238_1000025160 300
317 3300009551 Ga0105238_10003911 Ga0105238_1000391111 300
318 3300009551 Ga0105238_10021034 Ga0105238_100210345 300
319 3300009551 Ga0105238_10029981 Ga0105238_100299815 300
320 3300009551 Ga0105238_10132414 Ga0105238_101324142 300
321 3300009551 Ga0105238_10240288 Ga0105238_102402881 300
322 3300010375 Ga0105239_10000725 Ga0105239_100007256 300
323 3300010375 Ga0105239_10121104 Ga0105239_101211042 300
324 3300010375 Ga0105239_10216670 Ga0105239_102166703 300
325 3300013104 Ga0157370_10000174 Ga0157370_1000017455 300
326 3300013105 Ga0157369_10000262 Ga0157369_1000026211 300
327 3300013105 Ga0157369_10000369 Ga0157369_1000036960 300
328 3300013105 Ga0157369_10004534 Ga0157369_100045345 300
329 3300013105 Ga0157369_10007607 Ga0157369_100076076 300
330 3300013105 Ga0157369_10025609 Ga0157369_100256095 300
331 3300013105 Ga0157369_10108015 Ga0157369_101080152 300
332 3300013105 Ga0157369_10227352 Ga0157369_102273522 300
333 3300013296 Ga0157374_10001525 Ga0157374_1000152518 300
334 3300013296 Ga0157374_10014614 Ga0157374_100146142 300
335 3300013296 Ga0157374_10105671 Ga0157374_101056712 300
336 3300013297 Ga0157378_10042962 Ga0157378_100429625 300
337 3300013297 Ga0157378_10059298 Ga0157378_100592983 300
338 3300013297 Ga0157378_10068817 Ga0157378_100688174 300
339 3300013307 Ga0157372_10000659 Ga0157372_100006595 300
340 3300013307 Ga0157372_10007580 Ga0157372_1000758012 300
341 3300013307 Ga0157372_10017949 Ga0157372_100179493 300
342 3300013307 Ga0157372_10119497 Ga0157372_101194973 300
343 3300013307 Ga0157372_10139381 Ga0157372_101393813 300
344 3300013307 Ga0157372_10167492 Ga0157372_101674922 300
345 3300013307 Ga0157372_10193097 Ga0157372_101930972 300
346 3300013308 Ga0157375_10016043 Ga0157375_100160434 300
347 3300014968 Ga0157379_10112548 Ga0157379_101125482 300
348 3300014969 Ga0157376_10005272 Ga0157376_100052729 300
349 3300014969 Ga0157376_10018258 Ga0157376_100182582 300
350 3300025900 Ga0207710_10005191 Ga0207710_100051915 300
351 3300025904 Ga0207647_10022822 Ga0207647_100228223 300
352 3300025911 Ga0207654_10000068 Ga0207654_1000006859 300
353 3300025911 Ga0207654_10000548 Ga0207654_1000054822 300
354 3300025911 Ga0207654_10253832 Ga0207654_102538321 300
355 3300025913 Ga0207695_10000047 Ga0207695_10000047122 300
356 3300025913 Ga0207695_10000150 Ga0207695_1000015019 300
357 3300025913 Ga0207695_10000162 Ga0207695_10000162187 300
358 3300025913 Ga0207695_10001900 Ga0207695_100019005 300
359 3300025913 Ga0207695_10022767 Ga0207695_100227677 300
360 3300025913 Ga0207695_10033208 Ga0207695_100332083 300
361 3300025914 Ga0207671_10000155 Ga0207671_1000015531 300
362 3300025914 Ga0207671_10001417 Ga0207671_100014173 300
363 3300025920 Ga0207649_10018125 Ga0207649_100181255 300
364 3300025920 Ga0207649_10044610 Ga0207649_100446103 300
365 3300025924 Ga0207694_10000142 Ga0207694_1000014261 300
366 3300025924 Ga0207694_10000146 Ga0207694_100001464 300
367 3300025924 Ga0207694_10001885 Ga0207694_100018857 300
368 3300025924 Ga0207694_10018855 Ga0207694_100188555 300
369 3300025924 Ga0207694_10139608 Ga0207694_101396083 300
370 3300025925 Ga0207650_10006669 Ga0207650_100066697 300
371 3300025927 Ga0207687_10041670 Ga0207687_100416702 300
372 3300025927 Ga0207687_10343679 Ga0207687_103436791 300
373 3300025941 Ga0207711_10261415 Ga0207711_102614152 300
374 3300025949 Ga0207667_10003680 Ga0207667_100036803 300
375 3300025949 Ga0207667_10041966 Ga0207667_100419664 300
376 3300025949 Ga0207667_10066930 Ga0207667_100669303 300
377 3300025949 Ga0207667_10151048 Ga0207667_101510483 300
378 3300025986 Ga0207658_10000693 Ga0207658_100006934 300
379 3300026023 Ga0207677_10001259 Ga0207677_1000125910 300
380 3300026023 Ga0207677_10019180 Ga0207677_100191804 300
381 3300026035 Ga0207703_10017859 Ga0207703_100178596 300
382 3300026041 Ga0207639_10018233 Ga0207639_100182334 300
383 3300026041 Ga0207639_10020161 Ga0207639_100201612 300
384 3300026078 Ga0207702_10008441 Ga0207702_100084415 300
385 3300026078 Ga0207702_10054551 Ga0207702_100545513 300
386 3300026078 Ga0207702_10063963 Ga0207702_100639631 300
387 3300026078 Ga0207702_10117865 Ga0207702_101178653 300
388 3300026078 Ga0207702_10206607 Ga0207702_102066071 300
389 3300026088 Ga0207641_10002156 Ga0207641_1000215613 300
390 3300026116 Ga0207674_10001977 Ga0207674_100019773 300
391 3300026116 Ga0207674_10010049 Ga0207674_1001004910 300
392 3300026116 Ga0207674_10108660 Ga0207674_101086602 300
393 3300026142 Ga0207698_10000082 Ga0207698_1000008211 300
394 3300026142 Ga0207698_10000241 Ga0207698_100002413 300
395 3300026142 Ga0207698_10061003 Ga0207698_100610034 300
396 3300026142 Ga0207698_10102929 Ga0207698_101029292 300
397 3300028381 Ga0268264_10004090 Ga0268264_1000409010 300
398 3300031090 Ga0265760_10017599 Ga0265760_100175991 300
399 3300031241 Ga0265325_10075741 Ga0265325_100757411 300
400 3300031247 Ga0265340_10127905 Ga0265340_101279051 300
401 3300031344 Ga0265316_10116478 Ga0265316_101164781 300
402 3300035119 Ga0373956_0031670 Ga0373956_0031670_97_1179 300
403 3300036401 Ga0373937_0004389 Ga0373937_0004389_6381_7376 300
404 3300044694 Ga0466963_0037741 Ga0466963_0037741_937_1971 300
405 3300045976 Ga0466967_0000838 Ga0466967_0000838_10971_12005 300
406 3300046473 Ga0495582_0148595 Ga0495582_0148595_397_1308 300
407 3300046543 Ga0495645_0037456 Ga0495645_0037456_885_1913 300
408 3300046689 Ga0495613_0062652 Ga0495613_0062652_704_1669 300
409 3300048904 Ga0496101_0185538 Ga0496101_0185538_403_1368 300
410 3300048907 Ga0496104_0021844 Ga0496104_0021844_3602_4567 300
411 3300048908 Ga0496105_0174828 Ga0496105_0174828_79_1023 300
412 3300048909 Ga0496106_0153717 Ga0496106_0153717_405_1370 300
413 3300048917 Ga0496114_0004599 Ga0496114_0004599_5955_6920 300
414 3300048918 Ga0496115_0020619 Ga0496115_0020619_3409_4374 300

