F438348
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 414 | 217 | 403 | 320 |
Family's Representative Sequence
| Representative Sequence | 3300026075|Ga0207708_10002025|Ga0207708_100020252 |
| Length | 372 |
| Sequence | MGAQRPISITQHTTRIDIGRCAPVLIRRHEQYSNKHDTHCHVCEIKFLRMRADRLLTIVLLLQAHHQLTSRDLAARLEVSERTIHRDMEALSGAGIPVIALRGTHGGWSLLGEYRTNLTGLNEAEIETLFVTKPSRLLADLKLEKAAEGALLKLLAALPASYQRAAERARRRIHVDVGGWARQEEVAPLLPTLQEAVWLERKLSFSYDRGRECEPAERLCDPLGLVAKGSVWYLVAGVGSDIRTYRVSRILRAEVLQERVVIPDDFDLAAYWEASALKFKSSLPSYTARFRVAPEVFQFLQFAGRFSRVSQTYETDADGWLRVSVRFDVEEMACQFALSFGSKLEVLEPETLRAKVIQAAKETVEFYKQANA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917027 | Brevibacillus sp. CF112 | Isolate | Rhizosphere |
| 2 | 2512564013 | Brevibacillus sp. BC25 | Isolate | Rhizosphere |
| 3 | 2857453340 | Paenibacillus sp. R-74130 | Isolate | Unclassified |
| 4 | 2857460504 | Brevibacillus sp. R-74223 | Isolate | Unclassified |
| 5 | 2915597211 | Brevibacillus brevis Ag35 | Isolate | Nodule |
| 6 | 2915606848 | Brevibacillus sp. HD1.4A | Isolate | Rhizosphere |
| 7 | 2929183550 | Brevibacillus sp. R-71971 Hybrid assembly | Isolate | Unclassified |
| 8 | 2980182181 | Paenibacillus cymbidii R196 | Isolate | Unclassified |
| 9 | 3006826541 | Bacillus haikouensis CrR16 | Isolate | Unclassified |
| 10 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 70 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 144 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 145 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 146 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 147 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 148 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 149 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 150 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 151 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 152 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 153 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 154 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 155 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 156 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 157 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 158 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 159 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 160 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 161 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 162 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 163 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 164 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 165 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 166 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 167 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 168 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 169 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 170 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 171 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 172 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 179 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 180 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 181 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 182 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 183 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 184 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 185 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 186 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 187 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 188 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 189 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 190 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 191 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 192 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 193 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 194 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 195 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 196 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 197 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 198 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 199 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 200 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 201 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 202 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 203 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 204 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 206 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 207 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 208 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 209 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 210 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 211 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 212 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 213 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 214 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 215 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 216 | 8056533031 | Paenibacillus qinlingensis TEGT-2 | Isolate | Unclassified |
| 217 | 8057345674 | Herbiconiux aconitum CPCC 205763 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.86 |
| Metatranscriptomes | 0.48 |
| Isolates | 2.66 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.48 |
| Nodule | 0.24 |
| Rhizoplane | 3.62 |
| Rhizosphere | 92.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.9 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1000680 | 3300000546 | Bacteria | 5741 |
| 2 | rootH1_10022255 | 3300003323 | Bacteria | 2877 |
| 3 | Ga0058860_12050340 | 3300004801 | Unclassified | 1471 |
| 4 | Ga0065715_10190200 | 3300005293 | Bacteria | 1420 |
| 5 | Ga0070658_10012335 | 3300005327 | Bacteria | 6862 |
| 6 | Ga0070658_10050964 | 3300005327 | Bacteria | 3355 |
| 7 | Ga0070676_10138234 | 3300005328 | Bacteria | 1548 |
| 8 | Ga0070683_100010561 | 3300005329 | Bacteria | 7939 |
| 9 | Ga0070683_100019128 | 3300005329 | Bacteria | 6078 |
| 10 | Ga0070683_100033374 | 3300005329 | Bacteria | 4694 |
| 11 | Ga0070683_100166269 | 3300005329 | Bacteria | 2093 |
| 12 | Ga0070690_100008326 | 3300005330 | Bacteria | 5968 |
| 13 | Ga0070670_100008994 | 3300005331 | Bacteria | 8532 |
| 14 | Ga0068869_100021046 | 3300005334 | Bacteria | 4483 |
| 15 | Ga0068869_100044071 | 3300005334 | Unclassified | 3208 |
| 16 | Ga0070666_10010441 | 3300005335 | Bacteria | 5810 |
| 17 | Ga0070680_100000868 | 3300005336 | Bacteria | 21466 |
| 18 | Ga0068868_100015982 | 3300005338 | Bacteria | 5565 |
| 19 | Ga0068868_100068458 | 3300005338 | Bacteria | 2827 |
| 20 | Ga0068868_100114957 | 3300005338 | Bacteria | 2190 |
| 21 | Ga0068868_100182235 | 3300005338 | Bacteria | 1743 |
| 22 | Ga0068868_100204172 | 3300005338 | Unclassified | 1649 |
| 23 | Ga0068868_100499873 | 3300005338 | Bacteria | 1065 |
| 24 | Ga0070660_100196516 | 3300005339 | Unclassified | 1635 |
| 25 | Ga0070687_100003368 | 3300005343 | Bacteria | 6195 |
| 26 | Ga0070661_100028661 | 3300005344 | Bacteria | 4017 |
| 27 | Ga0070661_100048893 | 3300005344 | Unclassified | 3096 |
| 28 | Ga0070661_100127471 | 3300005344 | Bacteria | 1910 |
| 29 | Ga0070661_100185793 | 3300005344 | Bacteria | 1583 |
| 30 | Ga0070669_100030907 | 3300005353 | Bacteria | 3866 |
| 31 | Ga0070669_100152771 | 3300005353 | Unclassified | 1788 |
| 32 | Ga0070675_100070083 | 3300005354 | Unclassified | 2905 |
| 33 | Ga0070675_100518723 | 3300005354 | Unclassified | 1075 |
| 34 | Ga0070688_100210627 | 3300005365 | Unclassified | 1364 |
