F438295

General Info

Members Datasets Scaffolds Average Seq Length
414 239 828 137

Family's Representative Sequence

Representative Sequence 3300007076|Ga0075435_100718705|Ga0075435_1007187051
Length 154
Sequence MREKVTLNSSGQREDALSDQRYELQPIGWVESPLVDRAVAPRQGNEGAPEAWLVFDARFSEGLRDLRVGDEVIVLTWLDRARRDVLVVHPRGDPANPLQGVFNTRSPDRPNPIGLHRVRILVIQGTRIRVSDLEALDRTPIVDVKPVLDRRIER

Samples

Sample ID Description Type Environment
1 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
160 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
161 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
162 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
166 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
173 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
174 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
175 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
176 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
177 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
178 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
179 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
182 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
183 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
213 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
214 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
215 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
219 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
220 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
221 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
224 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
228 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
231 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
232 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
233 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
234 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
235 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
236 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
237 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
238 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
239 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.52
Metatranscriptomes 0
Isolates 0.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.49
Rhizosphere 91.06
Stem 0
Stem Tuber 0
Unclassified 14.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075435_100718705 3300007076 Bacteria 868
2 JGI24743J22301_10082963 3300001991 Bacteria 678
3 JGI25406J46586_10141933 3300003203 Bacteria 702
4 JGI25406J46586_10161378 3300003203 Bacteria 654
5 JGI25407J50210_10020186 3300003373 Bacteria 1733
6 Ga0070690_100010457 3300005330 Bacteria 5402
7 Ga0068869_100031124 3300005334 Bacteria 3753
8 Ga0070666_10402952 3300005335 Bacteria 984
9 Ga0070666_10769131 3300005335 Bacteria 708
10 Ga0070680_100096648 3300005336 Unclassified 2449
11 Ga0070680_100393056 3300005336 Bacteria 1181
12 Ga0070682_100081216 3300005337 Bacteria 2098
13 Ga0068868_100179558 3300005338 Bacteria 1755
14 Ga0068868_100204309 3300005338 Unclassified 1648
15 Ga0068868_100994558 3300005338 Bacteria 767
16 Ga0070689_100107802 3300005340 Unclassified 2212
17 Ga0070691_10079962 3300005341 Unclassified 1599
18 Ga0070687_100024402 3300005343 Bacteria 2887
19 Ga0070687_100049676 3300005343 Bacteria 2163
20 Ga0070687_100847266 3300005343 Bacteria 651
21 Ga0070692_10171011 3300005345 Unclassified 1253
22 Ga0070668_100258706 3300005347 Bacteria 1447
23 Ga0070668_100443582 3300005347 Bacteria 1115
24 Ga0070669_100209553 3300005353 Bacteria 1537
25 Ga0070669_100944772 3300005353 Unclassified 738
26 Ga0070675_100782397 3300005354 Bacteria 872
27 Ga0070671_100069172 3300005355 Bacteria 2944
28 Ga0070671_101034880 3300005355 Bacteria 720
29 Ga0070671_101322071 3300005355 Bacteria 636
30 Ga0070674_100277676 3300005356 Bacteria 1327
31 Ga0070674_101000882 3300005356 Bacteria 733
32 Ga0070673_100025887 3300005364 Bacteria 4325
33 Ga0070688_100434502 3300005365 Bacteria 978
34 Ga0070688_100551869 3300005365 Unclassified 876
35 Ga0070659_100010872 3300005366 Bacteria 6711
36 Ga0070703_10036738 3300005406 Bacteria 1507
37 Ga0070709_10125796 3300005434 Bacteria 1744
38 Ga0070714_100020983 3300005435 Bacteria 5341