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08279

HTH_11

HTH domain

54

109

0.92

PF13280

WYL

WYL domain

188

364

0.92

PF08220

HTH_DeoR

DeoR-like helix-turn-helix domain

54

112

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u2w-assembly1.cif.gz_B crystal structure of the staphylococcus aureus pi258 cadc 0.7807 1 43
1r23-assembly1.cif.gz_A crystal structure of the cyanobacterial metallothionein repressor smtb in the zn1-form (one zn(ii) per dimer) 0.7741 1 46
1r1t-assembly1.cif.gz_B crystal structure of the cyanobacterial metallothionein repressor smtb in the apo-form 0.7618 1 45
1r22-assembly1.cif.gz_B crystal structure of the cyanobacterial metallothionein repressor smtb (c14s/c61s/c121s mutant) in the zn2alpha5-form 0.7521 1 45
6cda-assembly1.cif.gz_A-2 crystal structure of l34a czra in the zn(ii)bound state 0.7444 2 45
ID Description Score Start End Superfamily
af_P06709_1_64_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8798 1 44 1.10.10.10
af_Q2FVV6_1_65_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8789 1 46 1.10.10.10
3v7sA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8698 1 45 1.10.10.10
af_Q2G258_1_64_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8663 1 45 1.10.10.10
4wf2A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8598 1 43 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1E1VVD0-F1-model_v4 deleted 0.905 132 300
AF-A0A1E1VVD0-F1-model_v4 deleted 0.8849 132 300
AF-V9GIZ5-F1-model_v4 Transcriptional regulator, DeoR family 0.8488 58 298
AF-A0A4Q5V196-F1-model_v4 deleted 0.8455 107 300
AF-M6RFN3-F1-model_v4 WYL domain protein 0.8306 213 294

Feature Viewer

pLDDT pTM Quality
83.74 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map