| 35 | Ga0070667_100006966 | 3300005367 | Bacteria | 9392 |
| 36 | Ga0070667_100011075 | 3300005367 | Bacteria | 7460 |
| 37 | Ga0070714_100156130 | 3300005435 | Unclassified | 2060 |
| 38 | Ga0070713_100126216 | 3300005436 | Bacteria | 2251 |
| 39 | Ga0070711_100040831 | 3300005439 | Unclassified | 3131 |
| 40 | Ga0070705_100000331 | 3300005440 | Bacteria | 27964 |
| 41 | Ga0070705_100074921 | 3300005440 | Unclassified | 2059 |
| 42 | Ga0070700_100000193 | 3300005441 | Bacteria | 34477 |
| 43 | Ga0070694_100004903 | 3300005444 | Bacteria | 8063 |
| 44 | Ga0070694_100013196 | 3300005444 | Bacteria | 5157 |
| 45 | Ga0070694_100044399 | 3300005444 | Bacteria | 2974 |
| 46 | Ga0070663_100288361 | 3300005455 | Bacteria | 1310 |
| 47 | Ga0070678_100014571 | 3300005456 | Bacteria | 4967 |
| 48 | Ga0070681_10000032 | 3300005458 | Bacteria | 99533 |
| 49 | Ga0070706_100001365 | 3300005467 | Bacteria | 25959 |
| 50 | Ga0070706_100012727 | 3300005467 | Bacteria | 7785 |
| 51 | Ga0070706_100269930 | 3300005467 | Bacteria | 1588 |
| 52 | Ga0070707_100003851 | 3300005468 | Bacteria | 14133 |
| 53 | Ga0070707_100175573 | 3300005468 | Unclassified | 2088 |
| 54 | Ga0070698_100122792 | 3300005471 | Bacteria | 2555 |
| 55 | Ga0070698_100295727 | 3300005471 | Bacteria | 1550 |
| 56 | Ga0070699_100000062 | 3300005518 | Bacteria | 101909 |
| 57 | Ga0070699_100026656 | 3300005518 | Bacteria | 4984 |
| 58 | Ga0070699_100114253 | 3300005518 | Bacteria | 2372 |
| 59 | Ga0070679_100000331 | 3300005530 | Bacteria | 40170 |
| 60 | Ga0070684_100010509 | 3300005535 | Bacteria | 7337 |
| 61 | Ga0070684_100040064 | 3300005535 | Bacteria | 4032 |
| 62 | Ga0070684_100043209 | 3300005535 | Bacteria | 3891 |
| 63 | Ga0070684_100237989 | 3300005535 | Bacteria | 1663 |
| 64 | Ga0068853_100034852 | 3300005539 | Bacteria | 4274 |
| 65 | Ga0068853_100061496 | 3300005539 | Unclassified | 3248 |
| 66 | Ga0070672_100009946 | 3300005543 | Bacteria | 6577 |
| 67 | Ga0070686_100046419 | 3300005544 | Bacteria | 2741 |
| 68 | Ga0070696_100000026 | 3300005546 | Bacteria | 68402 |
| 69 | Ga0070696_100018488 | 3300005546 | Bacteria | 4710 |
| 70 | Ga0070696_100051639 | 3300005546 | Unclassified | 2859 |
| 71 | Ga0070693_100075196 | 3300005547 | Bacteria | 1999 |
| 72 | Ga0070704_100060462 | 3300005549 | Bacteria | 2707 |
| 73 | Ga0070704_100091629 | 3300005549 | Bacteria | 2267 |
| 74 | Ga0070704_100093525 | 3300005549 | Bacteria | 2247 |
| 75 | Ga0068855_100027068 | 3300005563 | Bacteria | 6860 |
| 76 | Ga0068855_100047905 | 3300005563 | Bacteria | 5047 |
| 77 | Ga0068855_100050549 | 3300005563 | Bacteria | 4898 |
| 78 | Ga0068855_100088072 | 3300005563 | Bacteria | 3586 |
| 79 | Ga0068855_100128599 | 3300005563 | Bacteria | 2894 |
| 80 | Ga0068857_100015300 | 3300005577 | Bacteria | 6697 |
| 81 | Ga0068857_100113869 | 3300005577 | Unclassified | 2432 |
| 82 | Ga0068854_100045906 | 3300005578 | Bacteria | 3108 |
| 83 | Ga0068856_100013024 | 3300005614 | Bacteria | 8054 |
| 84 | Ga0068856_100058572 | 3300005614 | Bacteria | 3804 |
| 85 | Ga0068856_100081489 | 3300005614 | Unclassified | 3211 |
| 86 | Ga0068856_100182228 | 3300005614 | Unclassified | 2113 |
| 87 | Ga0068856_100199138 | 3300005614 | Unclassified | 2017 |
| 88 | Ga0068856_100436883 | 3300005614 | Unclassified | 1329 |
| 89 | Ga0068852_100001910 | 3300005616 | Bacteria | 14185 |
| 90 | Ga0068852_100008741 | 3300005616 | Bacteria | 7488 |
| 91 | Ga0068852_100229041 | 3300005616 | Bacteria | 1771 |
| 92 | Ga0068852_100308322 | 3300005616 | Bacteria | 1534 |
| 93 | Ga0068859_100107833 | 3300005617 | Unclassified | 2846 |
| 94 | Ga0068864_100001563 | 3300005618 | Bacteria | 18850 |
| 95 | Ga0068864_100007584 | 3300005618 | Bacteria | 8941 |
| 96 | Ga0068864_100023819 | 3300005618 | Bacteria | 5144 |
| 97 | Ga0068864_100055032 | 3300005618 | Unclassified | 3434 |
| 98 | Ga0068864_100502932 | 3300005618 | Unclassified | 1166 |
| 99 | Ga0068861_100016321 | 3300005719 | Bacteria | 5253 |
| 100 | Ga0068861_100072873 | 3300005719 | Bacteria | 2666 |
| 101 | Ga0068861_100087342 | 3300005719 | Unclassified | 2454 |
| 102 | Ga0068851_10008781 | 3300005834 | Bacteria | 4683 |
| 103 | Ga0068851_10012708 | 3300005834 | Bacteria | 3975 |
| 104 | Ga0068870_10056126 | 3300005840 | Bacteria | 2101 |
| 105 | Ga0068870_10221448 | 3300005840 | Unclassified | 1158 |
| 106 | Ga0068863_100002640 | 3300005841 | Bacteria | 17744 |
| 107 | Ga0068863_100043715 | 3300005841 | Bacteria | 4252 |
| 108 | Ga0068858_100025381 | 3300005842 | Bacteria | 5514 |
| 109 | Ga0068858_100071945 | 3300005842 | Unclassified | 3208 |
| 110 | Ga0068858_100172550 | 3300005842 | Bacteria | 2039 |
| 111 | Ga0068860_100000200 | 3300005843 | Bacteria | 95120 |
| 112 | Ga0068860_100248740 | 3300005843 | Bacteria | 1731 |
| 113 | Ga0070717_10001087 | 3300006028 | Bacteria | 18276 |
| 114 | Ga0070717_10004754 | 3300006028 | Bacteria | 9874 |
| 115 | Ga0070717_10035392 | 3300006028 | Bacteria | 4042 |
| 116 | Ga0070716_100100065 | 3300006173 | Bacteria | 1775 |
| 117 | Ga0097621_100004197 | 3300006237 | Bacteria | 9996 |
| 118 | Ga0097621_100014311 | 3300006237 | Bacteria | 5933 |
| 119 | Ga0068871_100010469 | 3300006358 | Bacteria | 6770 |
| 120 | Ga0068871_100011999 | 3300006358 | Bacteria | 6375 |
| 121 | Ga0068871_100083221 | 3300006358 | Bacteria | 2654 |
| 122 | Ga0075428_100199302 | 3300006844 | Bacteria | 2165 |
| 123 | Ga0075428_100434486 | 3300006844 | Bacteria | 1406 |
| 124 | Ga0075431_100055944 | 3300006847 | Bacteria | 4070 |
| 125 | Ga0075431_100233600 | 3300006847 | Unclassified | 1873 |
| 126 | Ga0075431_100283918 | 3300006847 | Bacteria | 1676 |
| 127 | Ga0075433_10093084 | 3300006852 | Bacteria | 2666 |
| 128 | Ga0075434_100019657 | 3300006871 | Bacteria | 6537 |
| 129 | Ga0075434_100423164 | 3300006871 | Unclassified | 1353 |
| 130 | Ga0068865_100010843 | 3300006881 | Bacteria | 5686 |
| 131 | Ga0097620_100107839 | 3300006931 | Unclassified | 2846 |
| 132 | Ga0105240_10000516 | 3300009093 | Bacteria | 71158 |
| 133 | Ga0105240_10005538 | 3300009093 | Bacteria | 18805 |
| 134 | Ga0105240_10006110 | 3300009093 | Bacteria | 17764 |
| 135 | Ga0105240_10006333 | 3300009093 | Bacteria | 17422 |
| 136 | Ga0105240_10007803 | 3300009093 | Bacteria | 15461 |
| 137 | Ga0105240_10035938 | 3300009093 | Bacteria | 6379 |
| 138 | Ga0105240_10069515 | 3300009093 | Unclassified | 4358 |
| 139 | Ga0105240_10635292 | 3300009093 | Bacteria | 1172 |
| 140 | Ga0111539_10192183 | 3300009094 | Bacteria | 2381 |
| 141 | Ga0111539_10209261 | 3300009094 | Bacteria | 2273 |
| 142 | Ga0105245_10009530 | 3300009098 | Bacteria | 8467 |
| 143 | Ga0105245_10013827 | 3300009098 | Bacteria | 7031 |
| 144 | Ga0114129_10005795 | 3300009147 | Bacteria | 17494 |
| 145 | Ga0114129_10147522 | 3300009147 | Bacteria | 3221 |
| 146 | Ga0105243_10028943 | 3300009148 | Bacteria | 4257 |
| 147 | Ga0105241_10000051 | 3300009174 | Bacteria | 95075 |
| 148 | Ga0105241_10001099 | 3300009174 | Bacteria | 20586 |
| 149 | Ga0105241_10002039 | 3300009174 | Bacteria | 15278 |
| 150 | Ga0105241_10049894 | 3300009174 | Bacteria | 3189 |
| 151 | Ga0105241_10077057 | 3300009174 | Bacteria | 2602 |
| 152 | Ga0105242_10050158 | 3300009176 | Bacteria | 3397 |
| 153 | Ga0105242_10384648 | 3300009176 | Bacteria | 1305 |
| 154 | Ga0105248_10015184 | 3300009177 | Bacteria | 8486 |
| 155 | Ga0105248_10019971 | 3300009177 | Bacteria | 7417 |
| 156 | Ga0105248_10580525 | 3300009177 | Unclassified | 1265 |
| 157 | Ga0105237_10010412 | 3300009545 | Bacteria | 9898 |
| 158 | Ga0105237_10014988 | 3300009545 | Bacteria | 8079 |
| 159 | Ga0105237_10024688 | 3300009545 | Bacteria | 6148 |
