F438343

General Info

Members Datasets Scaffolds Average Seq Length
414 152 414 102

Family's Representative Sequence

Representative Sequence 3300025929|Ga0207664_11696737|Ga0207664_116967372
Length 101
Sequence LSYLPYAVAAWICIWGIAGIATSQNLIHLAVCLTVTQSSSYVFLLSVGYVKHGKAPIFVGGTKLGSTAVDPVVQALTLTDVVDAHRLSGTVDPDGLADISG

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
46 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
50 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
73 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
74 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
75 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
76 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
77 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
78 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
83 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
84 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
85 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
86 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
87 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
88 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
89 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
90 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
91 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
92 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
93 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
94 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
95 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
96 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
97 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
98 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
99 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
100 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
101 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
102 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
103 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
104 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
105 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
106 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
107 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
108 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
109 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
110 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
111 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
112 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
113 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
114 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
115 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
116 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
117 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
118 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
119 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
120 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
121 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
122 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
123 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
124 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
125 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
126 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
127 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
128 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
129 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
130 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
131 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
132 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
133 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
134 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
135 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
140 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
141 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
144 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
145 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
146 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
147 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
148 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
149 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
150 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
151 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
152 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.07
Metatranscriptomes 1.93
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.87
Rhizosphere 88.41
Stem 0
Stem Tuber 0
Unclassified 0.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10124433 3300003320 Bacteria 2562
2 rootL2_10304739 3300003322 Bacteria 1913
3 rootH1_10109677 3300003323 Bacteria 2419
4 Ga0070658_10034677 3300005327 Bacteria 4060
5 Ga0070658_10268638 3300005327 Bacteria 1450
6 Ga0070658_10488191 3300005327 Bacteria 1063
7 Ga0070683_100097716 3300005329 Bacteria 2762
8 Ga0070683_100827764 3300005329 Bacteria 888
9 Ga0070680_100041822 3300005336 Bacteria 3716
10 Ga0070680_100229819 3300005336 Bacteria 1567
11 Ga0070680_100689508 3300005336 Bacteria 879
12 Ga0070682_100029805 3300005337 Bacteria 3289
13 Ga0070682_100091103 3300005337 Bacteria 1995
14 Ga0070682_100169759 3300005337 Unclassified 1515
15 Ga0070660_100223582 3300005339 Bacteria 1530
16 Ga0070660_100443605 3300005339 Bacteria 1076
17 Ga0070691_10017081 3300005341 Bacteria 3339
18 Ga0070691_10059942 3300005341 Bacteria 1829
19 Ga0070661_100048799 3300005344 Bacteria 3099
20 Ga0070661_100424806 3300005344 Bacteria 1054
21 Ga0070661_100769310 3300005344 Bacteria 788
22 Ga0070661_101493068 3300005344 Bacteria 570
23 Ga0070659_100074664 3300005366 Bacteria 2701
24 Ga0070659_101370664 3300005366 Bacteria 628
25 Ga0070703_10333119 3300005406 Bacteria 642
26 Ga0070709_10193020 3300005434 Bacteria 1438
27 Ga0070709_10458859 3300005434 Bacteria 961
28 Ga0070714_100010893 3300005435 Bacteria 7199
29 Ga0070714_100092663 3300005435 Bacteria 2649
30 Ga0070714_100131486 3300005435 Bacteria 2237
31 Ga0070714_100592687 3300005435 Bacteria 1064
32 Ga0070714_100972615 3300005435 Unclassified 825
33 Ga0070713_100262263 3300005436 Bacteria 1579