39 Ga0070713_101022624 3300005436 Bacteria 797
40 Ga0070701_10017374 3300005438 Bacteria 3361
41 Ga0070701_10270471 3300005438 Bacteria 1034
42 Ga0070711_100043557 3300005439 Bacteria 3040
43 Ga0070705_100026741 3300005440 Bacteria 3143
44 Ga0070705_100164063 3300005440 Bacteria 1488
45 Ga0070705_101928287 3300005440 Bacteria 503
46 Ga0070700_100031118 3300005441 Bacteria 3195
47 Ga0070700_100346381 3300005441 Bacteria 1100
48 Ga0070700_100367542 3300005441 Bacteria 1071
49 Ga0070694_100029081 3300005444 Bacteria 3604
50 Ga0070694_100041094 3300005444 Bacteria 3083
51 Ga0070694_100123764 3300005444 Unclassified 1859
52 Ga0070694_100913707 3300005444 Bacteria 725
53 Ga0070708_100043132 3300005445 Bacteria 3963
54 Ga0070708_100200404 3300005445 Unclassified 1868
55 Ga0070708_100227428 3300005445 Bacteria 1750
56 Ga0070708_100450046 3300005445 Bacteria 1215
57 Ga0070663_100015150 3300005455 Bacteria 4967
58 Ga0070663_101085953 3300005455 Bacteria 699
59 Ga0070678_100379713 3300005456 Unclassified 1222
60 Ga0070678_101503144 3300005456 Bacteria 631
61 Ga0070662_100207352 3300005457 Bacteria 1558
62 Ga0070681_10116845 3300005458 Unclassified 2604
63 Ga0068867_100224684 3300005459 Unclassified 1515
64 Ga0068867_100480620 3300005459 Bacteria 1064
65 Ga0070685_10683496 3300005466 Unclassified 747
66 Ga0070706_100183113 3300005467 Unclassified 1956
67 Ga0070699_100123364 3300005518 Bacteria 2279
68 Ga0070699_100225805 3300005518 Bacteria 1669
69 Ga0070699_101284157 3300005518 Bacteria 671
70 Ga0070679_100000156 3300005530 Bacteria 55265
71 Ga0070684_100163436 3300005535 Bacteria 2020
72 Ga0070684_100340065 3300005535 Bacteria 1380
73 Ga0070684_100758974 3300005535 Bacteria 906
74 Ga0070697_100190769 3300005536 Unclassified 1739
75 Ga0070697_100260240 3300005536 Bacteria 1485
76 Ga0070697_100296863 3300005536 Bacteria 1389
77 Ga0070697_100701391 3300005536 Bacteria 893
78 Ga0068853_100055662 3300005539 Bacteria 3409
79 Ga0068853_101097691 3300005539 Bacteria 767
80 Ga0070686_101758628 3300005544 Bacteria 527
81 Ga0070695_100012773 3300005545 Bacteria 5041
82 Ga0070696_100097053 3300005546 Bacteria 2107
83 Ga0070696_100180358 3300005546 Bacteria 1566
84 Ga0070696_100309450 3300005546 Bacteria 1212
85 Ga0070693_100023417 3300005547 Bacteria 3300
86 Ga0070665_100962947 3300005548 Bacteria 866
87 Ga0070704_100028426 3300005549 Bacteria 3720
88 Ga0070704_101108586 3300005549 Bacteria 719
89 Ga0068855_100057373 3300005563 Bacteria 4564
90 Ga0070664_100305470 3300005564 Bacteria 1438
91 Ga0068854_100033768 3300005578 Bacteria 3568
92 Ga0068854_100107534 3300005578 Bacteria 2100
93 Ga0068854_100524322 3300005578 Bacteria 1001
94 Ga0068856_100066407 3300005614 Bacteria 3564
95 Ga0068856_100095668 3300005614 Bacteria 2958
96 Ga0070702_100037279 3300005615 Bacteria 2699
97 Ga0070702_100096976 3300005615 Bacteria 1800
98 Ga0068859_100186871 3300005617 Bacteria 2156
99 Ga0068864_100259048 3300005618 Bacteria 1617
100 Ga0068866_10011527 3300005718 Bacteria 3827
101 Ga0068866_10108602 3300005718 Bacteria 1544
102 Ga0068861_100073590 3300005719 Bacteria 2655
103 Ga0068851_10445618 3300005834 Bacteria 769
104 Ga0068870_10133799 3300005840 Unclassified 1443
105 Ga0068870_10278003 3300005840 Bacteria 1048
106 Ga0068863_100071993 3300005841 Unclassified 3270
107 Ga0068858_100117782 3300005842 Bacteria 2482
108 Ga0068862_100112624 3300005844 Bacteria 2390
109 Ga0068862_100392773 3300005844 Bacteria 1296
110 Ga0068862_101092415 3300005844 Bacteria 792
111 Ga0081538_10000265 3300005981 Bacteria 59857
112 Ga0081538_10027560 3300005981 Bacteria 3936
113 Ga0081538_10228564 3300005981 Bacteria 729
114 Ga0081540_1025537 3300005983 Bacteria 3396
115 Ga0081539_10007970 3300005985 Bacteria 9418
116 Ga0081539_10012534 3300005985 Bacteria 6517
117 Ga0070717_10061561 3300006028 Bacteria 3110
118 Ga0075432_10388503 3300006058 Bacteria 600
119 Ga0070715_10005829 3300006163 Bacteria 4146
120 Ga0070716_100246531 3300006173 Bacteria 1214
121 Ga0070716_100476738 3300006173 Bacteria 915
122 Ga0097621_100564909 3300006237 Unclassified 1037
123 Ga0068871_100217407 3300006358 Bacteria 1654
124 Ga0075428_100034635 3300006844 Bacteria 5568
125 Ga0075428_100257905 3300006844 Bacteria 1878
126 Ga0075428_100420403 3300006844 Bacteria 1432