| 160 | Ga0105237_10044299 | 3300009545 | Unclassified | 4480 |
| 161 | Ga0105238_10000251 | 3300009551 | Bacteria | 59944 |
| 162 | Ga0105238_10003911 | 3300009551 | Bacteria | 14796 |
| 163 | Ga0105238_10004996 | 3300009551 | Bacteria | 13116 |
| 164 | Ga0105238_10021034 | 3300009551 | Bacteria | 6648 |
| 165 | Ga0105238_10029981 | 3300009551 | Bacteria | 5537 |
| 166 | Ga0105238_10132414 | 3300009551 | Bacteria | 2471 |
| 167 | Ga0105238_10240288 | 3300009551 | Unclassified | 1789 |
| 168 | Ga0105249_10262035 | 3300009553 | Bacteria | 1718 |
| 169 | Ga0105249_10339982 | 3300009553 | Unclassified | 1517 |
| 170 | Ga0105239_10000725 | 3300010375 | Bacteria | 46872 |
| 171 | Ga0105239_10121104 | 3300010375 | Unclassified | 2906 |
| 172 | Ga0105239_10216670 | 3300010375 | Bacteria | 2146 |
| 173 | Ga0105239_10347595 | 3300010375 | Bacteria | 1674 |
| 174 | Ga0105246_10033653 | 3300011119 | Bacteria | 3409 |
| 175 | Ga0157370_10000174 | 3300013104 | Bacteria | 79990 |
| 176 | Ga0157370_10005061 | 3300013104 | Bacteria | 14880 |
| 177 | Ga0157369_10000262 | 3300013105 | Bacteria | 71158 |
| 178 | Ga0157369_10000369 | 3300013105 | Bacteria | 59934 |
| 179 | Ga0157369_10004534 | 3300013105 | Bacteria | 16345 |
| 180 | Ga0157369_10007607 | 3300013105 | Bacteria | 12465 |
| 181 | Ga0157369_10020990 | 3300013105 | Bacteria | 7303 |
| 182 | Ga0157369_10025609 | 3300013105 | Bacteria | 6546 |
| 183 | Ga0157369_10108015 | 3300013105 | Bacteria | 2960 |
| 184 | Ga0157369_10227352 | 3300013105 | Bacteria | 1951 |
| 185 | Ga0157374_10001525 | 3300013296 | Bacteria | 19503 |
| 186 | Ga0157374_10014614 | 3300013296 | Bacteria | 6871 |
| 187 | Ga0157374_10017230 | 3300013296 | Bacteria | 6361 |
| 188 | Ga0157374_10105671 | 3300013296 | Bacteria | 2704 |
| 189 | Ga0157378_10039116 | 3300013297 | Unclassified | 4206 |
| 190 | Ga0157378_10042962 | 3300013297 | Unclassified | 4013 |
| 191 | Ga0157378_10059298 | 3300013297 | Bacteria | 3415 |
| 192 | Ga0157378_10068817 | 3300013297 | Bacteria | 3175 |
| 193 | Ga0163162_10021397 | 3300013306 | Bacteria | 6369 |
| 194 | Ga0163162_10071571 | 3300013306 | Bacteria | 3521 |
| 195 | Ga0163162_10138388 | 3300013306 | Unclassified | 2546 |
| 196 | Ga0163162_10427392 | 3300013306 | Bacteria | 1457 |
| 197 | Ga0157372_10000659 | 3300013307 | Bacteria | 37935 |
| 198 | Ga0157372_10007580 | 3300013307 | Bacteria | 11540 |
| 199 | Ga0157372_10017949 | 3300013307 | Bacteria | 7603 |
| 200 | Ga0157372_10119497 | 3300013307 | Bacteria | 3025 |
| 201 | Ga0157372_10139381 | 3300013307 | Unclassified | 2793 |
| 202 | Ga0157372_10167492 | 3300013307 | Unclassified | 2541 |
| 203 | Ga0157372_10193097 | 3300013307 | Bacteria | 2358 |
| 204 | Ga0157372_10212900 | 3300013307 | Unclassified | 2240 |
| 205 | Ga0157375_10004500 | 3300013308 | Bacteria | 12119 |
| 206 | Ga0157375_10016043 | 3300013308 | Bacteria | 6720 |
| 207 | Ga0157375_10024783 | 3300013308 | Bacteria | 5559 |
| 208 | Ga0163163_10000249 | 3300014325 | Bacteria | 54997 |
| 209 | Ga0163163_10066497 | 3300014325 | Bacteria | 3580 |
| 210 | Ga0163163_10201914 | 3300014325 | Bacteria | 2036 |
| 211 | Ga0157379_10047593 | 3300014968 | Bacteria | 3826 |
| 212 | Ga0157379_10105134 | 3300014968 | Bacteria | 2534 |
| 213 | Ga0157379_10112548 | 3300014968 | Unclassified | 2446 |
| 214 | Ga0157376_10005272 | 3300014969 | Bacteria | 9029 |
| 215 | Ga0157376_10018258 | 3300014969 | Bacteria | 5372 |
| 216 | Ga0157376_10067286 | 3300014969 | Bacteria | 3029 |
| 217 | Ga0157376_10110566 | 3300014969 | Bacteria | 2418 |
| 218 | Ga0157376_10183537 | 3300014969 | Bacteria | 1914 |
| 219 | Ga0207697_10004330 | 3300025315 | Bacteria | 6792 |
| 220 | Ga0207653_10000132 | 3300025885 | Bacteria | 53266 |
| 221 | Ga0207710_10005191 | 3300025900 | Bacteria | 5629 |
| 222 | Ga0207647_10022822 | 3300025904 | Unclassified | 4151 |
| 223 | Ga0207643_10109093 | 3300025908 | Bacteria | 1629 |
| 224 | Ga0207643_10196044 | 3300025908 | Bacteria | 1228 |
| 225 | Ga0207705_10000021 | 3300025909 | Bacteria | 309436 |
| 226 | Ga0207684_10000230 | 3300025910 | Bacteria | 85141 |
| 227 | Ga0207684_10020876 | 3300025910 | Bacteria | 5595 |
| 228 | Ga0207654_10000068 | 3300025911 | Bacteria | 67500 |
| 229 | Ga0207654_10000548 | 3300025911 | Bacteria | 21477 |
| 230 | Ga0207654_10253832 | 3300025911 | Bacteria | 1180 |
| 231 | Ga0207707_10000062 | 3300025912 | Bacteria | 108192 |
| 232 | Ga0207695_10000047 | 3300025913 | Bacteria | 422459 |
| 233 | Ga0207695_10000150 | 3300025913 | Bacteria | 207099 |
| 234 | Ga0207695_10000162 | 3300025913 | Bacteria | 198155 |
| 235 | Ga0207695_10001900 | 3300025913 | Bacteria | 32599 |
| 236 | Ga0207695_10022767 | 3300025913 | Bacteria | 7100 |
| 237 | Ga0207695_10033208 | 3300025913 | Bacteria | 5635 |
| 238 | Ga0207671_10000155 | 3300025914 | Bacteria | 106931 |
| 239 | Ga0207671_10001417 | 3300025914 | Bacteria | 27842 |
| 240 | Ga0207663_10027354 | 3300025916 | Bacteria | 3323 |
| 241 | Ga0207660_10000300 | 3300025917 | Bacteria | 32727 |
| 242 | Ga0207662_10061477 | 3300025918 | Bacteria | 2255 |
| 243 | Ga0207649_10018125 | 3300025920 | Bacteria | 3998 |
| 244 | Ga0207649_10044610 | 3300025920 | Unclassified | 2715 |
| 245 | Ga0207652_10000175 | 3300025921 | Bacteria | 68407 |
| 246 | Ga0207646_10063167 | 3300025922 | Unclassified | 3306 |
| 247 | Ga0207681_10222921 | 3300025923 | Unclassified | 1460 |
| 248 | Ga0207681_10281570 | 3300025923 | Bacteria | 1309 |
| 249 | Ga0207694_10000142 | 3300025924 | Bacteria | 74189 |
| 250 | Ga0207694_10000146 | 3300025924 | Bacteria | 72706 |
| 251 | Ga0207694_10001885 | 3300025924 | Bacteria | 17384 |
| 252 | Ga0207694_10018855 | 3300025924 | Bacteria | 5215 |
| 253 | Ga0207694_10139608 | 3300025924 | Bacteria | 1948 |
| 254 | Ga0207650_10006669 | 3300025925 | Bacteria | 7878 |
| 255 | Ga0207687_10041670 | 3300025927 | Bacteria | 3154 |
| 256 | Ga0207687_10343679 | 3300025927 | Bacteria | 1214 |
| 257 | Ga0207706_10011628 | 3300025933 | Bacteria | 8021 |
| 258 | Ga0207706_10078359 | 3300025933 | Bacteria | 2906 |
| 259 | Ga0207709_10022876 | 3300025935 | Bacteria | 3551 |
| 260 | Ga0207670_10000558 | 3300025936 | Bacteria | 20611 |
| 261 | Ga0207665_10096411 | 3300025939 | Bacteria | 2057 |
| 262 | Ga0207691_10012511 | 3300025940 | Bacteria | 8136 |
| 263 | Ga0207711_10261415 | 3300025941 | Unclassified | 1591 |
| 264 | Ga0207689_10004516 | 3300025942 | Bacteria | 12596 |
| 265 | Ga0207689_10115435 | 3300025942 | Bacteria | 2207 |
| 266 | Ga0207689_10140118 | 3300025942 | Unclassified | 1992 |
| 267 | Ga0207667_10003680 | 3300025949 | Bacteria | 18901 |
| 268 | Ga0207667_10041966 | 3300025949 | Bacteria | 4865 |
| 269 | Ga0207667_10053586 | 3300025949 | Bacteria | 4244 |
| 270 | Ga0207667_10066930 | 3300025949 | Bacteria | 3743 |
| 271 | Ga0207667_10080320 | 3300025949 | Bacteria | 3379 |
| 272 | Ga0207667_10151048 | 3300025949 | Unclassified | 2391 |
| 273 | Ga0207651_10099387 | 3300025960 | Bacteria | 2155 |
| 274 | Ga0207712_10121615 | 3300025961 | Bacteria | 1976 |
| 275 | Ga0207668_10350091 | 3300025972 | Unclassified | 1235 |
| 276 | Ga0207658_10000693 | 3300025986 | Bacteria | 29296 |
| 277 | Ga0207677_10001259 | 3300026023 | Bacteria | 13650 |
| 278 | Ga0207677_10019180 | 3300026023 | Bacteria | 4124 |
| 279 | Ga0207677_10050023 | 3300026023 | Bacteria | 2825 |
| 280 | Ga0207677_10406870 | 3300026023 | Unclassified | 1155 |
| 281 | Ga0207703_10017859 | 3300026035 | Bacteria | 5540 |
| 282 | Ga0207703_10041771 | 3300026035 | Unclassified | 3676 |
| 283 | Ga0207639_10018233 | 3300026041 | Unclassified | 4985 |
| 284 | Ga0207639_10020161 | 3300026041 | Bacteria | 4770 |
| 285 | Ga0207639_10180232 | 3300026041 | Unclassified | 1796 |