34 Ga0070713_100517841 3300005436 Bacteria 1127
35 Ga0070710_10347355 3300005437 Bacteria 981
36 Ga0070711_100103413 3300005439 Bacteria 2076
37 Ga0070662_100357205 3300005457 Unclassified 1198
38 Ga0070681_10086266 3300005458 Bacteria 3092
39 Ga0070681_10222944 3300005458 Unclassified 1800
40 Ga0070681_10246217 3300005458 Bacteria 1701
41 Ga0070679_100067733 3300005530 Bacteria 3560
42 Ga0070679_100069063 3300005530 Bacteria 3525
43 Ga0070679_100077688 3300005530 Bacteria 3309
44 Ga0070679_101454754 3300005530 Bacteria 632
45 Ga0070679_101978139 3300005530 Bacteria 532
46 Ga0070684_100017136 3300005535 Bacteria 5938
47 Ga0070684_100036833 3300005535 Bacteria 4193
48 Ga0070684_100229531 3300005535 Bacteria 1695
49 Ga0068853_100584074 3300005539 Bacteria 1060
50 Ga0068853_100999765 3300005539 Bacteria 805
51 Ga0070695_100000028 3300005545 Bacteria 53880
52 Ga0070704_100811538 3300005549 Unclassified 837
53 Ga0068855_100056266 3300005563 Bacteria 4616
54 Ga0068855_100143269 3300005563 Bacteria 2722
55 Ga0068855_100190310 3300005563 Bacteria 2315
56 Ga0068855_100785335 3300005563 Bacteria 1013
57 Ga0070664_100337077 3300005564 Bacteria 1369
58 Ga0068857_100115469 3300005577 Bacteria 2415
59 Ga0068856_100054408 3300005614 Bacteria 3947
60 Ga0068856_100248540 3300005614 Bacteria 1794
61 Ga0068856_101027772 3300005614 Unclassified 842
62 Ga0068852_100136664 3300005616 Bacteria 2264
63 Ga0068852_100434483 3300005616 Bacteria 1297
64 Ga0068852_100586274 3300005616 Bacteria 1118
65 Ga0068852_102133369 3300005616 Bacteria 582
66 Ga0070717_10008104 3300006028 Bacteria 7837
67 Ga0070717_10066290 3300006028 Bacteria 3002
68 Ga0070717_10245604 3300006028 Unclassified 1580
69 Ga0070717_10247264 3300006028 Bacteria 1574
70 Ga0070717_11883257 3300006028 Unclassified 540
71 Ga0068871_100506773 3300006358 Bacteria 1088
72 Ga0075436_100060281 3300006914 Unclassified 2621
73 Ga0105240_10016968 3300009093 Bacteria 9837
74 Ga0105240_10146004 3300009093 Bacteria 2822
75 Ga0105240_10188246 3300009093 Bacteria 2429
76 Ga0105240_10255771 3300009093 Bacteria 2023
77 Ga0105245_10012284 3300009098 Bacteria 7451
78 Ga0105237_10020964 3300009545 Bacteria 6727
79 Ga0105237_10633265 3300009545 Unclassified 1076
80 Ga0105249_12150735 3300009553 Bacteria 631
81 Ga0105239_10169594 3300010375 Unclassified 2440
82 Ga0105239_10500032 3300010375 Bacteria 1382
83 Ga0105246_10670825 3300011119 Bacteria 905
84 Ga0157373_10636162 3300013100 Unclassified 778
85 Ga0157370_10034532 3300013104 Bacteria 4922
86 Ga0157370_11539632 3300013104 Bacteria 598
87 Ga0157369_10005853 3300013105 Bacteria 14285
88 Ga0157369_10123931 3300013105 Bacteria 2741
89 Ga0157369_10225720 3300013105 Bacteria 1959
90 Ga0157369_10260583 3300013105 Bacteria 1808
91 Ga0157369_10298576 3300013105 Bacteria 1676
92 Ga0157369_10395624 3300013105 Bacteria 1434
93 Ga0157369_10436848 3300013105 Bacteria 1356
94 Ga0157369_10940565 3300013105 Bacteria 886
95 Ga0157374_10064934 3300013296 Bacteria 3427
96 Ga0157374_11528198 3300013296 Bacteria 691
97 Ga0157372_10022798 3300013307 Bacteria 6779
98 Ga0157372_10057133 3300013307 Bacteria 4362
99 Ga0157372_10107733 3300013307 Bacteria 3189
100 Ga0157372_10118900 3300013307 Bacteria 3033
101 Ga0157372_10234132 3300013307 Bacteria 2130
102 Ga0157372_10630613 3300013307 Bacteria 1249
103 Ga0157375_13137293 3300013308 Bacteria 551
104 Ga0157377_10239660 3300014745 Bacteria 1170
105 Ga0197907_10004038 3300020069 Bacteria 804
106 Ga0206356_10152118 3300020070 Bacteria 765
107 Ga0206356_10205567 3300020070 Bacteria 828
108 Ga0206353_11103351 3300020082 Bacteria 1768
109 Ga0206353_11259920 3300020082 Bacteria 5388
110 Ga0213871_10019390 3300021441 Bacteria 1675
111 Ga0224712_10113255 3300022467 Bacteria 1166
112 Ga0224712_10181715 3300022467 Bacteria 948
113 Ga0224712_10240579 3300022467 Bacteria 834
114 Ga0207699_10307604 3300025906 Bacteria 1108
115 Ga0207699_10786698 3300025906 Bacteria 699
116 Ga0207707_10127881 3300025912 Bacteria 2222
117 Ga0207707_10627808 3300025912 Bacteria 907
118 Ga0207695_10078704 3300025913 Bacteria 3344
119 Ga0207695_10101485 3300025913 Bacteria 2871
120 Ga0207695_10250551 3300025913 Bacteria 1670
121 Ga0207695_10541484 3300025913 Bacteria 1045
122 Ga0207695_11021089 3300025913 Unclassified 707
123 Ga0207671_10048219 3300025914 Bacteria 3153
124 Ga0207663_10358891 3300025916 Bacteria 1105
125 Ga0207660_10118563 3300025917 Bacteria 2002
126 Ga0207660_11408683 3300025917 Bacteria 565
127 Ga0207657_10002847 3300025919 Bacteria 18595
128 Ga0207649_10260799 3300025920 Bacteria 1252
129 Ga0207649_10294389 3300025920 Bacteria 1185
130 Ga0207652_10216214 3300025921 Bacteria 1726
131 Ga0207652_10216809 3300025921 Bacteria 1724
132 Ga0207652_10273921 3300025921 Bacteria 1522
133 Ga0207652_11055277 3300025921 Unclassified 712
134 Ga0207694_10322669 3300025924 Unclassified 1275
135 Ga0207694_10420628 3300025924 Bacteria 1113
136 Ga0207687_10018735 3300025927 Bacteria 4575
137 Ga0207700_10358247 3300025928 Bacteria 1271
138 Ga0207700_10363543 3300025928 Bacteria 1262
139 Ga0207700_11979230 3300025928 Unclassified 509
140 Ga0207664_10003819 3300025929 Bacteria 10113
141 Ga0207664_10057731 3300025929 Bacteria 3086
142 Ga0207664_10088240 3300025929 Unclassified 2537
143 Ga0207664_10350681 3300025929 Unclassified 1306
144 Ga0207664_10555595 3300025929 Bacteria 1030
145 Ga0207664_11696737 3300025929 Unclassified 554
146 Ga0207690_10060533 3300025932 Bacteria 2570
147 Ga0207706_10573454 3300025933 Bacteria 970
148 Ga0207661_10002551 3300025944 Bacteria 12530
149 Ga0207661_10243193 3300025944 Bacteria 1597
150 Ga0207661_10353551 3300025944 Bacteria 1326
151 Ga0207667_10316287 3300025949 Bacteria 1594
152 Ga0207667_10809144 3300025949 Bacteria 933
153 Ga0207667_10955182 3300025949 Unclassified 846
154 Ga0207712_11661861 3300025961 Bacteria 572
155 Ga0207702_10038145 3300026078 Bacteria 4024
156 Ga0207702_10073697 3300026078 Bacteria 2945
157 Ga0207702_11141498 3300026078 Bacteria 773
158 Ga0207702_12359774 3300026078 Bacteria 519
159 Ga0207674_10054264 3300026116 Bacteria 4081
160 Ga0207674_12299895 3300026116 Bacteria 501
161 Ga0207698_10069283 3300026142 Bacteria 2789
162 Ga0207698_10372993 3300026142 Bacteria 1355
163 Ga0207698_10856155 3300026142 Bacteria 914