127 Ga0075430_101096770 3300006846 Bacteria 656
128 Ga0075433_10093291 3300006852 Bacteria 2663
129 Ga0075434_100000022 3300006871 Bacteria 68968
130 Ga0075434_100004935 3300006871 Bacteria 12094
131 Ga0075434_100056331 3300006871 Bacteria 3907
132 Ga0075434_100068831 3300006871 Bacteria 3527
133 Ga0068865_100340861 3300006881 Bacteria 1211
134 Ga0068865_100946063 3300006881 Bacteria 752
135 Ga0075436_100001549 3300006914 Bacteria 15697
136 Ga0075436_100015870 3300006914 Bacteria 5156
137 Ga0075436_100058575 3300006914 Bacteria 2660
138 Ga0075436_100526453 3300006914 Unclassified 866
139 Ga0075436_100911619 3300006914 Bacteria 657
140 Ga0097620_100186880 3300006931 Bacteria 2156
141 Ga0075435_100000010 3300007076 Bacteria 112658
142 Ga0075435_100025480 3300007076 Bacteria 4605
143 Ga0075435_100034092 3300007076 Bacteria 4030
144 Ga0105240_10559379 3300009093 Bacteria 1264
145 Ga0105240_11518593 3300009093 Bacteria 702
146 Ga0111539_10152677 3300009094 Bacteria 2703
147 Ga0111539_10676999 3300009094 Bacteria 1201
148 Ga0111539_10716057 3300009094 Bacteria 1165
149 Ga0105245_10038876 3300009098 Bacteria 4234
150 Ga0105245_10173003 3300009098 Bacteria 2057
151 Ga0105247_10050650 3300009101 Bacteria 2556
152 Ga0114129_10003149 3300009147 Bacteria 23158
153 Ga0114129_10037213 3300009147 Bacteria 6871
154 Ga0114129_10469952 3300009147 Bacteria 1647
155 Ga0114129_10582628 3300009147 Unclassified 1451
156 Ga0114129_12365325 3300009147 Bacteria 637
157 Ga0105243_10018301 3300009148 Bacteria 5304
158 Ga0105243_10067909 3300009148 Bacteria 2872
159 Ga0105243_10122510 3300009148 Unclassified 2195
160 Ga0105243_10565515 3300009148 Bacteria 1089
161 Ga0105242_10018823 3300009176 Bacteria 5406
162 Ga0105238_10217699 3300009551 Bacteria 1886
163 Ga0105238_12563623 3300009551 Bacteria 546
164 Ga0105249_10079801 3300009553 Bacteria 3039
165 Ga0105249_10191556 3300009553 Bacteria 1996
166 Ga0105249_10195441 3300009553 Bacteria 1977
167 Ga0105249_10866237 3300009553 Bacteria 969
168 Ga0105239_10029683 3300010375 Bacteria 6013
169 Ga0105239_10573847 3300010375 Bacteria 1285
170 Ga0105246_10028143 3300011119 Unclassified 3690
171 Ga0157370_10061487 3300013104 Bacteria 3565
172 Ga0157369_10129645 3300013105 Bacteria 2673
173 Ga0157374_10716875 3300013296 Bacteria 1014
174 Ga0163162_10110540 3300013306 Bacteria 2845
175 Ga0163162_10164752 3300013306 Bacteria 2340
176 Ga0157372_10036631 3300013307 Bacteria 5408
177 Ga0157372_11526920 3300013307 Bacteria 769
178 Ga0157375_10310418 3300013308 Bacteria 1741
179 Ga0157375_10707883 3300013308 Unclassified 1160
180 Ga0157380_10008754 3300014326 Bacteria 7229
181 Ga0157380_11717496 3300014326 Bacteria 685
182 Ga0157377_10040386 3300014745 Bacteria 2583
183 Ga0157377_10114243 3300014745 Unclassified 1627
184 Ga0157379_10049173 3300014968 Bacteria 3764
185 Ga0157376_10129439 3300014969 Bacteria 2250
186 Ga0163161_10168320 3300017792 Bacteria 1674
187 Ga0213876_10061993 3300021384 Bacteria 1973
188 Ga0213875_10073734 3300021388 Bacteria 1592
189 Ga0207656_10155123 3300025321 Unclassified 1086
190 Ga0207653_10008219 3300025885 Bacteria 3253
191 Ga0207642_10198657 3300025899 Bacteria 1106
192 Ga0207688_10000555 3300025901 Bacteria 18211
193 Ga0207647_10057091 3300025904 Bacteria 2394
194 Ga0207647_10148960 3300025904 Unclassified 1368
195 Ga0207699_10057176 3300025906 Bacteria 2328
196 Ga0207645_10378424 3300025907 Bacteria 950
197 Ga0207643_10199297 3300025908 Bacteria 1218
198 Ga0207643_10248548 3300025908 Bacteria 1095
199 Ga0207684_10135138 3300025910 Unclassified 2117
200 Ga0207684_10473156 3300025910 Bacteria 1075
201 Ga0207684_10513907 3300025910 Bacteria 1026
202 Ga0207684_11106367 3300025910 Unclassified 659
203 Ga0207654_10190517 3300025911 Bacteria 1344
204 Ga0207707_10091914 3300025912 Bacteria 2652
205 Ga0207695_11315244 3300025913 Bacteria 603
206 Ga0207693_10009040 3300025915 Bacteria 8132
207 Ga0207660_10210971 3300025917 Bacteria 1521
208 Ga0207662_10010518 3300025918 Bacteria 5112
209 Ga0207662_10128419 3300025918 Bacteria 1596
210 Ga0207662_10738900 3300025918 Bacteria 691
211 Ga0207652_10000119 3300025921 Bacteria 86757
212 Ga0207646_10004538 3300025922 Bacteria 15034
213 Ga0207681_10065524 3300025923 Bacteria 2512