| 286 | Ga0207708_10000069 | 3300026075 | Bacteria | 82187 |
| 287 | Ga0207708_10002025 | 3300026075 | Bacteria | 14944 |
| 288 | Ga0207702_10008441 | 3300026078 | Bacteria | 8691 |
| 289 | Ga0207702_10054551 | 3300026078 | Unclassified | 3387 |
| 290 | Ga0207702_10063963 | 3300026078 | Bacteria | 3147 |
| 291 | Ga0207702_10117865 | 3300026078 | Unclassified | 2371 |
| 292 | Ga0207702_10126917 | 3300026078 | Bacteria | 2292 |
| 293 | Ga0207702_10206607 | 3300026078 | Bacteria | 1823 |
| 294 | Ga0207641_10002156 | 3300026088 | Bacteria | 18538 |
| 295 | Ga0207641_10476358 | 3300026088 | Bacteria | 1209 |
| 296 | Ga0207648_10031257 | 3300026089 | Bacteria | 4707 |
| 297 | Ga0207648_10168376 | 3300026089 | Unclassified | 1936 |
| 298 | Ga0207676_10015720 | 3300026095 | Bacteria | 5468 |
| 299 | Ga0207676_10064271 | 3300026095 | Bacteria | 2918 |
| 300 | Ga0207676_10215737 | 3300026095 | Bacteria | 1705 |
| 301 | Ga0207676_10482439 | 3300026095 | Unclassified | 1174 |
| 302 | Ga0207674_10001977 | 3300026116 | Bacteria | 25960 |
| 303 | Ga0207674_10010049 | 3300026116 | Bacteria | 10766 |
| 304 | Ga0207674_10066101 | 3300026116 | Unclassified | 3643 |
| 305 | Ga0207674_10108660 | 3300026116 | Unclassified | 2750 |
| 306 | Ga0207674_10140412 | 3300026116 | Unclassified | 2375 |
| 307 | Ga0207674_10206100 | 3300026116 | Bacteria | 1915 |
| 308 | Ga0207675_100012904 | 3300026118 | Bacteria | 7803 |
| 309 | Ga0207675_100069232 | 3300026118 | Unclassified | 3298 |
| 310 | Ga0207683_10002332 | 3300026121 | Bacteria | 16648 |
| 311 | Ga0207698_10000082 | 3300026142 | Bacteria | 62831 |
| 312 | Ga0207698_10000241 | 3300026142 | Bacteria | 33787 |
| 313 | Ga0207698_10061003 | 3300026142 | Bacteria | 2936 |
| 314 | Ga0207698_10092959 | 3300026142 | Bacteria | 2475 |
| 315 | Ga0207698_10102929 | 3300026142 | Unclassified | 2372 |
| 316 | Ga0268264_10004090 | 3300028381 | Bacteria | 12487 |
| 317 | Ga0265338_10192327 | 3300028800 | Bacteria | 1546 |
| 318 | Ga0265760_10017599 | 3300031090 | Unclassified | 2053 |
| 319 | Ga0265320_10035764 | 3300031240 | Unclassified | 2516 |
| 320 | Ga0265325_10075741 | 3300031241 | Bacteria | 1680 |
| 321 | Ga0265340_10127905 | 3300031247 | Unclassified | 1166 |
| 322 | Ga0265339_10001021 | 3300031249 | Bacteria | 21326 |
| 323 | Ga0265316_10056394 | 3300031344 | Bacteria | 3069 |
| 324 | Ga0265316_10116478 | 3300031344 | Unclassified | 2020 |
| 325 | Ga0307408_100013261 | 3300031548 | Bacteria | 5469 |
| 326 | Ga0316579_10001728 | 3300031691 | Bacteria | 8021 |
| 327 | Ga0265342_10002201 | 3300031712 | Bacteria | 17135 |
| 328 | Ga0307405_10162985 | 3300031731 | Bacteria | 1582 |
| 329 | Ga0307406_10003022 | 3300031901 | Bacteria | 9149 |
| 330 | Ga0307407_10094679 | 3300031903 | Bacteria | 1839 |
| 331 | Ga0307412_10018785 | 3300031911 | Bacteria | 4169 |
| 332 | Ga0307412_10055903 | 3300031911 | Bacteria | 2628 |
| 333 | Ga0307409_100299912 | 3300031995 | Bacteria | 1494 |
| 334 | Ga0307416_100002178 | 3300032002 | Bacteria | 11111 |
| 335 | Ga0307411_10008157 | 3300032005 | Bacteria | 5404 |
| 336 | Ga0307415_100010829 | 3300032126 | Bacteria | 5183 |
| 337 | Ga0373956_0031670 | 3300035119 | Bacteria | 2319 |
| 338 | Ga0373937_0004389 | 3300036401 | Bacteria | 11985 |
| 339 | Ga0373937_0347903 | 3300036401 | Bacteria | 1404 |
| 340 | Ga0316584_0011853 | 3300036712 | Bacteria | 6141 |
| 341 | Ga0316584_0072022 | 3300036712 | Unclassified | 2590 |
| 342 | Ga0395898_0267923 | 3300037466 | Bacteria | 1629 |
| 343 | Ga0466969_0031599 | 3300044656 | Bacteria | 2694 |
| 344 | Ga0466966_0006082 | 3300044684 | Bacteria | 7973 |
| 345 | Ga0466963_0037741 | 3300044694 | Unclassified | 3157 |
| 346 | Ga0466971_0085208 | 3300044719 | Bacteria | 1444 |
| 347 | Ga0466959_0001977 | 3300045049 | Bacteria | 12912 |
| 348 | Ga0466958_0025600 | 3300045836 | Bacteria | 3480 |
| 349 | Ga0466967_0000838 | 3300045976 | Bacteria | 16230 |
| 350 | Ga0466967_0116878 | 3300045976 | Bacteria | 2458 |
| 351 | Ga0495580_0013972 | 3300046472 | Bacteria | 6108 |
| 352 | Ga0495582_0148595 | 3300046473 | Bacteria | 1330 |
| 353 | Ga0495664_0078598 | 3300046477 | Bacteria | 1976 |
| 354 | Ga0495645_0037456 | 3300046543 | Bacteria | 3535 |
| 355 | Ga0495613_0062652 | 3300046689 | Unclassified | 2721 |
| 356 | Ga0495674_0157752 | 3300047319 | Bacteria | 1900 |
| 357 | Ga0496101_0070860 | 3300048904 | Unclassified | 2554 |
| 358 | Ga0496101_0185538 | 3300048904 | Unclassified | 1603 |
| 359 | Ga0496102_0165642 | 3300048905 | Bacteria | 2080 |
| 360 | Ga0496104_0021844 | 3300048907 | Bacteria | 5878 |
| 361 | Ga0496104_0047063 | 3300048907 | Bacteria | 4064 |
| 362 | Ga0496105_0174828 | 3300048908 | Bacteria | 1759 |
| 363 | Ga0496106_0153717 | 3300048909 | Unclassified | 1816 |
| 364 | Ga0496109_0029454 | 3300048912 | Unclassified | 4917 |
| 365 | Ga0496112_0026496 | 3300048915 | Bacteria | 5578 |
| 366 | Ga0496112_0489306 | 3300048915 | Bacteria | 1166 |
| 367 | Ga0496113_0185136 | 3300048916 | Bacteria | 1651 |
| 368 | Ga0496114_0004599 | 3300048917 | Bacteria | 10718 |
| 369 | Ga0496115_0008224 | 3300048918 | Bacteria | 7708 |
| 370 | Ga0496115_0020619 | 3300048918 | Bacteria | 5085 |
| 371 | Ga0496115_0284509 | 3300048918 | Bacteria | 1357 |
| 372 | Ga0496116_0029471 | 3300048919 | Unclassified | 3956 |
| 373 | Ga0496117_0001060 | 3300048920 | Bacteria | 41966 |
| 374 | Ga0496122_0003610 | 3300048925 | Bacteria | 20148 |
| 375 | Ga0496123_0008957 | 3300048926 | Bacteria | 9098 |
| 376 | Ga0501297_003222 | 3300049520 | Bacteria | 1616 |
| 377 | Ga0501298_002279 | 3300049521 | Bacteria | 2896 |
| 378 | Ga0501299_009299 | 3300049522 | Bacteria | 1617 |
| 379 | Ga0501299_012578 | 3300049522 | Bacteria | 1446 |
| 380 | Ga0501202_003950 | 3300049652 | Bacteria | 2568 |
| 381 | Ga0501216_001377 | 3300049660 | Bacteria | 3272 |
| 382 | Ga0501217_046458 | 3300049661 | Bacteria | 1121 |
| 383 | Ga0501223_001018 | 3300049663 | Bacteria | 6627 |
| 384 | Ga0501223_017647 | 3300049663 | Bacteria | 1408 |
| 385 | Ga0501227_000705 | 3300049665 | Bacteria | 7286 |
| 386 | Ga0501227_010095 | 3300049665 | Bacteria | 2043 |
| 387 | Ga0501230_002783 | 3300049667 | Bacteria | 2254 |
| 388 | Ga0501233_001068 | 3300049668 | Bacteria | 4647 |
| 389 | Ga0501253_008139 | 3300049683 | Bacteria | 1497 |
| 390 | Ga0501225_0003415 | 3300049705 | Bacteria | 4818 |
| 391 | Ga0501081_0198383 | 3300049743 | Unclassified | 1455 |
| 392 | Ga0501283_001660 | 3300049779 | Unclassified | 2898 |
| 393 | nmdc:mga06z11_75015_c1 | 3300050494 | Bacteria | 1799 |
| 394 | nmdc:mga05p37_135701_c1 | 3300050507 | Bacteria | 3018 |
| 395 | nmdc:mga05p37_537265_c1 | 3300050507 | Bacteria | 1334 |
| 396 | nmdc:mga09592_17921_c2 | 3300050508 | Bacteria | 3933 |
| 397 | nmdc:mga0qj67_1557_c1 | 3300050509 | Bacteria | 16106 |
| 398 | nmdc:mga06r32_108374_c1 | 3300050510 | Bacteria | 2731 |
| 399 | nmdc:mga08y16_542685_c1 | 3300050511 | Bacteria | 1177 |
| 400 | nmdc:mga0a205_40010_c1 | 3300050515 | Unclassified | 4513 |
| 401 | Ga0500616_0000113 | 3300053153 | Bacteria | 150722 |
| 402 | Ga0590075_013945 | 3300059424 | Bacteria | 1963 |
| 403 | Ga0590077_004033 | 3300059426 | Bacteria | 3024 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009177 | Ga0105248_10580525 | Ga0105248_105805252 | 284 |
| 2 | 3300013105 | Ga0157369_10020990 | Ga0157369_100209906 | 284 |
| 3 | 3300013306 | Ga0163162_10071571 | Ga0163162_100715714 | 284 |
| 4 | 3300014325 | Ga0163163_10066497 | Ga0163163_100664973 | 284 |
| 5 | 3300014969 | Ga0157376_10110566 | Ga0157376_101105663 | 284 |
| 6 | 3300048904 | Ga0496101_0070860 | Ga0496101_0070860_441_1337 | 284 |
| 7 | 3300048905 | Ga0496102_0165642 | Ga0496102_0165642_822_1718 | 284 |