164 Ga0373934_0122904 3300035086 Bacteria 1056
165 Ga0373957_0235600 3300035120 Bacteria 768
166 Ga0373955_0633686 3300035172 Bacteria 655
167 Ga0373937_0001058 3300036401 Bacteria 23217
168 Ga0373937_1112155 3300036401 Bacteria 739
169 Ga0373925_0353206 3300037068 Bacteria 1194
170 Ga0395899_0155307 3300037312 Bacteria 1619
171 Ga0395899_0441738 3300037312 Bacteria 853
172 Ga0395899_0460806 3300037312 Bacteria 831
173 Ga0395900_0130433 3300037418 Bacteria 2576
174 Ga0395900_0182297 3300037418 Bacteria 2133
175 Ga0395900_0353148 3300037418 Bacteria 1443
176 Ga0395900_0510114 3300037418 Bacteria 1152
177 Ga0395900_0579711 3300037418 Bacteria 1064
178 Ga0395898_0091327 3300037466 Bacteria 2930
179 Ga0395898_0116328 3300037466 Bacteria 2562
180 Ga0395898_0127837 3300037466 Bacteria 2434
181 Ga0395898_0303199 3300037466 Bacteria 1524
182 Ga0395898_0593491 3300037466 Bacteria 1050
183 Ga0395898_1453463 3300037466 Bacteria 612
184 Ga0395905_0181823 3300037471 Bacteria 1974
185 Ga0395905_0219799 3300037471 Bacteria 1778
186 Ga0395905_0907056 3300037471 Bacteria 784
187 Ga0395901_0011540 3300038443 Bacteria 8953
188 Ga0395901_0169416 3300038443 Bacteria 2291
189 Ga0395901_0505986 3300038443 Bacteria 1229
190 Ga0436360_0453943 3300039438 Bacteria 2787
191 Ga0436360_1311940 3300039438 Bacteria 2291
192 Ga0451804_0916896 3300041463 Bacteria 709
193 Ga0451807_2712184 3300041486 Bacteria 655
194 Ga0466969_0105045 3300044656 Bacteria 1326
195 Ga0466969_0460983 3300044656 Bacteria 579
196 Ga0466965_0081397 3300044683 Bacteria 1637
197 Ga0466966_0001849 3300044684 Bacteria 13724
198 Ga0466966_0005429 3300044684 Bacteria 8380
199 Ga0466966_0023722 3300044684 Bacteria 4015
200 Ga0466961_0005843 3300044693 Bacteria 7796
201 Ga0466961_0032733 3300044693 Bacteria 3341
202 Ga0466961_0108136 3300044693 Bacteria 1750
203 Ga0466961_0109195 3300044693 Bacteria 1741
204 Ga0466961_0119254 3300044693 Bacteria 1657
205 Ga0466961_0192740 3300044693 Bacteria 1263
206 Ga0466961_0203636 3300044693 Bacteria 1223
207 Ga0466963_0001677 3300044694 Bacteria 12065
208 Ga0466963_0001805 3300044694 Bacteria 11654
209 Ga0466963_0002283 3300044694 Bacteria 10658
210 Ga0466963_0002423 3300044694 Bacteria 10428
211 Ga0466963_0002547 3300044694 Bacteria 10212
212 Ga0466963_0004937 3300044694 Bacteria 7776
213 Ga0466963_0008813 3300044694 Bacteria 6057
214 Ga0466963_0014574 3300044694 Bacteria 4851
215 Ga0466963_0027677 3300044694 Bacteria 3632
216 Ga0466963_0043076 3300044694 Bacteria 2966
217 Ga0466963_0045444 3300044694 Bacteria 2892
218 Ga0466963_0053038 3300044694 Bacteria 2692
219 Ga0466963_0111514 3300044694 Bacteria 1878
220 Ga0466963_0276979 3300044694 Bacteria 1179
221 Ga0466963_0390834 3300044694 Bacteria 981
222 Ga0466964_0009299 3300044706 Bacteria 3698
223 Ga0466964_0012669 3300044706 Bacteria 3193
224 Ga0466964_0030247 3300044706 Bacteria 2142
225 Ga0466964_0069389 3300044706 Bacteria 1486
226 Ga0466964_0095247 3300044706 Unclassified 1302
227 Ga0466964_0108575 3300044706 Unclassified 1234
228 Ga0466964_0131801 3300044706 Bacteria 1139
229 Ga0466964_0572614 3300044706 Unclassified 616
230 Ga0466971_0001648 3300044719 Bacteria 9438
231 Ga0466971_0003570 3300044719 Bacteria 6648
232 Ga0466971_0008029 3300044719 Bacteria 4602
233 Ga0466971_0015429 3300044719 Bacteria 3363
234 Ga0466971_0020321 3300044719 Bacteria 2952
235 Ga0466971_0032778 3300044719 Bacteria 2328
236 Ga0466971_0096071 3300044719 Bacteria 1359
237 Ga0466971_0123791 3300044719 Bacteria 1198
238 Ga0466971_0153763 3300044719 Unclassified 1075
239 Ga0466971_0266470 3300044719 Bacteria 818
240 Ga0466968_0022469 3300044735 Unclassified 2564
241 Ga0466968_0045000 3300044735 Bacteria 1872
242 Ga0466968_0050980 3300044735 Bacteria 1767
243 Ga0466970_0013194 3300044765 Bacteria 4235
244 Ga0466970_0899875 3300044765 Unclassified 520
245 Ga0466957_0001545 3300044842 Bacteria 12106
246 Ga0466957_0002519 3300044842 Bacteria 9854
247 Ga0466957_0018816 3300044842 Bacteria 4060
248 Ga0466957_0027498 3300044842 Bacteria 3381
249 Ga0466957_0033629 3300044842 Bacteria 3076
250 Ga0466957_0036236 3300044842 Bacteria 2965
251 Ga0466957_0040518 3300044842 Bacteria 2814
252 Ga0466957_0041918 3300044842 Bacteria 2768
253 Ga0466957_0067024 3300044842 Bacteria 2214
254 Ga0466957_0111428 3300044842 Bacteria 1736
255 Ga0466957_0553901 3300044842 Unclassified 801
256 Ga0466960_0004006 3300044901 Bacteria 5730
257 Ga0466960_0021361 3300044901 Bacteria 2880
258 Ga0466960_0079456 3300044901 Bacteria 1650
259 Ga0466960_0104251 3300044901 Unclassified 1465
260 Ga0466960_0138984 3300044901 Bacteria 1289
261 Ga0466959_0004400 3300045049 Bacteria 9430
262 Ga0466959_0011626 3300045049 Bacteria 6328
263 Ga0466959_0044564 3300045049 Bacteria 3268
264 Ga0466959_0050284 3300045049 Bacteria 3060
265 Ga0466959_0065544 3300045049 Bacteria 2636
266 Ga0466959_0074577 3300045049 Bacteria 2453
267 Ga0466959_0114391 3300045049 Bacteria 1923
268 Ga0466959_0471403 3300045049 Unclassified 850
269 Ga0466959_0867507 3300045049 Bacteria 602
270 Ga0466958_0003857 3300045836 Bacteria 7840
271 Ga0466958_0005710 3300045836 Bacteria 6720
272 Ga0466958_0006912 3300045836 Bacteria 6206
273 Ga0466958_0008696 3300045836 Bacteria 5636
274 Ga0466958_0020094 3300045836 Bacteria 3893
275 Ga0466958_0030925 3300045836 Bacteria 3182
276 Ga0466958_0048760 3300045836 Unclassified 2561
277 Ga0466958_0074956 3300045836 Bacteria 2075
278 Ga0466958_0084124 3300045836 Bacteria 1962
279 Ga0466958_0132113 3300045836 Bacteria 1568
280 Ga0466958_0140973 3300045836 Bacteria 1517
281 Ga0466958_0204622 3300045836 Unclassified 1256
282 Ga0466958_0218543 3300045836 Bacteria 1215
283 Ga0466958_0377194 3300045836 Bacteria 914
284 Ga0466958_0400991 3300045836 Bacteria 885
285 Ga0466958_0431975 3300045836 Unclassified 852
286 Ga0466958_0912382 3300045836 Bacteria 573
287 Ga0466958_1109658 3300045836 Bacteria 516
288 Ga0466967_0000122 3300045976 Bacteria 29237
289 Ga0466967_0002222 3300045976 Bacteria 11944
290 Ga0466967_0004404 3300045976 Bacteria 9489
291 Ga0466967_0005380 3300045976 Bacteria 8862
292 Ga0466967_0005987 3300045976 Bacteria 8539
293 Ga0466967_0006609 3300045976 Bacteria 8238
294 Ga0466967_0007011 3300045976 Bacteria 8069
295 Ga0466967_0011153 3300045976 Bacteria 6790