214 Ga0207659_10125975 3300025926 Bacteria 1970
215 Ga0207687_10000012 3300025927 Bacteria 370729
216 Ga0207687_10052894 3300025927 Unclassified 2835
217 Ga0207687_10620759 3300025927 Bacteria 913
218 Ga0207664_10033765 3300025929 Bacteria 3935
219 Ga0207664_10124382 3300025929 Bacteria 2163
220 Ga0207644_11122607 3300025931 Bacteria 661
221 Ga0207690_10868976 3300025932 Bacteria 747
222 Ga0207690_11721311 3300025932 Unclassified 524
223 Ga0207706_10061350 3300025933 Unclassified 3311
224 Ga0207686_10485341 3300025934 Bacteria 956
225 Ga0207709_10331324 3300025935 Bacteria 1143
226 Ga0207709_10545263 3300025935 Unclassified 911
227 Ga0207669_10377344 3300025937 Unclassified 1104
228 Ga0207669_10503790 3300025937 Bacteria 969
229 Ga0207704_10112106 3300025938 Bacteria 1847
230 Ga0207665_10040524 3300025939 Bacteria 3108
231 Ga0207691_10379073 3300025940 Unclassified 1208
232 Ga0207711_10095255 3300025941 Unclassified 2625
233 Ga0207689_10022475 3300025942 Bacteria 5303
234 Ga0207689_10041999 3300025942 Bacteria 3784
235 Ga0207661_10114731 3300025944 Bacteria 2284
236 Ga0207661_10634009 3300025944 Bacteria 982
237 Ga0207679_10129061 3300025945 Unclassified 2025
238 Ga0207667_10050674 3300025949 Bacteria 4379
239 Ga0207712_10014561 3300025961 Bacteria 5064
240 Ga0207712_10197674 3300025961 Bacteria 1592
241 Ga0207712_10538035 3300025961 Bacteria 1003
242 Ga0207668_10029967 3300025972 Bacteria 3572
243 Ga0207668_10638456 3300025972 Bacteria 931
244 Ga0207668_10911495 3300025972 Bacteria 783
245 Ga0207640_10198476 3300025981 Unclassified 1518
246 Ga0207640_10242243 3300025981 Bacteria 1394
247 Ga0207703_10314899 3300026035 Unclassified 1431
248 Ga0207703_10799877 3300026035 Bacteria 900
249 Ga0207639_10112528 3300026041 Bacteria 2221
250 Ga0207678_10003052 3300026067 Bacteria 15144
251 Ga0207708_10194213 3300026075 Unclassified 1617
252 Ga0207708_10217969 3300026075 Bacteria 1528
253 Ga0207708_10227291 3300026075 Bacteria 1497
254 Ga0207708_10257697 3300026075 Bacteria 1407
255 Ga0207708_11219429 3300026075 Bacteria 658
256 Ga0207702_10198615 3300026078 Bacteria 1858
257 Ga0207702_10539321 3300026078 Bacteria 1140
258 Ga0207648_10437979 3300026089 Unclassified 1188
259 Ga0207674_10289100 3300026116 Bacteria 1588
260 Ga0207675_100042324 3300026118 Bacteria 4252
261 Ga0207675_100092364 3300026118 Bacteria 2846
262 Ga0207675_100277839 3300026118 Bacteria 1627
263 Ga0207675_100297459 3300026118 Bacteria 1571
264 Ga0207683_10005566 3300026121 Bacteria 10793
265 Ga0207683_10197033 3300026121 Bacteria 1830
266 Ga0207683_10351035 3300026121 Unclassified 1354
267 Ga0207428_10090682 3300027907 Bacteria 2374
268 Ga0268266_12034155 3300028379 Bacteria 548
269 Ga0268265_10168580 3300028380 Bacteria 1869
270 Ga0268265_10783143 3300028380 Bacteria 928
271 Ga0268264_10256539 3300028381 Bacteria 1627
272 Ga0307409_101036096 3300031995 Bacteria 840
273 Ga0307416_100855960 3300032002 Bacteria 1007
274 Ga0307415_100114714 3300032126 Bacteria 2006
275 Ga0307415_101260646 3300032126 Bacteria 699
276 Ga0373940_0117845 3300035088 Bacteria 821
277 Ga0373941_0031796 3300035115 Bacteria 1575
278 Ga0373961_0043172 3300035241 Bacteria 1310
279 Ga0373962_0129410 3300035242 Bacteria 811
280 Ga0373931_0038626 3300035691 Bacteria 2498
281 Ga0373947_0438811 3300035725 Bacteria 884
282 Ga0395899_0414654 3300037312 Unclassified 888
283 Ga0395900_0619172 3300037418 Bacteria 1021
284 Ga0395905_1175782 3300037471 Unclassified 670
285 Ga0436364_0327311 3300037853 Bacteria 10539
286 Ga0395901_1161672 3300038443 Unclassified 739
287 Ga0242420_108206 3300038996 Bacteria 597
288 Ga0436365_0858607 3300039437 Bacteria 13580
289 Ga0436362_1048143 3300039453 Unclassified 698
290 Ga0451802_1287740 3300041460 Bacteria 1181
291 Ga0451853_1635972 3300041512 Bacteria 3556
292 Ga0451577_0075570 3300042876 Bacteria 3004
293 Ga0466965_0042834 3300044683 Bacteria 2234
294 Ga0466968_0137442 3300044735 Bacteria 1115
295 Ga0466957_0652543 3300044842 Bacteria 740
296 Ga0466959_0227421 3300045049 Bacteria 1292
297 Ga0466959_0901811 3300045049 Unclassified 590
298 Ga0466967_0861192 3300045976 Bacteria 901
299 Ga0495590_0194432 3300046457 Bacteria 744
300 Ga0495658_0400555 3300046683 Bacteria 875
301 Ga0495672_0002923 3300047320 Bacteria 15089