| 8 | 3300048907 | Ga0496104_0047063 | Ga0496104_0047063_852_1748 | 284 |
| 9 | 3300048912 | Ga0496109_0029454 | Ga0496109_0029454_626_1522 | 284 |
| 10 | 3300048915 | Ga0496112_0026496 | Ga0496112_0026496_1576_2472 | 284 |
| 11 | 3300048916 | Ga0496113_0185136 | Ga0496113_0185136_20_916 | 284 |
| 12 | 3300048918 | Ga0496115_0008224 | Ga0496115_0008224_731_1627 | 284 |
| 13 | 3300026023 | Ga0207677_10406870 | Ga0207677_104068701 | 289 |
| 14 | iso_pu_bacteria | 2512564013 | 2512641378 | 290 |
| 15 | iso_pu_bacteria | 2857460504 | 2857461973 | 290 |
| 16 | iso_pu_bacteria | 2915597211 | 2915603400 | 290 |
| 17 | iso_pu_bacteria | 2929183550 | 2929188508 | 290 |
| 18 | 3300031731 | Ga0307405_10162985 | Ga0307405_101629853 | 291 |
| 19 | 3300048919 | Ga0496116_0029471 | Ga0496116_0029471_1007_1987 | 291 |
| 20 | 3300004801 | Ga0058860_12050340 | Ga0058860_120503402 | 292 |
| 21 | 3300005618 | Ga0068864_100502932 | Ga0068864_1005029322 | 292 |
| 22 | 3300026095 | Ga0207676_10482439 | Ga0207676_104824392 | 292 |
| 23 | 3300044656 | Ga0466969_0031599 | Ga0466969_0031599_293_1342 | 292 |
| 24 | 3300044684 | Ga0466966_0006082 | Ga0466966_0006082_4853_5902 | 292 |
| 25 | 3300044719 | Ga0466971_0085208 | Ga0466971_0085208_21_1070 | 292 |
| 26 | 3300045049 | Ga0466959_0001977 | Ga0466959_0001977_9686_10735 | 292 |
| 27 | 3300045836 | Ga0466958_0025600 | Ga0466958_0025600_2007_3056 | 292 |
| 28 | 3300048920 | Ga0496117_0001060 | Ga0496117_0001060_4084_5040 | 292 |
| 29 | 3300048925 | Ga0496122_0003610 | Ga0496122_0003610_19143_20099 | 292 |
| 30 | 3300048926 | Ga0496123_0008957 | Ga0496123_0008957_2076_3032 | 292 |
| 31 | 3300053153 | Ga0500616_0000113 | Ga0500616_0000113_86360_87316 | 292 |
| 32 | iso_pu_bacteria | 2915606848 | 2915608292 | 292 |
| 33 | iso_pu_bacteria | 8057345674 | 8057347655 | 292 |
| 34 | 3300005444 | Ga0070694_100004903 | Ga0070694_1000049036 | 293 |
| 35 | 3300005468 | Ga0070707_100175573 | Ga0070707_1001755731 | 293 |
| 36 | 3300005577 | Ga0068857_100113869 | Ga0068857_1001138692 | 293 |
| 37 | 3300006847 | Ga0075431_100055944 | Ga0075431_1000559441 | 293 |
| 38 | 3300006871 | Ga0075434_100423164 | Ga0075434_1004231641 | 293 |
| 39 | 3300009147 | Ga0114129_10147522 | Ga0114129_101475221 | 293 |
| 40 | 3300025922 | Ga0207646_10063167 | Ga0207646_100631674 | 293 |
| 41 | 3300026116 | Ga0207674_10140412 | Ga0207674_101404122 | 293 |
| 42 | 3300050507 | nmdc:mga05p37_537265_c1 | nmdc:mga05p37_537265_c1_312_1283 | 293 |
| 43 | 3300050509 | nmdc:mga0qj67_1557_c1 | nmdc:mga0qj67_1557_c1_14860_15831 | 293 |
| 44 | 3300050510 | nmdc:mga06r32_108374_c1 | nmdc:mga06r32_108374_c1_1484_2455 | 293 |
| 45 | iso_pu_bacteria | 2510917027 | 2511178979 | 293 |
| 46 | 3300005328 | Ga0070676_10138234 | Ga0070676_101382341 | 294 |
| 47 | 3300005330 | Ga0070690_100008326 | Ga0070690_1000083261 | 294 |
| 48 | 3300005334 | Ga0068869_100044071 | Ga0068869_1000440712 | 294 |
| 49 | 3300005335 | Ga0070666_10010441 | Ga0070666_100104412 | 294 |
| 50 | 3300005336 | Ga0070680_100000868 | Ga0070680_10000086814 | 294 |
| 51 | 3300005338 | Ga0068868_100068458 | Ga0068868_1000684584 | 294 |
| 52 | 3300005338 | Ga0068868_100182235 | Ga0068868_1001822352 | 294 |
| 53 | 3300005338 | Ga0068868_100204172 | Ga0068868_1002041722 | 294 |
| 54 | 3300005338 | Ga0068868_100499873 | Ga0068868_1004998731 | 294 |
| 55 | 3300005343 | Ga0070687_100003368 | Ga0070687_1000033681 | 294 |
| 56 | 3300005344 | Ga0070661_100185793 | Ga0070661_1001857932 | 294 |
| 57 | 3300005353 | Ga0070669_100030907 | Ga0070669_1000309072 | 294 |
| 58 | 3300005353 | Ga0070669_100152771 | Ga0070669_1001527711 | 294 |
| 59 | 3300005354 | Ga0070675_100070083 | Ga0070675_1000700832 | 294 |
| 60 | 3300005354 | Ga0070675_100518723 | Ga0070675_1005187231 | 294 |
| 61 | 3300005365 | Ga0070688_100210627 | Ga0070688_1002106271 | 294 |
| 62 | 3300005367 | Ga0070667_100006966 | Ga0070667_1000069664 | 294 |
| 63 | 3300005440 | Ga0070705_100074921 | Ga0070705_1000749212 | 294 |
| 64 | 3300005441 | Ga0070700_100000193 | Ga0070700_1000001939 | 294 |
| 65 | 3300005444 | Ga0070694_100013196 | Ga0070694_1000131963 | 294 |
| 66 | 3300005444 | Ga0070694_100044399 | Ga0070694_1000443993 | 294 |
| 67 | 3300005456 | Ga0070678_100014571 | Ga0070678_1000145716 | 294 |
| 68 | 3300005458 | Ga0070681_10000032 | Ga0070681_100000324 | 294 |
| 69 | 3300005467 | Ga0070706_100012727 | Ga0070706_1000127274 | 294 |
| 70 | 3300005467 | Ga0070706_100269930 | Ga0070706_1002699302 | 294 |
| 71 | 3300005468 | Ga0070707_100003851 | Ga0070707_1000038514 | 294 |
| 72 | 3300005471 | Ga0070698_100122792 | Ga0070698_1001227922 | 294 |
| 73 | 3300005518 | Ga0070699_100026656 | Ga0070699_1000266564 | 294 |
| 74 | 3300005518 | Ga0070699_100114253 | Ga0070699_1001142531 | 294 |
| 75 | 3300005530 | Ga0070679_100000331 | Ga0070679_1000003317 | 294 |
| 76 | 3300005543 | Ga0070672_100009946 | Ga0070672_1000099462 | 294 |
| 77 | 3300005544 | Ga0070686_100046419 | Ga0070686_1000464192 | 294 |
| 78 | 3300005546 | Ga0070696_100018488 | Ga0070696_1000184885 | 294 |
| 79 | 3300005546 | Ga0070696_100051639 | Ga0070696_1000516391 | 294 |
| 80 | 3300005547 | Ga0070693_100075196 | Ga0070693_1000751962 | 294 |
| 81 | 3300005549 | Ga0070704_100060462 | Ga0070704_1000604623 | 294 |
| 82 | 3300005549 | Ga0070704_100091629 | Ga0070704_1000916292 | 294 |
| 83 | 3300005617 | Ga0068859_100107833 | Ga0068859_1001078332 | 294 |
| 84 | 3300005618 | Ga0068864_100007584 | Ga0068864_1000075843 | 294 |
| 85 | 3300005618 | Ga0068864_100023819 | Ga0068864_1000238194 | 294 |
| 86 | 3300005618 | Ga0068864_100055032 | Ga0068864_1000550322 | 294 |
| 87 | 3300005719 | Ga0068861_100016321 | Ga0068861_1000163215 | 294 |
| 88 | 3300005719 | Ga0068861_100072873 | Ga0068861_1000728732 | 294 |
| 89 | 3300005719 | Ga0068861_100087342 | Ga0068861_1000873422 | 294 |
| 90 | 3300005834 | Ga0068851_10008781 | Ga0068851_100087814 | 294 |
| 91 | 3300005840 | Ga0068870_10056126 | Ga0068870_100561262 | 294 |
| 92 | 3300005840 | Ga0068870_10221448 | Ga0068870_102214481 | 294 |
| 93 | 3300005841 | Ga0068863_100043715 | Ga0068863_1000437152 | 294 |
| 94 | 3300005842 | Ga0068858_100071945 | Ga0068858_1000719452 | 294 |
| 95 | 3300005842 | Ga0068858_100172550 | Ga0068858_1001725503 | 294 |
| 96 | 3300005843 | Ga0068860_100248740 | Ga0068860_1002487403 | 294 |
| 97 | 3300006028 | Ga0070717_10004754 | Ga0070717_100047547 | 294 |
| 98 | 3300006173 | Ga0070716_100100065 | Ga0070716_1001000652 | 294 |
| 99 | 3300006237 | Ga0097621_100004197 | Ga0097621_1000041977 | 294 |
| 100 | 3300006237 | Ga0097621_100014311 | Ga0097621_1000143114 | 294 |
| 101 | 3300006358 | Ga0068871_100011999 | Ga0068871_1000119991 | 294 |
| 102 | 3300006844 | Ga0075428_100199302 | Ga0075428_1001993022 | 294 |
| 103 | 3300006844 | Ga0075428_100434486 | Ga0075428_1004344862 | 294 |
| 104 | 3300006847 | Ga0075431_100233600 | Ga0075431_1002336002 | 294 |
| 105 | 3300006847 | Ga0075431_100283918 | Ga0075431_1002839182 | 294 |
| 106 | 3300006852 | Ga0075433_10093084 | Ga0075433_100930844 | 294 |
| 107 | 3300006871 | Ga0075434_100019657 | Ga0075434_1000196577 | 294 |
| 108 | 3300006881 | Ga0068865_100010843 | Ga0068865_1000108434 | 294 |
| 109 | 3300006931 | Ga0097620_100107839 | Ga0097620_1001078392 | 294 |
| 110 | 3300009094 | Ga0111539_10192183 | Ga0111539_101921831 | 294 |
| 111 | 3300009094 | Ga0111539_10209261 | Ga0111539_102092611 | 294 |
| 112 | 3300009148 | Ga0105243_10028943 | Ga0105243_100289434 | 294 |
| 113 | 3300009176 | Ga0105242_10050158 | Ga0105242_100501583 | 294 |
| 114 | 3300009177 | Ga0105248_10015184 | Ga0105248_100151844 | 294 |
| 115 | 3300009545 | Ga0105237_10010412 | Ga0105237_100104128 | 294 |