296 Ga0466967_0011622 3300045976 Bacteria 6684
297 Ga0466967_0024707 3300045976 Bacteria 4944
298 Ga0466967_0024771 3300045976 Bacteria 4939
299 Ga0466967_0031407 3300045976 Bacteria 4470
300 Ga0466967_0035094 3300045976 Bacteria 4265
301 Ga0466967_0082790 3300045976 Bacteria 2901
302 Ga0466967_0084429 3300045976 Bacteria 2873
303 Ga0466967_0096273 3300045976 Bacteria 2700
304 Ga0466967_0126416 3300045976 Bacteria 2368
305 Ga0466967_0151727 3300045976 Unclassified 2166
306 Ga0466967_0152973 3300045976 Bacteria 2158
307 Ga0466967_0264446 3300045976 Bacteria 1646
308 Ga0466967_0339356 3300045976 Unclassified 1452
309 Ga0466967_0429142 3300045976 Bacteria 1289
310 Ga0466967_0551179 3300045976 Unclassified 1135
311 Ga0466967_0693267 3300045976 Unclassified 1008
312 Ga0466967_1952966 3300045976 Bacteria 583
313 Ga0466967_1959473 3300045976 Bacteria 582
314 Ga0466967_2413985 3300045976 Bacteria 521
315 Ga0495592_0000037 3300046454 Bacteria 125143
316 Ga0495651_0000038 3300046462 Bacteria 97248
317 Ga0495653_0037895 3300046463 Bacteria 3785
318 Ga0495664_0138095 3300046477 Unclassified 1477
319 Ga0495608_0001032 3300046511 Bacteria 19553
320 Ga0495618_0001122 3300046514 Bacteria 18089
321 Ga0495628_0000025 3300046516 Bacteria 127935
322 Ga0495630_0178154 3300046517 Bacteria 1620
323 Ga0495630_0438574 3300046517 Bacteria 1001
324 Ga0495652_0000088 3300046529 Bacteria 98865
325 Ga0495652_0378073 3300046529 Bacteria 1008
326 Ga0495640_0364592 3300046533 Bacteria 890
327 Ga0495587_0000502 3300046536 Bacteria 27283
328 Ga0495645_0000024 3300046543 Bacteria 125065
329 Ga0495645_0262272 3300046543 Bacteria 1143
330 Ga0495667_0024487 3300046559 Bacteria 4065
331 Ga0495657_0013000 3300046675 Bacteria 6159
332 Ga0495599_0000019 3300046678 Bacteria 141108
333 Ga0495623_0000032 3300046679 Bacteria 84435
334 Ga0495646_0001414 3300046680 Bacteria 14283
335 Ga0495647_0109534 3300046681 Bacteria 1151
336 Ga0495658_0312645 3300046683 Bacteria 995
337 Ga0495624_0153542 3300046690 Bacteria 1408
338 Ga0495624_0360204 3300046690 Bacteria 874
339 Ga0495600_0083361 3300046809 Bacteria 2087
340 Ga0495604_0000476 3300047317 Bacteria 35284
341 Ga0495674_0118913 3300047319 Bacteria 2234
342 Ga0495674_0191543 3300047319 Bacteria 1699
343 Ga0495674_1221275 3300047319 Unclassified 567
344 Ga0495676_0094643 3300047321 Bacteria 2225
345 Ga0495676_0435798 3300047321 Bacteria 866
346 Ga0495680_0017550 3300047322 Bacteria 6106
347 Ga0495675_0000007 3300047444 Bacteria 162640
348 Ga0495602_0000246 3300048088 Bacteria 50728
349 Ga0496100_0044162 3300048903 Bacteria 2853
350 Ga0496100_0465120 3300048903 Bacteria 971
351 Ga0496100_0721512 3300048903 Bacteria 779
352 Ga0496101_0559758 3300048904 Bacteria 904
353 Ga0496101_0807480 3300048904 Bacteria 740
354 Ga0496102_0044016 3300048905 Bacteria 4049
355 Ga0496103_0296697 3300048906 Bacteria 1040
356 Ga0496104_0185508 3300048907 Bacteria 1991
357 Ga0496105_0001221 3300048908 Bacteria 17908
358 Ga0496105_0055757 3300048908 Bacteria 3263
359 Ga0496105_0562876 3300048908 Bacteria 888
360 Ga0496106_0298377 3300048909 Bacteria 1292
361 Ga0496107_0312566 3300048910 Bacteria 1169
362 Ga0496108_0010850 3300048911 Bacteria 7396
363 Ga0496108_0021074 3300048911 Bacteria 5355
364 Ga0496108_0238868 3300048911 Bacteria 1580
365 Ga0496108_0253079 3300048911 Bacteria 1532
366 Ga0496109_0002867 3300048912 Bacteria 14419
367 Ga0496109_0007731 3300048912 Bacteria 9103
368 Ga0496109_0058249 3300048912 Bacteria 3528
369 Ga0496109_0153125 3300048912 Bacteria 2159
370 Ga0496109_0272796 3300048912 Unclassified 1594
371 Ga0496109_0415990 3300048912 Bacteria 1270
372 Ga0496110_0022683 3300048913 Bacteria 5334
373 Ga0496110_0041441 3300048913 Bacteria 4018
374 Ga0496110_0320416 3300048913 Bacteria 1412
375 Ga0496111_0010161 3300048914 Bacteria 6303
376 Ga0496111_0032705 3300048914 Bacteria 3709
377 Ga0496111_0637489 3300048914 Bacteria 778
378 Ga0496112_0034759 3300048915 Bacteria 4906
379 Ga0496112_0137327 3300048915 Bacteria 2415
380 Ga0496112_0181672 3300048915 Bacteria 2067
381 Ga0496112_0221352 3300048915 Bacteria 1849
382 Ga0496112_0283472 3300048915 Bacteria 1603
383 Ga0496113_0078262 3300048916 Bacteria 2530
384 Ga0496113_0156246 3300048916 Bacteria 1801
385 Ga0496113_0769184 3300048916 Unclassified 766
386 Ga0496113_1008389 3300048916 Bacteria 655
387 Ga0496114_0050771 3300048917 Bacteria 3453
388 Ga0496115_0120942 3300048918 Bacteria 2154
389 Ga0496115_0178193 3300048918 Bacteria 1758
390 Ga0496115_0488208 3300048918 Unclassified 991
391 Ga0496115_0773911 3300048918 Bacteria 749
392 Ga0501047_0024077 3300049581 Bacteria 5847
393 Ga0501067_0015229 3300049583 Bacteria 4258
394 Ga0501067_0131415 3300049583 Bacteria 1393
395 Ga0501067_0273767 3300049583 Bacteria 940
396 Ga0501067_0297905 3300049583 Bacteria 898
397 Ga0501069_0047083 3300049585 Bacteria 2393
398 Ga0501069_0054741 3300049585 Bacteria 2222
399 Ga0501069_0060287 3300049585 Bacteria 2118
400 Ga0501070_0159954 3300049586 Bacteria 1857
401 Ga0501044_0277633 3300049823 Bacteria 1610
402 nmdc:mga08x19_52436_c1 3300050514 Unclassified 2623
403 Ga0495601_0000325 3300053077 Bacteria 25289
404 Ga0495601_0002577 3300053077 Bacteria 10308
405 Ga0495601_0149353 3300053077 Bacteria 1525
406 Ga0495612_0012878 3300053078 Bacteria 3370
407 Ga0495595_0033773 3300053084 Bacteria 2310
408 Ga0495619_0001347 3300053085 Bacteria 16107
409 Ga0466962_0005019 3300061719 Bacteria 6364
410 Ga0466962_0007811 3300061719 Bacteria 5127
411 Ga0466962_0029132 3300061719 Bacteria 2642
412 Ga0466962_0108133 3300061719 Bacteria 1338
413 Ga0466962_0432670 3300061719 Unclassified 661
414 Ga0466962_0612554 3300061719 Bacteria 555

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048903 Ga0496100_0721512 Ga0496100_0721512_194_538 92
2 3300044901 Ga0466960_0079456 Ga0466960_0079456_871_1215 93
3 3300009545 Ga0105237_10633265 Ga0105237_106332652 94
4 3300049583 Ga0501067_0131415 Ga0501067_0131415_82_426 94
5 3300049585 Ga0501069_0054741 Ga0501069_0054741_623_967 94
6 3300041463 Ga0451804_0916896 Ga0451804_0916896_198_542 95
7 3300048907 Ga0496104_0185508 Ga0496104_0185508_1467_1811 95
8 3300048908 Ga0496105_0055757 Ga0496105_0055757_201_545 95
9 3300048911 Ga0496108_0238868 Ga0496108_0238868_1205_1549 95
10 3300048912 Ga0496109_0153125 Ga0496109_0153125_986_1330 95