302 Ga0496100_0030879 3300048903 Bacteria 3327
303 Ga0496100_0324158 3300048903 Unclassified 1158
304 Ga0496101_0141126 3300048904 Unclassified 1836
305 Ga0496101_0649528 3300048904 Bacteria 833
306 Ga0496102_0015380 3300048905 Bacteria 6665
307 Ga0496102_0032891 3300048905 Bacteria 4660
308 Ga0496103_0215776 3300048906 Unclassified 1234
309 Ga0496104_0021550 3300048907 Bacteria 5918
310 Ga0496104_0184769 3300048907 Unclassified 1995
311 Ga0496104_0997845 3300048907 Bacteria 741
312 Ga0496105_0095927 3300048908 Bacteria 2449
313 Ga0496105_0358906 3300048908 Bacteria 1163
314 Ga0496106_0021840 3300048909 Bacteria 4753
315 Ga0496107_0139227 3300048910 Bacteria 1794
316 Ga0496107_0292670 3300048910 Unclassified 1212
317 Ga0496108_0001964 3300048911 Bacteria 16463
318 Ga0496108_0014582 3300048911 Bacteria 6415
319 Ga0496109_0032082 3300048912 Bacteria 4718
320 Ga0496109_0059109 3300048912 Bacteria 3502
321 Ga0496109_0525501 3300048912 Bacteria 1117
322 Ga0496110_0003297 3300048913 Bacteria 12320
323 Ga0496110_0862247 3300048913 Bacteria 811
324 Ga0496111_0010109 3300048914 Bacteria 6317
325 Ga0496111_0376795 3300048914 Unclassified 1050
326 Ga0496112_0134178 3300048915 Bacteria 2446
327 Ga0496112_0245483 3300048915 Unclassified 1742
328 Ga0496113_0005502 3300048916 Bacteria 7906
329 Ga0496114_0009705 3300048917 Bacteria 7646
330 Ga0496115_0046108 3300048918 Bacteria 3482
331 Ga0496115_0307708 3300048918 Bacteria 1298
332 Ga0501031_0186051 3300049568 Bacteria 1356
333 Ga0501031_0269152 3300049568 Bacteria 1106
334 Ga0501034_0772396 3300049571 Bacteria 855
335 Ga0501036_0065881 3300049572 Bacteria 3065
336 Ga0501036_0864420 3300049572 Bacteria 743
337 Ga0501037_0483611 3300049573 Bacteria 841
338 Ga0501038_0426708 3300049574 Bacteria 1022
339 Ga0501039_0015240 3300049575 Bacteria 5883
340 Ga0501039_0205768 3300049575 Bacteria 1547
341 Ga0501039_0855667 3300049575 Bacteria 708
342 Ga0501040_0018329 3300049576 Bacteria 4646
343 Ga0501041_0242175 3300049577 Bacteria 1133
344 Ga0501041_0283151 3300049577 Bacteria 1043
345 Ga0501042_0016168 3300049578 Bacteria 5118
346 Ga0501042_0100258 3300049578 Bacteria 2082
347 Ga0501042_0105989 3300049578 Bacteria 2023
348 Ga0501042_1352439 3300049578 Bacteria 519
349 Ga0501043_0195484 3300049579 Bacteria 1572
350 Ga0501046_0253786 3300049580 Bacteria 1294
351 Ga0501048_0060711 3300049582 Bacteria 2679
352 Ga0501048_0517525 3300049582 Bacteria 856
353 Ga0501068_0288319 3300049584 Bacteria 1050
354 Ga0501070_0170136 3300049586 Bacteria 1795
355 Ga0501071_0200313 3300049587 Bacteria 1499
356 Ga0501071_0239256 3300049587 Bacteria 1369
357 Ga0501072_0033562 3300049588 Bacteria 4022
358 Ga0501072_0152965 3300049588 Bacteria 1839
359 Ga0501072_0277825 3300049588 Bacteria 1332
360 Ga0501073_0154093 3300049589 Bacteria 1593
361 Ga0501074_0121243 3300049590 Bacteria 1870
362 Ga0501074_0251425 3300049590 Bacteria 1257
363 Ga0501075_0035465 3300049591 Bacteria 3720
364 Ga0501075_0048556 3300049591 Bacteria 3189
365 Ga0501075_0484721 3300049591 Bacteria 943
366 Ga0501076_0013300 3300049592 Bacteria 6172
367 Ga0501076_0567184 3300049592 Bacteria 936
368 Ga0501077_0018185 3300049593 Bacteria 4445
369 Ga0501077_0549589 3300049593 Bacteria 741
370 Ga0501079_0068830 3300049741 Bacteria 2732
371 Ga0501079_0441110 3300049741 Bacteria 1022
372 Ga0501080_0432882 3300049742 Bacteria 1181
373 Ga0501081_0043488 3300049743 Bacteria 3082
374 Ga0501081_0061485 3300049743 Bacteria 2604
375 Ga0501035_0271229 3300049822 Bacteria 1436
376 Ga0501035_0287560 3300049822 Bacteria 1388
377 Ga0501035_0713822 3300049822 Bacteria 808
378 Ga0501044_0652280 3300049823 Bacteria 941
379 Ga0501044_0972591 3300049823 Bacteria 721
380 nmdc:mga05p37_1112579_c1 3300050507 Bacteria 826
381 nmdc:mga05p37_1202051_c1 3300050507 Bacteria 783
382 nmdc:mga05p37_123943_c1 3300050507 Bacteria 3174
383 nmdc:mga05p37_13018_c1 3300050507 Bacteria 9954
384 nmdc:mga05p37_866992_c1 3300050507 Bacteria 978
385 nmdc:mga09592_1128031_c1 3300050508 Bacteria 651
386 nmdc:mga09592_547134_c1 3300050508 Unclassified 994
387 nmdc:mga06r32_1633994_c1 3300050510 Unclassified 582
388 nmdc:mga08y16_182513_c1 3300050511 Bacteria 2178
389 nmdc:mga0n895_168134_c1 3300050512 Bacteria 2225