| 116 | 3300009553 | Ga0105249_10262035 | Ga0105249_102620351 | 294 |
| 117 | 3300009553 | Ga0105249_10339982 | Ga0105249_103399822 | 294 |
| 118 | 3300011119 | Ga0105246_10033653 | Ga0105246_100336534 | 294 |
| 119 | 3300013296 | Ga0157374_10017230 | Ga0157374_100172303 | 294 |
| 120 | 3300013297 | Ga0157378_10039116 | Ga0157378_100391164 | 294 |
| 121 | 3300013306 | Ga0163162_10021397 | Ga0163162_100213975 | 294 |
| 122 | 3300013306 | Ga0163162_10138388 | Ga0163162_101383882 | 294 |
| 123 | 3300013306 | Ga0163162_10427392 | Ga0163162_104273922 | 294 |
| 124 | 3300013308 | Ga0157375_10024783 | Ga0157375_100247831 | 294 |
| 125 | 3300014325 | Ga0163163_10201914 | Ga0163163_102019142 | 294 |
| 126 | 3300014968 | Ga0157379_10047593 | Ga0157379_100475935 | 294 |
| 127 | 3300014969 | Ga0157376_10067286 | Ga0157376_100672864 | 294 |
| 128 | 3300014969 | Ga0157376_10183537 | Ga0157376_101835372 | 294 |
| 129 | 3300025315 | Ga0207697_10004330 | Ga0207697_100043306 | 294 |
| 130 | 3300025908 | Ga0207643_10109093 | Ga0207643_101090932 | 294 |
| 131 | 3300025908 | Ga0207643_10196044 | Ga0207643_101960441 | 294 |
| 132 | 3300025910 | Ga0207684_10020876 | Ga0207684_100208764 | 294 |
| 133 | 3300025912 | Ga0207707_10000062 | Ga0207707_1000006294 | 294 |
| 134 | 3300025917 | Ga0207660_10000300 | Ga0207660_100003007 | 294 |
| 135 | 3300025918 | Ga0207662_10061477 | Ga0207662_100614772 | 294 |
| 136 | 3300025921 | Ga0207652_10000175 | Ga0207652_100001757 | 294 |
| 137 | 3300025923 | Ga0207681_10222921 | Ga0207681_102229211 | 294 |
| 138 | 3300025923 | Ga0207681_10281570 | Ga0207681_102815702 | 294 |
| 139 | 3300025933 | Ga0207706_10011628 | Ga0207706_100116284 | 294 |
| 140 | 3300025933 | Ga0207706_10078359 | Ga0207706_100783591 | 294 |
| 141 | 3300025935 | Ga0207709_10022876 | Ga0207709_100228762 | 294 |
| 142 | 3300025936 | Ga0207670_10000558 | Ga0207670_1000055814 | 294 |
| 143 | 3300025939 | Ga0207665_10096411 | Ga0207665_100964111 | 294 |
| 144 | 3300025940 | Ga0207691_10012511 | Ga0207691_100125114 | 294 |
| 145 | 3300025942 | Ga0207689_10115435 | Ga0207689_101154352 | 294 |
| 146 | 3300025942 | Ga0207689_10140118 | Ga0207689_101401182 | 294 |
| 147 | 3300025949 | Ga0207667_10080320 | Ga0207667_100803204 | 294 |
| 148 | 3300025960 | Ga0207651_10099387 | Ga0207651_100993872 | 294 |
| 149 | 3300025961 | Ga0207712_10121615 | Ga0207712_101216151 | 294 |
| 150 | 3300025972 | Ga0207668_10350091 | Ga0207668_103500911 | 294 |
| 151 | 3300026023 | Ga0207677_10050023 | Ga0207677_100500234 | 294 |
| 152 | 3300026035 | Ga0207703_10041771 | Ga0207703_100417711 | 294 |
| 153 | 3300026041 | Ga0207639_10180232 | Ga0207639_101802321 | 294 |
| 154 | 3300026075 | Ga0207708_10000069 | Ga0207708_1000006951 | 294 |
| 155 | 3300026075 | Ga0207708_10002025 | Ga0207708_100020252 | 294 |
| 156 | 3300026078 | Ga0207702_10126917 | Ga0207702_101269173 | 294 |
| 157 | 3300026088 | Ga0207641_10476358 | Ga0207641_104763581 | 294 |
| 158 | 3300026089 | Ga0207648_10031257 | Ga0207648_100312574 | 294 |
| 159 | 3300026089 | Ga0207648_10168376 | Ga0207648_101683762 | 294 |
| 160 | 3300026095 | Ga0207676_10015720 | Ga0207676_100157204 | 294 |
| 161 | 3300026095 | Ga0207676_10064271 | Ga0207676_100642714 | 294 |
| 162 | 3300026095 | Ga0207676_10215737 | Ga0207676_102157372 | 294 |
| 163 | 3300026116 | Ga0207674_10066101 | Ga0207674_100661012 | 294 |
| 164 | 3300026116 | Ga0207674_10206100 | Ga0207674_102061001 | 294 |
| 165 | 3300026118 | Ga0207675_100012904 | Ga0207675_1000129042 | 294 |
| 166 | 3300026118 | Ga0207675_100069232 | Ga0207675_1000692323 | 294 |
| 167 | 3300026121 | Ga0207683_10002332 | Ga0207683_100023328 | 294 |
| 168 | 3300026142 | Ga0207698_10092959 | Ga0207698_100929593 | 294 |
| 169 | 3300028800 | Ga0265338_10192327 | Ga0265338_101923272 | 294 |
| 170 | 3300031240 | Ga0265320_10035764 | Ga0265320_100357643 | 294 |
| 171 | 3300031344 | Ga0265316_10056394 | Ga0265316_100563944 | 294 |
| 172 | 3300031548 | Ga0307408_100013261 | Ga0307408_1000132614 | 294 |
| 173 | 3300031901 | Ga0307406_10003022 | Ga0307406_100030227 | 294 |
| 174 | 3300031903 | Ga0307407_10094679 | Ga0307407_100946792 | 294 |
| 175 | 3300031911 | Ga0307412_10018785 | Ga0307412_100187854 | 294 |
| 176 | 3300031911 | Ga0307412_10055903 | Ga0307412_100559032 | 294 |
| 177 | 3300031995 | Ga0307409_100299912 | Ga0307409_1002999122 | 294 |
| 178 | 3300032002 | Ga0307416_100002178 | Ga0307416_1000021785 | 294 |
| 179 | 3300032005 | Ga0307411_10008157 | Ga0307411_100081573 | 294 |
| 180 | 3300032126 | Ga0307415_100010829 | Ga0307415_1000108293 | 294 |
| 181 | 3300036401 | Ga0373937_0347903 | Ga0373937_0347903_285_1259 | 294 |
| 182 | 3300037466 | Ga0395898_0267923 | Ga0395898_0267923_303_1289 | 294 |
| 183 | 3300046472 | Ga0495580_0013972 | Ga0495580_0013972_3524_4498 | 294 |
| 184 | 3300047319 | Ga0495674_0157752 | Ga0495674_0157752_574_1548 | 294 |
| 185 | 3300049520 | Ga0501297_003222 | Ga0501297_003222_480_1433 | 294 |
| 186 | 3300049521 | Ga0501298_002279 | Ga0501298_002279_536_1489 | 294 |
| 187 | 3300049522 | Ga0501299_009299 | Ga0501299_009299_167_1084 | 294 |
| 188 | 3300049522 | Ga0501299_012578 | Ga0501299_012578_228_1199 | 294 |
| 189 | 3300049652 | Ga0501202_003950 | Ga0501202_003950_942_1895 | 294 |
| 190 | 3300049660 | Ga0501216_001377 | Ga0501216_001377_1770_2723 | 294 |
| 191 | 3300049661 | Ga0501217_046458 | Ga0501217_046458_43_996 | 294 |
| 192 | 3300049663 | Ga0501223_001018 | Ga0501223_001018_3047_4033 | 294 |
| 193 | 3300049663 | Ga0501223_017647 | Ga0501223_017647_200_1117 | 294 |
| 194 | 3300049665 | Ga0501227_000705 | Ga0501227_000705_3356_4342 | 294 |
| 195 | 3300049665 | Ga0501227_010095 | Ga0501227_010095_808_1761 | 294 |
| 196 | 3300049667 | Ga0501230_002783 | Ga0501230_002783_532_1485 | 294 |
| 197 | 3300049668 | Ga0501233_001068 | Ga0501233_001068_2146_3132 | 294 |
| 198 | 3300049683 | Ga0501253_008139 | Ga0501253_008139_453_1424 | 294 |
| 199 | 3300049705 | Ga0501225_0003415 | Ga0501225_0003415_1330_2316 | 294 |
| 200 | 3300049743 | Ga0501081_0198383 | Ga0501081_0198383_50_1039 | 294 |
| 201 | 3300049779 | Ga0501283_001660 | Ga0501283_001660_43_1014 | 294 |
| 202 | 3300050508 | nmdc:mga09592_17921_c2 | nmdc:mga09592_17921_c2_1584_2549 | 294 |
| 203 | 3300050511 | nmdc:mga08y16_542685_c1 | nmdc:mga08y16_542685_c1_196_1164 | 294 |
| 204 | 3300050515 | nmdc:mga0a205_40010_c1 | nmdc:mga0a205_40010_c1_313_1245 | 294 |
| 205 | iso_pu_bacteria | 2980182181 | 2980187559 | 294 |
| 206 | iso_pu_bacteria | 3006826541 | 3006828246 | 294 |
| 207 | 3300005471 | Ga0070698_100295727 | Ga0070698_1002957272 | 295 |
| 208 | iso_pu_bacteria | 2857453340 | 2857454906 | 295 |
| 209 | iso_pu_bacteria | 8056533031 | 8056533718 | 295 |
| 210 | 3300005293 | Ga0065715_10190200 | Ga0065715_101902001 | 296 |
| 211 | 3300005440 | Ga0070705_100000331 | Ga0070705_1000003316 | 296 |
| 212 | 3300005467 | Ga0070706_100001365 | Ga0070706_10000136516 | 296 |
| 213 | 3300005518 | Ga0070699_100000062 | Ga0070699_10000006222 | 296 |
| 214 | 3300005546 | Ga0070696_100000026 | Ga0070696_10000002676 | 296 |
| 215 | 3300005549 | Ga0070704_100093525 | Ga0070704_1000935252 | 296 |
| 216 | 3300009147 | Ga0114129_10005795 | Ga0114129_100057954 | 296 |
| 217 | 3300025885 | Ga0207653_10000132 | Ga0207653_1000013239 | 296 |
| 218 | 3300025910 | Ga0207684_10000230 | Ga0207684_1000023016 | 296 |
| 219 | 3300031249 | Ga0265339_10001021 | Ga0265339_1000102114 | 296 |
| 220 | 3300031712 | Ga0265342_10002201 | Ga0265342_1000220111 | 296 |
| 221 | 3300046477 | Ga0495664_0078598 | Ga0495664_0078598_720_1667 | 296 |
| 222 | 3300048915 | Ga0496112_0489306 | Ga0496112_0489306_77_1072 | 296 |