11 3300048913 Ga0496110_0041441 Ga0496110_0041441_497_841 95
12 3300048914 Ga0496111_0637489 Ga0496111_0637489_254_598 95
13 3300048915 Ga0496112_0034759 Ga0496112_0034759_1924_2268 95
14 3300005435 Ga0070714_100010893 Ga0070714_1000108938 96
15 3300006028 Ga0070717_10008104 Ga0070717_100081042 96
16 3300006028 Ga0070717_10245604 Ga0070717_102456042 96
17 3300025928 Ga0207700_11979230 Ga0207700_119792302 96
18 3300026078 Ga0207702_12359774 Ga0207702_123597742 96
19 3300037418 Ga0395900_0353148 Ga0395900_0353148_876_1220 96
20 3300037471 Ga0395905_0219799 Ga0395905_0219799_109_453 96
21 3300038443 Ga0395901_0505986 Ga0395901_0505986_396_740 96
22 3300005435 Ga0070714_100592687 Ga0070714_1005926872 97
23 3300005563 Ga0068855_100143269 Ga0068855_1001432693 97
24 3300005616 Ga0068852_100586274 Ga0068852_1005862742 97
25 3300013104 Ga0157370_10034532 Ga0157370_100345327 97
26 3300013105 Ga0157369_10005853 Ga0157369_1000585310 97
27 3300020069 Ga0197907_10004038 Ga0197907_100040382 97
28 3300022467 Ga0224712_10240579 Ga0224712_102405792 97
29 3300025929 Ga0207664_10003819 Ga0207664_100038198 97
30 3300025949 Ga0207667_10809144 Ga0207667_108091441 97
31 3300026142 Ga0207698_10069283 Ga0207698_100692833 97
32 3300037312 Ga0395899_0460806 Ga0395899_0460806_74_418 97
33 3300037466 Ga0395898_0593491 Ga0395898_0593491_136_480 97
34 3300044694 Ga0466963_0111514 Ga0466963_0111514_290_634 97
35 3300044706 Ga0466964_0572614 Ga0466964_0572614_49_393 97
36 3300044719 Ga0466971_0032778 Ga0466971_0032778_991_1335 97
37 3300044735 Ga0466968_0050980 Ga0466968_0050980_468_812 97
38 3300045976 Ga0466967_0024771 Ga0466967_0024771_2012_2356 97
39 3300045976 Ga0466967_0035094 Ga0466967_0035094_3229_3573 97
40 3300045976 Ga0466967_0126416 Ga0466967_0126416_926_1270 97
41 3300061719 Ga0466962_0108133 Ga0466962_0108133_742_1086 97
42 3300061719 Ga0466962_0432670 Ga0466962_0432670_162_506 97
43 3300005327 Ga0070658_10488191 Ga0070658_104881912 98
44 3300005336 Ga0070680_100041822 Ga0070680_1000418221 98
45 3300005337 Ga0070682_100169759 Ga0070682_1001697592 98
46 3300005344 Ga0070661_100769310 Ga0070661_1007693102 98
47 3300005366 Ga0070659_101370664 Ga0070659_1013706641 98
48 3300005406 Ga0070703_10333119 Ga0070703_103331191 98
49 3300005458 Ga0070681_10246217 Ga0070681_102462172 98
50 3300005530 Ga0070679_100077688 Ga0070679_1000776884 98
51 3300005539 Ga0068853_100999765 Ga0068853_1009997652 98
52 3300005549 Ga0070704_100811538 Ga0070704_1008115382 98
53 3300005563 Ga0068855_100785335 Ga0068855_1007853352 98
54 3300005616 Ga0068852_100434483 Ga0068852_1004344832 98
55 3300009093 Ga0105240_10188246 Ga0105240_101882462 98
56 3300009098 Ga0105245_10012284 Ga0105245_100122849 98
57 3300009553 Ga0105249_12150735 Ga0105249_121507352 98
58 3300010375 Ga0105239_10169594 Ga0105239_101695942 98
59 3300011119 Ga0105246_10670825 Ga0105246_106708252 98
60 3300013105 Ga0157369_10298576 Ga0157369_102985762 98
61 3300013296 Ga0157374_10064934 Ga0157374_100649347 98
62 3300013307 Ga0157372_10107733 Ga0157372_101077332 98
63 3300013307 Ga0157372_10118900 Ga0157372_101189007 98
64 3300013307 Ga0157372_10234132 Ga0157372_102341322 98
65 3300013308 Ga0157375_13137293 Ga0157375_131372931 98
66 3300014745 Ga0157377_10239660 Ga0157377_102396602 98
67 3300022467 Ga0224712_10181715 Ga0224712_101817151 98
68 3300025906 Ga0207699_10786698 Ga0207699_107866982 98
69 3300025913 Ga0207695_10250551 Ga0207695_102505512 98
70 3300025921 Ga0207652_10216214 Ga0207652_102162142 98
71 3300025924 Ga0207694_10322669 Ga0207694_103226692 98
72 3300025927 Ga0207687_10018735 Ga0207687_1001873510 98
73 3300025961 Ga0207712_11661861 Ga0207712_116618611 98
74 3300026078 Ga0207702_10073697 Ga0207702_100736972 98
75 3300026142 Ga0207698_10372993 Ga0207698_103729932 98
76 3300037466 Ga0395898_0303199 Ga0395898_0303199_440_784 98
77 3300039438 Ga0436360_1311940 Ga0436360_1311940_1291_1635 98
78 3300044694 Ga0466963_0002547 Ga0466963_0002547_8004_8348 98
79 3300044706 Ga0466964_0069389 Ga0466964_0069389_285_629 98
80 3300044719 Ga0466971_0015429 Ga0466971_0015429_1561_1905 98
81 3300044719 Ga0466971_0123791 Ga0466971_0123791_594_938 98
82 3300044719 Ga0466971_0266470 Ga0466971_0266470_385_729 98
83 3300044735 Ga0466968_0045000 Ga0466968_0045000_632_976 98
84 3300044765 Ga0466970_0899875 Ga0466970_0899875_116_460 98
85 3300044842 Ga0466957_0027498 Ga0466957_0027498_2118_2462 98
86 3300044842 Ga0466957_0033629 Ga0466957_0033629_545_889 98
87 3300044842 Ga0466957_0036236 Ga0466957_0036236_1190_1534 98
88 3300044901 Ga0466960_0021361 Ga0466960_0021361_1025_1369 98
89 3300045049 Ga0466959_0114391 Ga0466959_0114391_220_564 98
90 3300045049 Ga0466959_0867507 Ga0466959_0867507_151_495 98
91 3300045836 Ga0466958_0030925 Ga0466958_0030925_2122_2466 98
92 3300045836 Ga0466958_0132113 Ga0466958_0132113_177_521 98
93 3300045836 Ga0466958_0140973 Ga0466958_0140973_1056_1400 98
94 3300045836 Ga0466958_0377194 Ga0466958_0377194_82_426 98
95 3300045976 Ga0466967_0000122 Ga0466967_0000122_28474_28818 98
96 3300045976 Ga0466967_0005987 Ga0466967_0005987_7177_7521 98
97 3300048903 Ga0496100_0465120 Ga0496100_0465120_274_618 98
98 3300048904 Ga0496101_0807480 Ga0496101_0807480_139_483 98
99 3300048908 Ga0496105_0001221 Ga0496105_0001221_3497_3841 98
100 3300048911 Ga0496108_0010850 Ga0496108_0010850_6915_7259 98
101 3300048911 Ga0496108_0021074 Ga0496108_0021074_238_582 98
102 3300048912 Ga0496109_0002867 Ga0496109_0002867_6912_7256 98
103 3300048912 Ga0496109_0007731 Ga0496109_0007731_1989_2333 98
104 3300048913 Ga0496110_0022683 Ga0496110_0022683_3179_3523 98
105 3300048914 Ga0496111_0010161 Ga0496111_0010161_1418_1762 98
106 3300048915 Ga0496112_0181672 Ga0496112_0181672_413_757 98
107 3300048915 Ga0496112_0221352 Ga0496112_0221352_138_482 98
108 3300048916 Ga0496113_0078262 Ga0496113_0078262_1928_2272 98
109 3300048916 Ga0496113_1008389 Ga0496113_1008389_255_599 98
110 3300048917 Ga0496114_0050771 Ga0496114_0050771_494_838 98
111 3300048918 Ga0496115_0120942 Ga0496115_0120942_274_618 98
112 3300061719 Ga0466962_0007811 Ga0466962_0007811_4209_4553 98
113 3300061719 Ga0466962_0612554 Ga0466962_0612554_200_544 98
114 3300003322 rootL2_10304739 rootL2_103047391 99
115 3300003323 rootH1_10109677 rootH1_101096771 99