390 nmdc:mga0n895_203230_c1 3300050512 Bacteria 2012
391 nmdc:mga0n895_38968_c1 3300050512 Bacteria 4608
392 nmdc:mga0n895_48_c1 3300050512 Bacteria 73654
393 nmdc:mga0n895_599985_c1 3300050512 Bacteria 1103
394 nmdc:mga0rr50_10836_c1 3300050513 Bacteria 5812
395 nmdc:mga0rr50_1357589_c1 3300050513 Unclassified 602
396 nmdc:mga0rr50_154483_c1 3300050513 Bacteria 1858
397 nmdc:mga0rr50_18_c1 3300050513 Bacteria 166751
398 nmdc:mga0rr50_191326_c1 3300050513 Unclassified 1677
399 nmdc:mga08x19_143_c1 3300050514 Bacteria 62934
400 nmdc:mga08x19_232683_c1 3300050514 Bacteria 1269
401 nmdc:mga08x19_26039_c1 3300050514 Bacteria 3648
402 nmdc:mga08x19_713886_c1 3300050514 Unclassified 712
403 nmdc:mga08x19_77295_c1 3300050514 Bacteria 2180
404 nmdc:mga0a205_236701_c1 3300050515 Bacteria 1708
405 nmdc:mga0a205_259360_c1 3300050515 Bacteria 1616
406 nmdc:mga0a205_273923_c1 3300050515 Bacteria 1564
407 Ga0501084_0047849 3300054114 Bacteria 3581
408 Ga0501084_0664959 3300054114 Bacteria 879
409 Ga0590075_077343 3300059424 Bacteria 861
410 Ga0501082_0024041 3300060353 Bacteria 5255
411 Ga0501082_0102473 3300060353 Bacteria 2476
412 Ga0530510_0045683 3300061734 Bacteria 3164
413 8003874745 8003870546 Bacteria 7396674
414 8055181341 8055172936 Bacteria 9305943
415 Ga0075435_100718705
416 JGI24743J22301_10082963
417 JGI25406J46586_10141933
418 JGI25406J46586_10161378
419 JGI25407J50210_10020186
420 Ga0070690_100010457
421 Ga0068869_100031124
422 Ga0070666_10402952
423 Ga0070666_10769131
424 Ga0070680_100096648
425 Ga0070680_100393056
426 Ga0070682_100081216
427 Ga0068868_100179558
428 Ga0068868_100204309
429 Ga0068868_100994558
430 Ga0070689_100107802
431 Ga0070691_10079962
432 Ga0070687_100024402
433 Ga0070687_100049676
434 Ga0070687_100847266
435 Ga0070692_10171011
436 Ga0070668_100258706
437 Ga0070668_100443582
438 Ga0070669_100209553
439 Ga0070669_100944772
440 Ga0070675_100782397
441 Ga0070671_100069172
442 Ga0070671_101034880
443 Ga0070671_101322071
444 Ga0070674_100277676
445 Ga0070674_101000882
446 Ga0070673_100025887
447 Ga0070688_100434502
448 Ga0070688_100551869
449 Ga0070659_100010872
450 Ga0070703_10036738
451 Ga0070709_10125796
452 Ga0070714_100020983
453 Ga0070713_101022624
454 Ga0070701_10017374
455 Ga0070701_10270471
456 Ga0070711_100043557
457 Ga0070705_100026741
458 Ga0070705_100164063
459 Ga0070705_101928287
460 Ga0070700_100031118
461 Ga0070700_100346381
462 Ga0070700_100367542
463 Ga0070694_100029081
464 Ga0070694_100041094
465 Ga0070694_100123764
466 Ga0070694_100913707
467 Ga0070708_100043132
468 Ga0070708_100200404
469 Ga0070708_100227428
470 Ga0070708_100450046
471 Ga0070663_100015150
472 Ga0070663_101085953
473 Ga0070678_100379713
474 Ga0070678_101503144
475 Ga0070662_100207352
476 Ga0070681_10116845
477 Ga0068867_100224684
478 Ga0068867_100480620
479 Ga0070685_10683496
480 Ga0070706_100183113
481 Ga0070699_100123364
482 Ga0070699_100225805
483 Ga0070699_101284157
484 Ga0070679_100000156
485 Ga0070684_100163436
486 Ga0070684_100340065
487 Ga0070684_100758974
488 Ga0070697_100190769
489 Ga0070697_100260240
490 Ga0070697_100296863
491 Ga0070697_100701391
492 Ga0068853_100055662
493 Ga0068853_101097691
494 Ga0070686_101758628
495 Ga0070695_100012773
496 Ga0070696_100097053
497 Ga0070696_100180358
498 Ga0070696_100309450
499 Ga0070693_100023417
500 Ga0070665_100962947
501 Ga0070704_100028426
502 Ga0070704_101108586
503 Ga0068855_100057373
504 Ga0070664_100305470
505 Ga0068854_100033768
506 Ga0068854_100107534
507 Ga0068854_100524322
508 Ga0068856_100066407
509 Ga0068856_100095668
510 Ga0070702_100037279
511 Ga0070702_100096976
512 Ga0068859_100186871
513 Ga0068864_100259048
514 Ga0068866_10011527
515 Ga0068866_10108602
516 Ga0068861_100073590
517 Ga0068851_10445618
518 Ga0068870_10133799
519 Ga0068870_10278003
520 Ga0068863_100071993
521 Ga0068858_100117782
522 Ga0068862_100112624
523 Ga0068862_100392773
524 Ga0068862_101092415
525 Ga0081538_10000265
526 Ga0081538_10027560
527 Ga0081538_10228564
528 Ga0081540_1025537
529 Ga0081539_10007970
530 Ga0081539_10012534
531 Ga0070717_10061561
532 Ga0075432_10388503
533 Ga0070715_10005829
534 Ga0070716_100246531
535 Ga0070716_100476738
536 Ga0097621_100564909
537 Ga0068871_100217407
538 Ga0075428_100034635
539 Ga0075428_100257905
540 Ga0075428_100420403
541 Ga0075430_101096770
542 Ga0075433_10093291
543 Ga0075434_100000022
544 Ga0075434_100004935
545 Ga0075434_100056331
546 Ga0075434_100068831
547 Ga0068865_100340861
548 Ga0068865_100946063
549 Ga0075436_100001549
550 Ga0075436_100015870
551 Ga0075436_100058575
552 Ga0075436_100526453
553 Ga0075436_100911619
554 Ga0097620_100186880
555 Ga0075435_100000010
556 Ga0075435_100025480
557 Ga0075435_100034092
558 Ga0105240_10559379
559 Ga0105240_11518593
560 Ga0111539_10152677
561 Ga0111539_10676999
562 Ga0111539_10716057
563 Ga0105245_10038876
564 Ga0105245_10173003
565 Ga0105247_10050650
566 Ga0114129_10003149
567 Ga0114129_10037213
568 Ga0114129_10469952
569 Ga0114129_10582628
570 Ga0114129_12365325
571 Ga0105243_10018301
572 Ga0105243_10067909
573 Ga0105243_10122510
574 Ga0105243_10565515
575 Ga0105242_10018823
576 Ga0105238_10217699
577 Ga0105238_12563623
578 Ga0105249_10079801
579 Ga0105249_10191556
580 Ga0105249_10195441
581 Ga0105249_10866237
582 Ga0105239_10029683
583 Ga0105239_10573847
584 Ga0105246_10028143
585 Ga0157370_10061487
586 Ga0157369_10129645
587 Ga0157374_10716875
588 Ga0163162_10110540
589 Ga0163162_10164752
590 Ga0157372_10036631
591 Ga0157372_11526920
592 Ga0157375_10310418
593 Ga0157375_10707883
594 Ga0157380_10008754
595 Ga0157380_11717496
596 Ga0157377_10040386
597 Ga0157377_10114243
598 Ga0157379_10049173
599 Ga0157376_10129439
600 Ga0163161_10168320
601 Ga0213876_10061993
602 Ga0213875_10073734
603 Ga0207656_10155123
604 Ga0207653_10008219
605 Ga0207642_10198657
606 Ga0207688_10000555
607 Ga0207647_10057091
608 Ga0207647_10148960
609 Ga0207699_10057176
610 Ga0207645_10378424
611 Ga0207643_10199297
612 Ga0207643_10248548
613 Ga0207684_10135138
614 Ga0207684_10473156
615 Ga0207684_10513907
616 Ga0207684_11106367
617 Ga0207654_10190517
618 Ga0207707_10091914
619 Ga0207695_11315244
620 Ga0207693_10009040
621 Ga0207660_10210971
622 Ga0207662_10010518
623 Ga0207662_10128419
624 Ga0207662_10738900
625 Ga0207652_10000119
626 Ga0207646_10004538
627 Ga0207681_10065524
628 Ga0207659_10125975
629 Ga0207687_10000012
630 Ga0207687_10052894
631 Ga0207687_10620759
632 Ga0207664_10033765
633 Ga0207664_10124382
634 Ga0207644_11122607
635 Ga0207690_10868976
636 Ga0207690_11721311
637 Ga0207706_10061350
638 Ga0207686_10485341
639 Ga0207709_10331324
640 Ga0207709_10545263
641 Ga0207669_10377344
642 Ga0207669_10503790
643 Ga0207704_10112106
644 Ga0207665_10040524
645 Ga0207691_10379073
646 Ga0207711_10095255
647 Ga0207689_10022475
648 Ga0207689_10041999
649 Ga0207661_10114731
650 Ga0207661_10634009
651 Ga0207679_10129061
652 Ga0207667_10050674
653 Ga0207712_10014561
654 Ga0207712_10197674
655 Ga0207712_10538035
656 Ga0207668_10029967
657 Ga0207668_10638456
658 Ga0207668_10911495
659 Ga0207640_10198476
660 Ga0207640_10242243
661 Ga0207703_10314899
662 Ga0207703_10799877
663 Ga0207639_10112528
664 Ga0207678_10003052
665 Ga0207708_10194213
666 Ga0207708_10217969
667 Ga0207708_10227291
668 Ga0207708_10257697
669 Ga0207708_11219429
670 Ga0207702_10198615
671 Ga0207702_10539321
672 Ga0207648_10437979
673 Ga0207674_10289100
674 Ga0207675_100042324
675 Ga0207675_100092364
676 Ga0207675_100277839
677 Ga0207675_100297459
678 Ga0207683_10005566
679 Ga0207683_10197033
680 Ga0207683_10351035
681 Ga0207428_10090682
682 Ga0268266_12034155
683 Ga0268265_10168580
684 Ga0268265_10783143
685 Ga0268264_10256539
686 Ga0307409_101036096
687 Ga0307416_100855960
688 Ga0307415_100114714
689 Ga0307415_101260646
690 Ga0373940_0117845
691 Ga0373941_0031796
692 Ga0373961_0043172
693 Ga0373962_0129410
694 Ga0373931_0038626
695 Ga0373947_0438811
696 Ga0395899_0414654
697 Ga0395900_0619172
698 Ga0395905_1175782
699 Ga0436364_0327311
700 Ga0395901_1161672
701 Ga0242420_108206
702 Ga0436365_0858607
703 Ga0436362_1048143
704 Ga0451802_1287740
705 Ga0451853_1635972
706 Ga0451577_0075570
707 Ga0466965_0042834
708 Ga0466968_0137442
709 Ga0466957_0652543
710 Ga0466959_0227421
711 Ga0466959_0901811
712 Ga0466967_0861192
713 Ga0495590_0194432
714 Ga0495658_0400555
715 Ga0495672_0002923
716 Ga0496100_0030879
717 Ga0496100_0324158
718 Ga0496101_0141126
719 Ga0496101_0649528
720 Ga0496102_0015380
721 Ga0496102_0032891
722 Ga0496103_0215776
723 Ga0496104_0021550
724 Ga0496104_0184769