| 223 | 3300050507 | nmdc:mga05p37_135701_c1 | nmdc:mga05p37_135701_c1_1734_2720 | 296 |
| 224 | 3300005436 | Ga0070713_100126216 | Ga0070713_1001262162 | 297 |
| 225 | 3300013307 | Ga0157372_10212900 | Ga0157372_102129003 | 297 |
| 226 | 3300014968 | Ga0157379_10105134 | Ga0157379_101051343 | 297 |
| 227 | 3300048918 | Ga0496115_0284509 | Ga0496115_0284509_348_1298 | 297 |
| 228 | 3300050494 | nmdc:mga06z11_75015_c1 | nmdc:mga06z11_75015_c1_637_1605 | 297 |
| 229 | 3300059424 | Ga0590075_013945 | Ga0590075_013945_860_1846 | 297 |
| 230 | 3300059426 | Ga0590077_004033 | Ga0590077_004033_765_1751 | 297 |
| 231 | 3300005334 | Ga0068869_100021046 | Ga0068869_1000210462 | 298 |
| 232 | 3300005344 | Ga0070661_100127471 | Ga0070661_1001274712 | 298 |
| 233 | 3300005439 | Ga0070711_100040831 | Ga0070711_1000408313 | 298 |
| 234 | 3300006028 | Ga0070717_10035392 | Ga0070717_100353922 | 298 |
| 235 | 3300009093 | Ga0105240_10005538 | Ga0105240_1000553810 | 298 |
| 236 | 3300009551 | Ga0105238_10004996 | Ga0105238_1000499610 | 298 |
| 237 | 3300010375 | Ga0105239_10347595 | Ga0105239_103475951 | 298 |
| 238 | 3300013308 | Ga0157375_10004500 | Ga0157375_1000450010 | 298 |
| 239 | 3300014325 | Ga0163163_10000249 | Ga0163163_1000024939 | 298 |
| 240 | 3300025916 | Ga0207663_10027354 | Ga0207663_100273542 | 298 |
| 241 | 3300025942 | Ga0207689_10004516 | Ga0207689_1000451610 | 298 |
| 242 | 3300005435 | Ga0070714_100156130 | Ga0070714_1001561302 | 299 |
| 243 | 3300005563 | Ga0068855_100128599 | Ga0068855_1001285994 | 299 |
| 244 | 3300013104 | Ga0157370_10005061 | Ga0157370_100050619 | 299 |
| 245 | 3300025909 | Ga0207705_10000021 | Ga0207705_10000021132 | 299 |
| 246 | 3300025949 | Ga0207667_10053586 | Ga0207667_100535867 | 299 |
| 247 | 3300031691 | Ga0316579_10001728 | Ga0316579_100017286 | 299 |
| 248 | 3300036712 | Ga0316584_0011853 | Ga0316584_0011853_1096_2064 | 299 |
| 249 | 3300036712 | Ga0316584_0072022 | Ga0316584_0072022_1249_2217 | 299 |
| 250 | 3300045976 | Ga0466967_0116878 | Ga0466967_0116878_153_1109 | 299 |
| 251 | 3300000546 | LJNas_1000680 | LJNas_10006803 | 300 |
| 252 | 3300003323 | rootH1_10022255 | rootH1_100222552 | 300 |
| 253 | 3300005327 | Ga0070658_10012335 | Ga0070658_100123354 | 300 |
| 254 | 3300005327 | Ga0070658_10050964 | Ga0070658_100509642 | 300 |
| 255 | 3300005329 | Ga0070683_100010561 | Ga0070683_1000105619 | 300 |
| 256 | 3300005329 | Ga0070683_100019128 | Ga0070683_1000191287 | 300 |
| 257 | 3300005329 | Ga0070683_100033374 | Ga0070683_1000333744 | 300 |
| 258 | 3300005329 | Ga0070683_100166269 | Ga0070683_1001662692 | 300 |
| 259 | 3300005331 | Ga0070670_100008994 | Ga0070670_1000089948 | 300 |
| 260 | 3300005338 | Ga0068868_100015982 | Ga0068868_1000159826 | 300 |
| 261 | 3300005338 | Ga0068868_100114957 | Ga0068868_1001149573 | 300 |
| 262 | 3300005339 | Ga0070660_100196516 | Ga0070660_1001965162 | 300 |
| 263 | 3300005344 | Ga0070661_100028661 | Ga0070661_1000286611 | 300 |
| 264 | 3300005344 | Ga0070661_100048893 | Ga0070661_1000488934 | 300 |
| 265 | 3300005367 | Ga0070667_100011075 | Ga0070667_1000110756 | 300 |
| 266 | 3300005455 | Ga0070663_100288361 | Ga0070663_1002883611 | 300 |
| 267 | 3300005535 | Ga0070684_100010509 | Ga0070684_1000105093 | 300 |
| 268 | 3300005535 | Ga0070684_100040064 | Ga0070684_1000400642 | 300 |
| 269 | 3300005535 | Ga0070684_100043209 | Ga0070684_1000432091 | 300 |
| 270 | 3300005535 | Ga0070684_100237989 | Ga0070684_1002379892 | 300 |
| 271 | 3300005539 | Ga0068853_100034852 | Ga0068853_1000348526 | 300 |
| 272 | 3300005539 | Ga0068853_100061496 | Ga0068853_1000614963 | 300 |
| 273 | 3300005563 | Ga0068855_100027068 | Ga0068855_1000270685 | 300 |
| 274 | 3300005563 | Ga0068855_100047905 | Ga0068855_1000479055 | 300 |
| 275 | 3300005563 | Ga0068855_100050549 | Ga0068855_1000505492 | 300 |
| 276 | 3300005563 | Ga0068855_100088072 | Ga0068855_1000880724 | 300 |
| 277 | 3300005577 | Ga0068857_100015300 | Ga0068857_1000153003 | 300 |
| 278 | 3300005578 | Ga0068854_100045906 | Ga0068854_1000459062 | 300 |
| 279 | 3300005614 | Ga0068856_100013024 | Ga0068856_1000130241 | 300 |
| 280 | 3300005614 | Ga0068856_100058572 | Ga0068856_1000585723 | 300 |
| 281 | 3300005614 | Ga0068856_100081489 | Ga0068856_1000814894 | 300 |
| 282 | 3300005614 | Ga0068856_100182228 | Ga0068856_1001822282 | 300 |
| 283 | 3300005614 | Ga0068856_100199138 | Ga0068856_1001991382 | 300 |
| 284 | 3300005614 | Ga0068856_100436883 | Ga0068856_1004368832 | 300 |
| 285 | 3300005616 | Ga0068852_100001910 | Ga0068852_10000191012 | 300 |
| 286 | 3300005616 | Ga0068852_100008741 | Ga0068852_1000087412 | 300 |
| 287 | 3300005616 | Ga0068852_100229041 | Ga0068852_1002290412 | 300 |
| 288 | 3300005616 | Ga0068852_100308322 | Ga0068852_1003083222 | 300 |
| 289 | 3300005618 | Ga0068864_100001563 | Ga0068864_10000156318 | 300 |
| 290 | 3300005834 | Ga0068851_10012708 | Ga0068851_100127085 | 300 |
| 291 | 3300005841 | Ga0068863_100002640 | Ga0068863_1000026406 | 300 |
| 292 | 3300005842 | Ga0068858_100025381 | Ga0068858_1000253813 | 300 |
| 293 | 3300005843 | Ga0068860_100000200 | Ga0068860_10000020074 | 300 |
| 294 | 3300006028 | Ga0070717_10001087 | Ga0070717_100010877 | 300 |
| 295 | 3300006358 | Ga0068871_100010469 | Ga0068871_1000104697 | 300 |
| 296 | 3300006358 | Ga0068871_100083221 | Ga0068871_1000832213 | 300 |
| 297 | 3300009093 | Ga0105240_10000516 | Ga0105240_1000051611 | 300 |
| 298 | 3300009093 | Ga0105240_10006110 | Ga0105240_100061104 | 300 |
| 299 | 3300009093 | Ga0105240_10006333 | Ga0105240_1000633312 | 300 |
| 300 | 3300009093 | Ga0105240_10007803 | Ga0105240_100078034 | 300 |
| 301 | 3300009093 | Ga0105240_10035938 | Ga0105240_100359385 | 300 |
| 302 | 3300009093 | Ga0105240_10069515 | Ga0105240_100695155 | 300 |
| 303 | 3300009093 | Ga0105240_10635292 | Ga0105240_106352921 | 300 |
| 304 | 3300009098 | Ga0105245_10009530 | Ga0105245_100095304 | 300 |
| 305 | 3300009098 | Ga0105245_10013827 | Ga0105245_100138275 | 300 |
| 306 | 3300009174 | Ga0105241_10000051 | Ga0105241_1000005121 | 300 |
| 307 | 3300009174 | Ga0105241_10001099 | Ga0105241_1000109911 | 300 |
| 308 | 3300009174 | Ga0105241_10002039 | Ga0105241_100020394 | 300 |
| 309 | 3300009174 | Ga0105241_10049894 | Ga0105241_100498943 | 300 |
| 310 | 3300009174 | Ga0105241_10077057 | Ga0105241_100770573 | 300 |
| 311 | 3300009176 | Ga0105242_10384648 | Ga0105242_103846482 | 300 |
| 312 | 3300009177 | Ga0105248_10019971 | Ga0105248_100199714 | 300 |
| 313 | 3300009545 | Ga0105237_10014988 | Ga0105237_100149888 | 300 |
| 314 | 3300009545 | Ga0105237_10024688 | Ga0105237_100246885 | 300 |
| 315 | 3300009545 | Ga0105237_10044299 | Ga0105237_100442995 | 300 |
| 316 | 3300009551 | Ga0105238_10000251 | Ga0105238_1000025160 | 300 |
| 317 | 3300009551 | Ga0105238_10003911 | Ga0105238_1000391111 | 300 |
| 318 | 3300009551 | Ga0105238_10021034 | Ga0105238_100210345 | 300 |
| 319 | 3300009551 | Ga0105238_10029981 | Ga0105238_100299815 | 300 |
| 320 | 3300009551 | Ga0105238_10132414 | Ga0105238_101324142 | 300 |
| 321 | 3300009551 | Ga0105238_10240288 | Ga0105238_102402881 | 300 |
| 322 | 3300010375 | Ga0105239_10000725 | Ga0105239_100007256 | 300 |
| 323 | 3300010375 | Ga0105239_10121104 | Ga0105239_101211042 | 300 |
| 324 | 3300010375 | Ga0105239_10216670 | Ga0105239_102166703 | 300 |
| 325 | 3300013104 | Ga0157370_10000174 | Ga0157370_1000017455 | 300 |
| 326 | 3300013105 | Ga0157369_10000262 | Ga0157369_1000026211 | 300 |
| 327 | 3300013105 | Ga0157369_10000369 | Ga0157369_1000036960 | 300 |
| 328 | 3300013105 | Ga0157369_10004534 | Ga0157369_100045345 | 300 |
| 329 | 3300013105 | Ga0157369_10007607 | Ga0157369_100076076 | 300 |
| 330 | 3300013105 | Ga0157369_10025609 | Ga0157369_100256095 | 300 |