116 3300005457 Ga0070662_100357205 Ga0070662_1003572052 99
117 3300013307 Ga0157372_10630613 Ga0157372_106306132 99
118 3300025929 Ga0207664_10088240 Ga0207664_100882404 99
119 3300044684 Ga0466966_0001849 Ga0466966_0001849_6482_6826 99
120 3300044693 Ga0466961_0109195 Ga0466961_0109195_93_437 99
121 3300045049 Ga0466959_0004400 Ga0466959_0004400_5139_5483 99
122 3300045836 Ga0466958_0074956 Ga0466958_0074956_238_582 99
123 3300046529 Ga0495652_0378073 Ga0495652_0378073_79_423 99
124 3300046533 Ga0495640_0364592 Ga0495640_0364592_106_450 99
125 3300047319 Ga0495674_0191543 Ga0495674_0191543_866_1210 99
126 3300047319 Ga0495674_1221275 Ga0495674_1221275_10_354 99
127 3300047321 Ga0495676_0094643 Ga0495676_0094643_1600_1944 99
128 3300048918 Ga0496115_0178193 Ga0496115_0178193_618_962 99
129 3300053077 Ga0495601_0002577 Ga0495601_0002577_9487_9831 99
130 3300005327 Ga0070658_10034677 Ga0070658_100346772 100
131 3300005327 Ga0070658_10268638 Ga0070658_102686382 100
132 3300005329 Ga0070683_100097716 Ga0070683_1000977164 100
133 3300005336 Ga0070680_100229819 Ga0070680_1002298192 100
134 3300005336 Ga0070680_100689508 Ga0070680_1006895082 100
135 3300005337 Ga0070682_100029805 Ga0070682_1000298057 100
136 3300005337 Ga0070682_100091103 Ga0070682_1000911032 100
137 3300005339 Ga0070660_100223582 Ga0070660_1002235822 100
138 3300005339 Ga0070660_100443605 Ga0070660_1004436052 100
139 3300005341 Ga0070691_10017081 Ga0070691_100170814 100
140 3300005341 Ga0070691_10059942 Ga0070691_100599423 100
141 3300005344 Ga0070661_100048799 Ga0070661_1000487992 100
142 3300005344 Ga0070661_101493068 Ga0070661_1014930682 100
143 3300005366 Ga0070659_100074664 Ga0070659_1000746642 100
144 3300005434 Ga0070709_10458859 Ga0070709_104588592 100
145 3300005435 Ga0070714_100092663 Ga0070714_1000926632 100
146 3300005435 Ga0070714_100131486 Ga0070714_1001314863 100
147 3300005437 Ga0070710_10347355 Ga0070710_103473552 100
148 3300005458 Ga0070681_10086266 Ga0070681_100862666 100
149 3300005458 Ga0070681_10222944 Ga0070681_102229442 100
150 3300005530 Ga0070679_100067733 Ga0070679_1000677334 100
151 3300005530 Ga0070679_101454754 Ga0070679_1014547542 100
152 3300005530 Ga0070679_101978139 Ga0070679_1019781392 100
153 3300005535 Ga0070684_100036833 Ga0070684_1000368332 100
154 3300005539 Ga0068853_100584074 Ga0068853_1005840742 100
155 3300005545 Ga0070695_100000028 Ga0070695_1000000289 100
156 3300005563 Ga0068855_100056266 Ga0068855_1000562666 100
157 3300005563 Ga0068855_100190310 Ga0068855_1001903103 100
158 3300005564 Ga0070664_100337077 Ga0070664_1003370772 100
159 3300005577 Ga0068857_100115469 Ga0068857_1001154692 100
160 3300005614 Ga0068856_100054408 Ga0068856_1000544082 100
161 3300005616 Ga0068852_100136664 Ga0068852_1001366642 100
162 3300006028 Ga0070717_10247264 Ga0070717_102472642 100
163 3300006028 Ga0070717_11883257 Ga0070717_118832572 100
164 3300006358 Ga0068871_100506773 Ga0068871_1005067732 100
165 3300009093 Ga0105240_10016968 Ga0105240_100169689 100
166 3300009093 Ga0105240_10146004 Ga0105240_101460044 100
167 3300009093 Ga0105240_10255771 Ga0105240_102557712 100
168 3300009545 Ga0105237_10020964 Ga0105237_100209646 100
169 3300010375 Ga0105239_10500032 Ga0105239_105000322 100
170 3300013100 Ga0157373_10636162 Ga0157373_106361622 100
171 3300013105 Ga0157369_10123931 Ga0157369_101239312 100
172 3300013105 Ga0157369_10260583 Ga0157369_102605832 100
173 3300013105 Ga0157369_10395624 Ga0157369_103956243 100
174 3300013105 Ga0157369_10940565 Ga0157369_109405652 100
175 3300013296 Ga0157374_11528198 Ga0157374_115281982 100
176 3300013307 Ga0157372_10022798 Ga0157372_100227989 100
177 3300013307 Ga0157372_10057133 Ga0157372_100571338 100
178 3300020070 Ga0206356_10205567 Ga0206356_102055671 100
179 3300020082 Ga0206353_11103351 Ga0206353_111033512 100
180 3300025906 Ga0207699_10307604 Ga0207699_103076042 100
181 3300025912 Ga0207707_10127881 Ga0207707_101278812 100
182 3300025912 Ga0207707_10627808 Ga0207707_106278082 100
183 3300025913 Ga0207695_10078704 Ga0207695_100787044 100
184 3300025913 Ga0207695_10101485 Ga0207695_101014852 100
185 3300025913 Ga0207695_10541484 Ga0207695_105414842 100
186 3300025913 Ga0207695_11021089 Ga0207695_110210892 100
187 3300025914 Ga0207671_10048219 Ga0207671_100482192 100
188 3300025917 Ga0207660_10118563 Ga0207660_101185632 100
189 3300025917 Ga0207660_11408683 Ga0207660_114086832 100
190 3300025919 Ga0207657_10002847 Ga0207657_1000284720 100
191 3300025920 Ga0207649_10260799 Ga0207649_102607992 100
192 3300025921 Ga0207652_10216809 Ga0207652_102168092 100
193 3300025921 Ga0207652_11055277 Ga0207652_110552772 100
194 3300025924 Ga0207694_10420628 Ga0207694_104206282 100
195 3300025929 Ga0207664_10057731 Ga0207664_100577313 100
196 3300025929 Ga0207664_10555595 Ga0207664_105555952 100
197 3300025929 Ga0207664_11696737 Ga0207664_116967372 100
198 3300025932 Ga0207690_10060533 Ga0207690_100605332 100
199 3300025933 Ga0207706_10573454 Ga0207706_105734542 100
200 3300025944 Ga0207661_10243193 Ga0207661_102431932 100
201 3300025949 Ga0207667_10316287 Ga0207667_103162872 100
202 3300025949 Ga0207667_10955182 Ga0207667_109551822 100
203 3300026078 Ga0207702_10038145 Ga0207702_100381452 100
204 3300026116 Ga0207674_10054264 Ga0207674_100542644 100
205 3300026142 Ga0207698_10856155 Ga0207698_108561552 100
206 3300036401 Ga0373937_1112155 Ga0373937_1112155_320_664 100
207 3300037312 Ga0395899_0155307 Ga0395899_0155307_202_546 100
208 3300037418 Ga0395900_0130433 Ga0395900_0130433_1546_1890 100
209 3300037418 Ga0395900_0510114 Ga0395900_0510114_232_576 100
210 3300037418 Ga0395900_0579711 Ga0395900_0579711_43_387 100
211 3300037466 Ga0395898_0127837 Ga0395898_0127837_349_693 100
212 3300037466 Ga0395898_1453463 Ga0395898_1453463_91_435 100
213 3300037471 Ga0395905_0181823 Ga0395905_0181823_594_938 100
214 3300038443 Ga0395901_0169416 Ga0395901_0169416_24_368 100
215 3300044693 Ga0466961_0119254 Ga0466961_0119254_509_853 100
216 3300044694 Ga0466963_0002283 Ga0466963_0002283_7088_7432 100
217 3300044706 Ga0466964_0012669 Ga0466964_0012669_1528_1872 100
218 3300044842 Ga0466957_0018816 Ga0466957_0018816_3594_3938 100
219 3300044842 Ga0466957_0553901 Ga0466957_0553901_206_550 100
220 3300044901 Ga0466960_0138984 Ga0466960_0138984_721_1065 100
221 3300045049 Ga0466959_0065544 Ga0466959_0065544_543_887 100
222 3300045836 Ga0466958_0008696 Ga0466958_0008696_2239_2583 100
223 3300045836 Ga0466958_0084124 Ga0466958_0084124_280_624 100
224 3300045976 Ga0466967_0004404 Ga0466967_0004404_8364_8708 100
225 3300045976 Ga0466967_0011153 Ga0466967_0011153_2121_2465 100
226 3300045976 Ga0466967_0024707 Ga0466967_0024707_178_522 100
227 3300046477 Ga0495664_0138095 Ga0495664_0138095_951_1295 100
228 3300046517 Ga0495630_0178154 Ga0495630_0178154_975_1319 100
229 3300046543 Ga0495645_0262272 Ga0495645_0262272_781_1125 100
230 3300046681 Ga0495647_0109534 Ga0495647_0109534_88_432 100
231 3300046683 Ga0495658_0312645 Ga0495658_0312645_445_789 100
232 3300046690 Ga0495624_0153542 Ga0495624_0153542_957_1301 100
233 3300047321 Ga0495676_0435798 Ga0495676_0435798_112_456 100
234 3300048903 Ga0496100_0044162 Ga0496100_0044162_2140_2484 100
235 3300048904 Ga0496101_0559758 Ga0496101_0559758_21_365 100
236 3300048905 Ga0496102_0044016 Ga0496102_0044016_509_853 100
237 3300048906 Ga0496103_0296697 Ga0496103_0296697_278_622 100
238 3300048908 Ga0496105_0562876 Ga0496105_0562876_454_798 100
239 3300048909 Ga0496106_0298377 Ga0496106_0298377_429_773 100
240 3300048910 Ga0496107_0312566 Ga0496107_0312566_520_864 100
241 3300048911 Ga0496108_0253079 Ga0496108_0253079_862_1206 100
242 3300048912 Ga0496109_0058249 Ga0496109_0058249_2771_3115 100
243 3300048912 Ga0496109_0415990 Ga0496109_0415990_11_355 100
244 3300048913 Ga0496110_0320416 Ga0496110_0320416_305_649 100
245 3300048914 Ga0496111_0032705 Ga0496111_0032705_587_931 100
246 3300048915 Ga0496112_0283472 Ga0496112_0283472_291_635 100
247 3300048916 Ga0496113_0156246 Ga0496113_0156246_849_1193 100
248 3300048918 Ga0496115_0773911 Ga0496115_0773911_39_383 100
249 3300053077 Ga0495601_0149353 Ga0495601_0149353_699_1043 100
250 3300005434 Ga0070709_10193020 Ga0070709_101930202 101
251 3300005435 Ga0070714_100972615 Ga0070714_1009726152 101
252 3300005436 Ga0070713_100262263 Ga0070713_1002622632 101
253 3300005439 Ga0070711_100103413 Ga0070711_1001034132 101
254 3300005614 Ga0068856_101027772 Ga0068856_1010277722 101
255 3300006028 Ga0070717_10066290 Ga0070717_100662903 101
256 3300006914 Ga0075436_100060281 Ga0075436_1000602812 101
257 3300025916 Ga0207663_10358891 Ga0207663_103588912 101
258 3300025928 Ga0207700_10363543 Ga0207700_103635432 101
259 3300025929 Ga0207664_10350681 Ga0207664_103506812 101
260 3300050514 nmdc:mga08x19_52436_c1 nmdc:mga08x19_52436_c1_1763_2107 101
261 3300005530 Ga0070679_100069063 Ga0070679_1000690632 102
262 3300005535 Ga0070684_100017136 Ga0070684_1000171366 102
263 3300005616 Ga0068852_102133369 Ga0068852_1021333692 102
264 3300013104 Ga0157370_11539632 Ga0157370_115396321 102
265 3300013105 Ga0157369_10225720 Ga0157369_102257202 102
266 3300020070 Ga0206356_10152118 Ga0206356_101521181 102
267 3300020082 Ga0206353_11259920 Ga0206353_112599202 102
268 3300021441 Ga0213871_10019390 Ga0213871_100193902 102
269 3300025921 Ga0207652_10273921 Ga0207652_102739212 102
270 3300025944 Ga0207661_10002551 Ga0207661_1000255113 102
271 3300026116 Ga0207674_12299895 Ga0207674_122998951 102
272 3300039438 Ga0436360_0453943 Ga0436360_0453943_906_1250 102
273 3300044694 Ga0466963_0390834 Ga0466963_0390834_436_780 102
274 3300045976 Ga0466967_0006609 Ga0466967_0006609_4830_5174 102
275 3300045976 Ga0466967_0031407 Ga0466967_0031407_2212_2556 102
276 3300045976 Ga0466967_0551179 Ga0466967_0551179_254_598 102
277 3300045976 Ga0466967_2413985 Ga0466967_2413985_67_411 102
278 3300005329 Ga0070683_100827764 Ga0070683_1008277642 103
279 3300005344 Ga0070661_100424806 Ga0070661_1004248062 103
280 3300005436 Ga0070713_100517841 Ga0070713_1005178412 103
281 3300005535 Ga0070684_100229531 Ga0070684_1002295312 103
282 3300005614 Ga0068856_100248540 Ga0068856_1002485402 103
283 3300013105 Ga0157369_10436848 Ga0157369_104368482 103
284 3300022467 Ga0224712_10113255 Ga0224712_101132552 103
285 3300025920 Ga0207649_10294389 Ga0207649_102943892 103
286 3300025928 Ga0207700_10358247 Ga0207700_103582472 103
287 3300025944 Ga0207661_10353551 Ga0207661_103535512 103
288 3300026078 Ga0207702_11141498 Ga0207702_111414981 103
289 3300037068 Ga0373925_0353206 Ga0373925_0353206_129_473 103
290 3300037466 Ga0395898_0091327 Ga0395898_0091327_2548_2892 103
291 3300044656 Ga0466969_0460983 Ga0466969_0460983_128_472 103
292 3300044683 Ga0466965_0081397 Ga0466965_0081397_142_486 103
293 3300044684 Ga0466966_0005429 Ga0466966_0005429_1427_1771 103
294 3300044684 Ga0466966_0023722 Ga0466966_0023722_811_1155 103
295 3300044693 Ga0466961_0005843 Ga0466961_0005843_2351_2695 103
296 3300044693 Ga0466961_0108136 Ga0466961_0108136_951_1295 103
297 3300044693 Ga0466961_0192740 Ga0466961_0192740_225_569 103
298 3300044693 Ga0466961_0203636 Ga0466961_0203636_527_871 103
299 3300044694 Ga0466963_0001677 Ga0466963_0001677_7589_7933 103
300 3300044694 Ga0466963_0001805 Ga0466963_0001805_6331_6675 103
301 3300044694 Ga0466963_0002423 Ga0466963_0002423_630_974 103
302 3300044694 Ga0466963_0004937 Ga0466963_0004937_4696_5040 103
303 3300044694 Ga0466963_0014574 Ga0466963_0014574_2112_2456 103
304 3300044694 Ga0466963_0027677 Ga0466963_0027677_171_515 103
305 3300044694 Ga0466963_0043076 Ga0466963_0043076_367_711 103
306 3300044694 Ga0466963_0045444 Ga0466963_0045444_2144_2488 103
307 3300044694 Ga0466963_0053038 Ga0466963_0053038_709_1053 103
308 3300044694 Ga0466963_0276979 Ga0466963_0276979_654_998 103
309 3300044706 Ga0466964_0009299 Ga0466964_0009299_1994_2338 103
310 3300044706 Ga0466964_0030247 Ga0466964_0030247_933_1277 103
311 3300044706 Ga0466964_0095247 Ga0466964_0095247_171_515 103
312 3300044706 Ga0466964_0108575 Ga0466964_0108575_139_483 103
313 3300044706 Ga0466964_0131801 Ga0466964_0131801_505_849 103
314 3300044719 Ga0466971_0001648 Ga0466971_0001648_4255_4599 103
315 3300044719 Ga0466971_0003570 Ga0466971_0003570_2327_2671 103
316 3300044719 Ga0466971_0008029 Ga0466971_0008029_2224_2568 103
317 3300044719 Ga0466971_0096071 Ga0466971_0096071_79_423 103
318 3300044719 Ga0466971_0153763 Ga0466971_0153763_238_582 103
319 3300044735 Ga0466968_0022469 Ga0466968_0022469_607_951 103
320 3300044765 Ga0466970_0013194 Ga0466970_0013194_1936_2280 103
321 3300044842 Ga0466957_0001545 Ga0466957_0001545_6603_6947 103
322 3300044842 Ga0466957_0002519 Ga0466957_0002519_2239_2583 103
323 3300044842 Ga0466957_0067024 Ga0466957_0067024_1320_1664 103
324 3300044842 Ga0466957_0111428 Ga0466957_0111428_553_897 103
325 3300044901 Ga0466960_0004006 Ga0466960_0004006_3569_3913 103
326 3300044901 Ga0466960_0104251 Ga0466960_0104251_691_1035 103
327 3300045049 Ga0466959_0011626 Ga0466959_0011626_947_1291 103
328 3300045049 Ga0466959_0050284 Ga0466959_0050284_80_424 103
329 3300045049 Ga0466959_0074577 Ga0466959_0074577_1735_2079 103
330 3300045836 Ga0466958_0003857 Ga0466958_0003857_46_390 103
331 3300045836 Ga0466958_0005710 Ga0466958_0005710_4476_4820 103
332 3300045836 Ga0466958_0020094 Ga0466958_0020094_560_904 103
333 3300045836 Ga0466958_0048760 Ga0466958_0048760_1444_1788 103
334 3300045836 Ga0466958_0204622 Ga0466958_0204622_746_1090 103
335 3300045836 Ga0466958_0218543 Ga0466958_0218543_684_1028 103
336 3300045836 Ga0466958_0400991 Ga0466958_0400991_78_422 103
337 3300045836 Ga0466958_0431975 Ga0466958_0431975_287_631 103
338 3300045836 Ga0466958_0912382 Ga0466958_0912382_51_395 103
339 3300045836 Ga0466958_1109658 Ga0466958_1109658_62_406 103
340 3300045976 Ga0466967_0002222 Ga0466967_0002222_8484_8828 103
341 3300045976 Ga0466967_0005380 Ga0466967_0005380_692_1036 103
342 3300045976 Ga0466967_0007011 Ga0466967_0007011_3723_4067 103
343 3300045976 Ga0466967_0011622 Ga0466967_0011622_4557_4901 103
344 3300045976 Ga0466967_0082790 Ga0466967_0082790_858_1202 103
345 3300045976 Ga0466967_0151727 Ga0466967_0151727_1133_1477 103
346 3300045976 Ga0466967_0152973 Ga0466967_0152973_1430_1774 103
347 3300045976 Ga0466967_0264446 Ga0466967_0264446_720_1064 103
348 3300045976 Ga0466967_0339356 Ga0466967_0339356_183_527 103
349 3300045976 Ga0466967_0429142 Ga0466967_0429142_31_375 103
350 3300045976 Ga0466967_0693267 Ga0466967_0693267_349_693 103
351 3300045976 Ga0466967_1952966 Ga0466967_1952966_78_422 103
352 3300045976 Ga0466967_1959473 Ga0466967_1959473_62_406 103
353 3300046690 Ga0495624_0360204 Ga0495624_0360204_117_461 103
354 3300048918 Ga0496115_0488208 Ga0496115_0488208_269_613 103
355 3300061719 Ga0466962_0005019 Ga0466962_0005019_3648_3992 103
356 3300061719 Ga0466962_0029132 Ga0466962_0029132_1758_2102 103
357 3300044842 Ga0466957_0040518 Ga0466957_0040518_341_685 104
358 3300045976 Ga0466967_0084429 Ga0466967_0084429_1220_1564 104
359 3300003320 rootH2_10124433 rootH2_101244332 114
360 3300035086 Ga0373934_0122904 Ga0373934_0122904_502_846 114
361 3300035120 Ga0373957_0235600 Ga0373957_0235600_164_508 114
362 3300035172 Ga0373955_0633686 Ga0373955_0633686_36_380 114
363 3300036401 Ga0373937_0001058 Ga0373937_0001058_15696_16040 114
364 3300037312 Ga0395899_0441738 Ga0395899_0441738_66_410 114
365 3300037418 Ga0395900_0182297 Ga0395900_0182297_108_452 114
366 3300037466 Ga0395898_0116328 Ga0395898_0116328_297_641 114
367 3300037471 Ga0395905_0907056 Ga0395905_0907056_421_765 114
368 3300038443 Ga0395901_0011540 Ga0395901_0011540_3426_3770 114
369 3300041486 Ga0451807_2712184 Ga0451807_2712184_210_554 114
370 3300044656 Ga0466969_0105045 Ga0466969_0105045_860_1204 114
371 3300044693 Ga0466961_0032733 Ga0466961_0032733_1451_1795 114
372 3300044694 Ga0466963_0008813 Ga0466963_0008813_4879_5223 114
373 3300044719 Ga0466971_0020321 Ga0466971_0020321_860_1204 114
374 3300044842 Ga0466957_0041918 Ga0466957_0041918_271_615 114
375 3300045049 Ga0466959_0044564 Ga0466959_0044564_1502_1846 114
376 3300045049 Ga0466959_0471403 Ga0466959_0471403_105_449 114
377 3300045836 Ga0466958_0006912 Ga0466958_0006912_1237_1581 114
378 3300045976 Ga0466967_0096273 Ga0466967_0096273_1914_2258 114
379 3300046454 Ga0495592_0000037 Ga0495592_0000037_16468_16812 114
380 3300046462 Ga0495651_0000038 Ga0495651_0000038_88287_88631 114
381 3300046463 Ga0495653_0037895 Ga0495653_0037895_2116_2460 114
382 3300046511 Ga0495608_0001032 Ga0495608_0001032_10737_11081 114
383 3300046514 Ga0495618_0001122 Ga0495618_0001122_7204_7548 114
384 3300046516 Ga0495628_0000025 Ga0495628_0000025_66965_67309 114
385 3300046517 Ga0495630_0438574 Ga0495630_0438574_552_896 114
386 3300046529 Ga0495652_0000088 Ga0495652_0000088_88307_88651 114
387 3300046536 Ga0495587_0000502 Ga0495587_0000502_10474_10818 114
388 3300046543 Ga0495645_0000024 Ga0495645_0000024_88282_88626 114
389 3300046559 Ga0495667_0024487 Ga0495667_0024487_1795_2139 114
390 3300046675 Ga0495657_0013000 Ga0495657_0013000_2657_3001 114
391 3300046678 Ga0495599_0000019 Ga0495599_0000019_74167_74511 114
392 3300046679 Ga0495623_0000032 Ga0495623_0000032_32628_32972 114
393 3300046680 Ga0495646_0001414 Ga0495646_0001414_6304_6648 114
394 3300046809 Ga0495600_0083361 Ga0495600_0083361_1318_1662 114
395 3300047317 Ga0495604_0000476 Ga0495604_0000476_24725_25069 114
396 3300047319 Ga0495674_0118913 Ga0495674_0118913_1339_1683 114
397 3300047322 Ga0495680_0017550 Ga0495680_0017550_4524_4868 114
398 3300047444 Ga0495675_0000007 Ga0495675_0000007_74010_74354 114
399 3300048088 Ga0495602_0000246 Ga0495602_0000246_41899_42243 114
400 3300048912 Ga0496109_0272796 Ga0496109_0272796_740_1084 114
401 3300048915 Ga0496112_0137327 Ga0496112_0137327_966_1310 114
402 3300048916 Ga0496113_0769184 Ga0496113_0769184_155_499 114
403 3300049581 Ga0501047_0024077 Ga0501047_0024077_1988_2332 114
404 3300049583 Ga0501067_0015229 Ga0501067_0015229_385_729 114
405 3300049583 Ga0501067_0273767 Ga0501067_0273767_57_401 114
406 3300049583 Ga0501067_0297905 Ga0501067_0297905_501_845 114
407 3300049585 Ga0501069_0047083 Ga0501069_0047083_213_557 114
408 3300049585 Ga0501069_0060287 Ga0501069_0060287_1388_1732 114
409 3300049586 Ga0501070_0159954 Ga0501070_0159954_465_809 114
410 3300049823 Ga0501044_0277633 Ga0501044_0277633_809_1153 114
411 3300053077 Ga0495601_0000325 Ga0495601_0000325_16462_16806 114
412 3300053078 Ga0495612_0012878 Ga0495612_0012878_2392_2736 114
413 3300053084 Ga0495595_0033773 Ga0495595_0033773_171_515 114
414 3300053085 Ga0495619_0001347 Ga0495619_0001347_8503_8847 114

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00420

Oxidored_q2

NADH-ubiquinone/plastoquinone oxidoreductase chain 4L

4

87

0.95

Feature Viewer

pLDDT pTM Quality
65.16 0.46 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map