725 Ga0496104_0997845
726 Ga0496105_0095927
727 Ga0496105_0358906
728 Ga0496106_0021840
729 Ga0496107_0139227
730 Ga0496107_0292670
731 Ga0496108_0001964
732 Ga0496108_0014582
733 Ga0496109_0032082
734 Ga0496109_0059109
735 Ga0496109_0525501
736 Ga0496110_0003297
737 Ga0496110_0862247
738 Ga0496111_0010109
739 Ga0496111_0376795
740 Ga0496112_0134178
741 Ga0496112_0245483
742 Ga0496113_0005502
743 Ga0496114_0009705
744 Ga0496115_0046108
745 Ga0496115_0307708
746 Ga0501031_0186051
747 Ga0501031_0269152
748 Ga0501034_0772396
749 Ga0501036_0065881
750 Ga0501036_0864420
751 Ga0501037_0483611
752 Ga0501038_0426708
753 Ga0501039_0015240
754 Ga0501039_0205768
755 Ga0501039_0855667
756 Ga0501040_0018329
757 Ga0501041_0242175
758 Ga0501041_0283151
759 Ga0501042_0016168
760 Ga0501042_0100258
761 Ga0501042_0105989
762 Ga0501042_1352439
763 Ga0501043_0195484
764 Ga0501046_0253786
765 Ga0501048_0060711
766 Ga0501048_0517525
767 Ga0501068_0288319
768 Ga0501070_0170136
769 Ga0501071_0200313
770 Ga0501071_0239256
771 Ga0501072_0033562
772 Ga0501072_0152965
773 Ga0501072_0277825
774 Ga0501073_0154093
775 Ga0501074_0121243
776 Ga0501074_0251425
777 Ga0501075_0035465
778 Ga0501075_0048556
779 Ga0501075_0484721
780 Ga0501076_0013300
781 Ga0501076_0567184
782 Ga0501077_0018185
783 Ga0501077_0549589
784 Ga0501079_0068830
785 Ga0501079_0441110
786 Ga0501080_0432882
787 Ga0501081_0043488
788 Ga0501081_0061485
789 Ga0501035_0271229
790 Ga0501035_0287560
791 Ga0501035_0713822
792 Ga0501044_0652280
793 Ga0501044_0972591
794 nmdc:mga05p37_1112579_c1
795 nmdc:mga05p37_1202051_c1
796 nmdc:mga05p37_123943_c1
797 nmdc:mga05p37_13018_c1
798 nmdc:mga05p37_866992_c1
799 nmdc:mga09592_1128031_c1
800 nmdc:mga09592_547134_c1
801 nmdc:mga06r32_1633994_c1
802 nmdc:mga08y16_182513_c1
803 nmdc:mga0n895_168134_c1
804 nmdc:mga0n895_203230_c1
805 nmdc:mga0n895_38968_c1
806 nmdc:mga0n895_48_c1
807 nmdc:mga0n895_599985_c1
808 nmdc:mga0rr50_10836_c1
809 nmdc:mga0rr50_1357589_c1
810 nmdc:mga0rr50_154483_c1
811 nmdc:mga0rr50_18_c1
812 nmdc:mga0rr50_191326_c1
813 nmdc:mga08x19_143_c1
814 nmdc:mga08x19_232683_c1
815 nmdc:mga08x19_26039_c1
816 nmdc:mga08x19_713886_c1
817 nmdc:mga08x19_77295_c1
818 nmdc:mga0a205_236701_c1
819 nmdc:mga0a205_259360_c1
820 nmdc:mga0a205_273923_c1
821 Ga0501084_0047849
822 Ga0501084_0664959
823 Ga0590075_077343
824 Ga0501082_0024041
825 Ga0501082_0102473
826 Ga0530510_0045683
827 8003874745
828 8055181341

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01980

TrmO

tRNA-methyltransferase O

39

151

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nv4-assembly1.cif.gz_B crystal structure of upf0066 protein af0241 in complex with s-adenosylmethionine. northeast structural genomics consortium target gr27 0.8784 6 135
2nv4-assembly1.cif.gz_B crystal structure of upf0066 protein af0241 in complex with s-adenosylmethionine. northeast structural genomics consortium target gr27 0.842 6 135
3okx-assembly1.cif.gz_B crystal structure of yaeb-like protein from rhodopseudomonas palustris 0.8179 2 131
3okx-assembly1.cif.gz_A crystal structure of yaeb-like protein from rhodopseudomonas palustris 0.814 2 131
7bu1-assembly1.cif.gz_A crystal structure of trmo from pseudomonas aeruginosa 0.8013 4 132
ID Description Score Start End Superfamily
2nv4B00 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.8763 7 135 2.40.30.70
af_Q58978_4_126_2.40.30.70 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.8554 8 135 2.40.30.70
af_A1Z759_99_248_2.40.30.70 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.8502 7 132 2.40.30.70
2nv4B00 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.8395 7 135 2.40.30.70
af_Q9BU70_29_181_2.40.30.70 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.8369 7 132 2.40.30.70
ID Description Score Start End GO Terms
AF-A0A127JRV9-F1-model_v4 Methyltransferase 0.9343 6 132 GO:0008168
GO:0032259
AF-A0A538A8W8-F1-model_v4 tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO 0.9326 4 132 GO:0008168
GO:0032259
AF-A0A0B1TZC9-F1-model_v4 TsaA-like domain-containing protein 0.9321 53 133
AF-A0A1J4SR65-F1-model_v4 tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO 0.9278 1 134 GO:0008168
GO:0032259
AF-F4CIV5-F1-model_v4 Uncharacterized protein family UPF0066 0.9274 2 132

Map