| 331 | 3300013105 | Ga0157369_10108015 | Ga0157369_101080152 | 300 |
| 332 | 3300013105 | Ga0157369_10227352 | Ga0157369_102273522 | 300 |
| 333 | 3300013296 | Ga0157374_10001525 | Ga0157374_1000152518 | 300 |
| 334 | 3300013296 | Ga0157374_10014614 | Ga0157374_100146142 | 300 |
| 335 | 3300013296 | Ga0157374_10105671 | Ga0157374_101056712 | 300 |
| 336 | 3300013297 | Ga0157378_10042962 | Ga0157378_100429625 | 300 |
| 337 | 3300013297 | Ga0157378_10059298 | Ga0157378_100592983 | 300 |
| 338 | 3300013297 | Ga0157378_10068817 | Ga0157378_100688174 | 300 |
| 339 | 3300013307 | Ga0157372_10000659 | Ga0157372_100006595 | 300 |
| 340 | 3300013307 | Ga0157372_10007580 | Ga0157372_1000758012 | 300 |
| 341 | 3300013307 | Ga0157372_10017949 | Ga0157372_100179493 | 300 |
| 342 | 3300013307 | Ga0157372_10119497 | Ga0157372_101194973 | 300 |
| 343 | 3300013307 | Ga0157372_10139381 | Ga0157372_101393813 | 300 |
| 344 | 3300013307 | Ga0157372_10167492 | Ga0157372_101674922 | 300 |
| 345 | 3300013307 | Ga0157372_10193097 | Ga0157372_101930972 | 300 |
| 346 | 3300013308 | Ga0157375_10016043 | Ga0157375_100160434 | 300 |
| 347 | 3300014968 | Ga0157379_10112548 | Ga0157379_101125482 | 300 |
| 348 | 3300014969 | Ga0157376_10005272 | Ga0157376_100052729 | 300 |
| 349 | 3300014969 | Ga0157376_10018258 | Ga0157376_100182582 | 300 |
| 350 | 3300025900 | Ga0207710_10005191 | Ga0207710_100051915 | 300 |
| 351 | 3300025904 | Ga0207647_10022822 | Ga0207647_100228223 | 300 |
| 352 | 3300025911 | Ga0207654_10000068 | Ga0207654_1000006859 | 300 |
| 353 | 3300025911 | Ga0207654_10000548 | Ga0207654_1000054822 | 300 |
| 354 | 3300025911 | Ga0207654_10253832 | Ga0207654_102538321 | 300 |
| 355 | 3300025913 | Ga0207695_10000047 | Ga0207695_10000047122 | 300 |
| 356 | 3300025913 | Ga0207695_10000150 | Ga0207695_1000015019 | 300 |
| 357 | 3300025913 | Ga0207695_10000162 | Ga0207695_10000162187 | 300 |
| 358 | 3300025913 | Ga0207695_10001900 | Ga0207695_100019005 | 300 |
| 359 | 3300025913 | Ga0207695_10022767 | Ga0207695_100227677 | 300 |
| 360 | 3300025913 | Ga0207695_10033208 | Ga0207695_100332083 | 300 |
| 361 | 3300025914 | Ga0207671_10000155 | Ga0207671_1000015531 | 300 |
| 362 | 3300025914 | Ga0207671_10001417 | Ga0207671_100014173 | 300 |
| 363 | 3300025920 | Ga0207649_10018125 | Ga0207649_100181255 | 300 |
| 364 | 3300025920 | Ga0207649_10044610 | Ga0207649_100446103 | 300 |
| 365 | 3300025924 | Ga0207694_10000142 | Ga0207694_1000014261 | 300 |
| 366 | 3300025924 | Ga0207694_10000146 | Ga0207694_100001464 | 300 |
| 367 | 3300025924 | Ga0207694_10001885 | Ga0207694_100018857 | 300 |
| 368 | 3300025924 | Ga0207694_10018855 | Ga0207694_100188555 | 300 |
| 369 | 3300025924 | Ga0207694_10139608 | Ga0207694_101396083 | 300 |
| 370 | 3300025925 | Ga0207650_10006669 | Ga0207650_100066697 | 300 |
| 371 | 3300025927 | Ga0207687_10041670 | Ga0207687_100416702 | 300 |
| 372 | 3300025927 | Ga0207687_10343679 | Ga0207687_103436791 | 300 |
| 373 | 3300025941 | Ga0207711_10261415 | Ga0207711_102614152 | 300 |
| 374 | 3300025949 | Ga0207667_10003680 | Ga0207667_100036803 | 300 |
| 375 | 3300025949 | Ga0207667_10041966 | Ga0207667_100419664 | 300 |
| 376 | 3300025949 | Ga0207667_10066930 | Ga0207667_100669303 | 300 |
| 377 | 3300025949 | Ga0207667_10151048 | Ga0207667_101510483 | 300 |
| 378 | 3300025986 | Ga0207658_10000693 | Ga0207658_100006934 | 300 |
| 379 | 3300026023 | Ga0207677_10001259 | Ga0207677_1000125910 | 300 |
| 380 | 3300026023 | Ga0207677_10019180 | Ga0207677_100191804 | 300 |
| 381 | 3300026035 | Ga0207703_10017859 | Ga0207703_100178596 | 300 |
| 382 | 3300026041 | Ga0207639_10018233 | Ga0207639_100182334 | 300 |
| 383 | 3300026041 | Ga0207639_10020161 | Ga0207639_100201612 | 300 |
| 384 | 3300026078 | Ga0207702_10008441 | Ga0207702_100084415 | 300 |
| 385 | 3300026078 | Ga0207702_10054551 | Ga0207702_100545513 | 300 |
| 386 | 3300026078 | Ga0207702_10063963 | Ga0207702_100639631 | 300 |
| 387 | 3300026078 | Ga0207702_10117865 | Ga0207702_101178653 | 300 |
| 388 | 3300026078 | Ga0207702_10206607 | Ga0207702_102066071 | 300 |
| 389 | 3300026088 | Ga0207641_10002156 | Ga0207641_1000215613 | 300 |
| 390 | 3300026116 | Ga0207674_10001977 | Ga0207674_100019773 | 300 |
| 391 | 3300026116 | Ga0207674_10010049 | Ga0207674_1001004910 | 300 |
| 392 | 3300026116 | Ga0207674_10108660 | Ga0207674_101086602 | 300 |
| 393 | 3300026142 | Ga0207698_10000082 | Ga0207698_1000008211 | 300 |
| 394 | 3300026142 | Ga0207698_10000241 | Ga0207698_100002413 | 300 |
| 395 | 3300026142 | Ga0207698_10061003 | Ga0207698_100610034 | 300 |
| 396 | 3300026142 | Ga0207698_10102929 | Ga0207698_101029292 | 300 |
| 397 | 3300028381 | Ga0268264_10004090 | Ga0268264_1000409010 | 300 |
| 398 | 3300031090 | Ga0265760_10017599 | Ga0265760_100175991 | 300 |
| 399 | 3300031241 | Ga0265325_10075741 | Ga0265325_100757411 | 300 |
| 400 | 3300031247 | Ga0265340_10127905 | Ga0265340_101279051 | 300 |
| 401 | 3300031344 | Ga0265316_10116478 | Ga0265316_101164781 | 300 |
| 402 | 3300035119 | Ga0373956_0031670 | Ga0373956_0031670_97_1179 | 300 |
| 403 | 3300036401 | Ga0373937_0004389 | Ga0373937_0004389_6381_7376 | 300 |
| 404 | 3300044694 | Ga0466963_0037741 | Ga0466963_0037741_937_1971 | 300 |
| 405 | 3300045976 | Ga0466967_0000838 | Ga0466967_0000838_10971_12005 | 300 |
| 406 | 3300046473 | Ga0495582_0148595 | Ga0495582_0148595_397_1308 | 300 |
| 407 | 3300046543 | Ga0495645_0037456 | Ga0495645_0037456_885_1913 | 300 |
| 408 | 3300046689 | Ga0495613_0062652 | Ga0495613_0062652_704_1669 | 300 |
| 409 | 3300048904 | Ga0496101_0185538 | Ga0496101_0185538_403_1368 | 300 |
| 410 | 3300048907 | Ga0496104_0021844 | Ga0496104_0021844_3602_4567 | 300 |
| 411 | 3300048908 | Ga0496105_0174828 | Ga0496105_0174828_79_1023 | 300 |
| 412 | 3300048909 | Ga0496106_0153717 | Ga0496106_0153717_405_1370 | 300 |
| 413 | 3300048917 | Ga0496114_0004599 | Ga0496114_0004599_5955_6920 | 300 |
| 414 | 3300048918 | Ga0496115_0020619 | Ga0496115_0020619_3409_4374 | 300 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1u2w-assembly1.cif.gz_B | crystal structure of the staphylococcus aureus pi258 cadc | 0.7807 | 1 | 43 |
| 1r23-assembly1.cif.gz_A | crystal structure of the cyanobacterial metallothionein repressor smtb in the zn1-form (one zn(ii) per dimer) | 0.7741 | 1 | 46 |
| 1r1t-assembly1.cif.gz_B | crystal structure of the cyanobacterial metallothionein repressor smtb in the apo-form | 0.7618 | 1 | 45 |
| 1r22-assembly1.cif.gz_B | crystal structure of the cyanobacterial metallothionein repressor smtb (c14s/c61s/c121s mutant) in the zn2alpha5-form | 0.7521 | 1 | 45 |
| 6cda-assembly1.cif.gz_A-2 | crystal structure of l34a czra in the zn(ii)bound state | 0.7444 | 2 | 45 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P06709_1_64_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8798 | 1 | 44 | 1.10.10.10 |
| af_Q2FVV6_1_65_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8789 | 1 | 46 | 1.10.10.10 |
| 3v7sA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8698 | 1 | 45 | 1.10.10.10 |
| af_Q2G258_1_64_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8663 | 1 | 45 | 1.10.10.10 |
| 4wf2A01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8598 | 1 | 43 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1E1VVD0-F1-model_v4 | deleted | 0.905 | 132 | 300 |
|
| AF-A0A1E1VVD0-F1-model_v4 | deleted | 0.8849 | 132 | 300 |
|
| AF-V9GIZ5-F1-model_v4 | Transcriptional regulator, DeoR family | 0.8488 | 58 | 298 |
|
| AF-A0A4Q5V196-F1-model_v4 | deleted | 0.8455 | 107 | 300 |
|
| AF-M6RFN3-F1-model_v4 | WYL domain protein | 0.8306 | 213 | 294 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar