F438131

General Info

Members Datasets Scaffolds Average Seq Length
413 203 404 317

Family's Representative Sequence

Representative Sequence 3300046457|Ga0495590_0001791|Ga0495590_0001791_7557_8657
Length 366
Sequence MKYSQRVAVALILISLSKRQRKVESGHNRSYIDSIFSSAMYHPTTRVLALLELLQTHGRLGGAELSARLGVDRRTLRRYIGKLEDIGIPITAERGRAGGYALMPGFKLPPMMFTEDETLALSLGLLAARGLGLTEAAPAVASAQAKLERVMPDGLKRRVRAVDDTVRLDAARAAAPVDRQALSALTGAAQACRRVLLRYRDQRGDESARRFDAYGLAWRHGRWYVAGMCHLRHALRTFRLDRVTDVETLEEGFERPADFDPMAHVVQAIATLPRAFTIEVLLKTDVAVARAHLFAEAGVFEESAEGVVIHAQSDELDWFARQLAGMPFDFEIRRPPELHAAVGDCVRRLLRCSPASAWPDRHVTGV

Samples

Sample ID Description Type Environment
1 2643221645 Massilia sp. Root351 Isolate Unclassified
2 2643221664 Massilia sp. Root418 Isolate Unclassified
3 2738541280 Massilia sp. GV090 Isolate Unclassified
4 2738541300 Massilia sp. GV016 Isolate Unclassified
5 2738543018 Massilia sp. GV045 Isolate Unclassified
6 2738543030 Massilia sp. GV097 Isolate Unclassified
7 2818991436 Collimonas arenae 515 Isolate Unclassified
8 2842711865 Duganella sp. R-73148 Isolate Unclassified
9 2857558681 Duganella sp. R-74565 Isolate Unclassified
10 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
13 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
14 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
59 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
60 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
65 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
66 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
68 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
91 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
92 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
96 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
97 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
98 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
99 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
100 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
101 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
102 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
103 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
104 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
105 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
106 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
107 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
108 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
109 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
110 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
111 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
112 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
113 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
114 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
115 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
116 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
117 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
118 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
119 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
120 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
121 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
122 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
123 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
124 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
125 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
126 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
127 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
128 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
129 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
130 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
131 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
132 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
133 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
134 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
135 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
136 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
137 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
138 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
139 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
140 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
141 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
142 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
143 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
144 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
145 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
146 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
147 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
148 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
149 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
150 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
151 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
152 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
153 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
154 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
155 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
156 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
157 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
158 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
159 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
160 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
161 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
162 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
163 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
164 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
165 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
166 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
167 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
168 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
169 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
170 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
171 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
172 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
173 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
174 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
175 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
176 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
185 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
186 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
187 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
188 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
189 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
190 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
191 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
192 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
193 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
194 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
195 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
196 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
199 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
200 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
201 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
202 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
203 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.82
Metatranscriptomes 0
Isolates 2.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.93
Nodule 0.48
Rhizoplane 2.18
Rhizosphere 83.78
Stem 0
Stem Tuber 0
Unclassified 3.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000079 3300002737 Bacteria 115162
2 JGI25165J46597_1000135 3300003214 Bacteria 122924
3 Ga0055538_1000055 3300003751 Bacteria 122924
4 Ga0055539_1000080 3300003752 Bacteria 122924
5 Ga0055533_1000086 3300003756 Bacteria 122924
6 Ga0055525_1000114 3300003759 Bacteria 122924
7 Ga0055526_1000939 3300003771 Bacteria 21586
8 Ga0055537_1000400 3300003773 Bacteria 29070
9 Ga0055524_1000010 3300003775 Bacteria 282893
10 Ga0055534_1000139 3300003784 Bacteria 54768
11 Ga0055528_1000011 3300003790 Bacteria 218512
12 Ga0055541_1000057 3300003841 Bacteria 122924
13 Ga0065165_1023261 3300005262 Bacteria 2105
14 Ga0068868_100121752 3300005338 Bacteria 2129
15 Ga0070689_100011944 3300005340 Bacteria 6237
16 Ga0070687_100011479 3300005343 Bacteria 3877
17 Ga0070675_100040734 3300005354 Bacteria 3793
18 Ga0070688_100012865 3300005365 Bacteria 4702
19 Ga0070709_10000005 3300005434 Bacteria 197619
20 Ga0070700_100025988 3300005441 Bacteria 3452
21 Ga0070663_100031335 3300005455 Bacteria 3654
22 Ga0070662_100164290 3300005457 Bacteria 1739
23 Ga0068867_100014108 3300005459 Bacteria 5660
24 Ga0068857_100469809 3300005577 Bacteria 1178
25 Ga0068864_100108218 3300005618 Bacteria 2474
26 Ga0068870_10216564 3300005840 Bacteria 1170
27 Ga0068863_100021040 3300005841 Bacteria 6231
28 Ga0068858_100047788 3300005842 Bacteria 3966
29 Ga0068860_100025152 3300005843 Bacteria 5745
30 Ga0068860_100209293 3300005843 Bacteria 1891
31 Ga0070717_10335194 3300006028 Bacteria 1350
32 Ga0075364_10060101 3300006051 Bacteria 2492
33 Ga0070716_100073238 3300006173 Bacteria 2020
34 Ga0075362_10006632 3300006177 Bacteria 4322
35 Ga0075367_10012546 3300006178 Bacteria 4524
36 Ga0075366_10001483 3300006195 Bacteria 11708
37 Ga0075428_100222395 3300006844 Bacteria 2038
38 Ga0075430_100050699 3300006846 Bacteria 3499
39 Ga0075431_100130712 3300006847 Bacteria 2590
40 Ga0075429_100120790 3300006880 Bacteria 2290
41 Ga0068865_100075983 3300006881 Bacteria 2396
42 Ga0099826_10000002 3300006948 Bacteria 1125830
43 Ga0111539_10004599 3300009094 Bacteria 18034
44 Ga0114129_10316824 3300009147 Unclassified 2074
45 Ga0105243_10101288 3300009148 Bacteria 2391
46 Ga0105248_10014186 3300009177 Bacteria 8773
47 Ga0105237_10400931 3300009545 Bacteria 1376
48 Ga0105249_10052195 3300009553 Bacteria 3733
49 Ga0157375_10023960 3300013308 Bacteria 5641
50 Ga0182007_10005662 3300015262 Bacteria 5452
51 Ga0182005_1000151 3300015265 Bacteria 48745
52 Ga0209784_100010 3300025224 Bacteria 683664
53 Ga0209566_100008 3300025225 Bacteria 683664
54 Ga0209674_100019 3300025226 Bacteria 683664
55 Ga0209563_100021 3300025230 Bacteria 683764
56 Ga0207427_100232 3300025231 Bacteria 46074
57 Ga0209437_100019 3300025233 Bacteria 683764
58 Ga0209677_100011 3300025253 Bacteria 683664
59 Ga0209233_1000025 3300025261 Bacteria 683764
60 Ga0209565_1000003 3300025263 Bacteria 1099648
61 Ga0209455_1000073 3300025272 Bacteria 291417
62 Ga0209673_1000003 3300025273 Bacteria 980859
63 Ga0209675_1000003 3300025291 Bacteria 1003982
64 Ga0209564_1000012 3300025295 Bacteria 792078
65 Ga0209256_1000007 3300025299 Bacteria 1136599
66 Ga0209256_1000029 3300025299 Bacteria 415922
67 Ga0207642_10087482 3300025899 Bacteria 1530
68 Ga0207699_10000015 3300025906 Bacteria 251707
69 Ga0207643_10008791 3300025908 Bacteria 5417
70 Ga0207660_10007892 3300025917 Bacteria 6888
71 Ga0207662_10007399 3300025918 Bacteria 5979
72 Ga0207681_10456945 3300025923 Bacteria 1040
73 Ga0207659_10173074 3300025926 Bacteria 1704
74 Ga0207691_10014710 3300025940 Bacteria 7459
75 Ga0207689_10004757 3300025942 Bacteria 12247
76 Ga0207641_10155992 3300026088 Bacteria 2071
77 Ga0207648_10002128 3300026089 Bacteria 21540
78 Ga0207683_10093706 3300026121 Bacteria 2676
79 Ga0209282_1000001 3300027666 Bacteria 2450367
80 Ga0207428_10000220 3300027907 Bacteria 79712
81 Ga0268265_10079681 3300028380 Bacteria 2580
82 Ga0268264_10006696 3300028381 Bacteria 9685
83 Ga0268264_10186975 3300028381 Bacteria 1885
84 Ga0316180_1119166 3300030736 Bacteria 5552
85 Ga0316182_1218658 3300030745 Bacteria 4080
86 Ga0307513_10000219 3300031456 Bacteria 82663
87 Ga0307408_100001201 3300031548 Bacteria 19572
88 Ga0395905_0076437 3300037471 Bacteria 3138
89 Ga0466968_0042914 3300044735 Bacteria 1913
90 Ga0466970_0086273 3300044765 Bacteria 1701
91 Ga0495617_000027 3300046452 Bacteria 157385
92 Ga0495617_000935 3300046452 Bacteria 13555
93 Ga0495617_058886 3300046452 Bacteria 1272
94 Ga0495627_000457 3300046453 Bacteria 35474
95 Ga0495592_0014124 3300046454 Bacteria 6067
96 Ga0495603_0000675 3300046455 Bacteria 19337
97 Ga0495603_0006165 3300046455 Bacteria 7168
98 Ga0495590_0000034 3300046457 Bacteria 129910
99 Ga0495590_0001791 3300046457 Bacteria 9116
100 Ga0495590_0033685 3300046457 Bacteria 1790
101 Ga0495638_0000072 3300046460 Bacteria 164926
102 Ga0495638_0016555 3300046460 Bacteria 4935
103 Ga0495638_0047508 3300046460 Bacteria 2690
104 Ga0495638_0051407 3300046460 Bacteria 2570
105 Ga0495638_0092233 3300046460 Bacteria 1823
106 Ga0495651_0008008 3300046462 Bacteria 8102
107 Ga0495653_0003132 3300046463 Bacteria 13256
108 Ga0495653_0035155 3300046463 Bacteria 3956
109 Ga0495650_0000772 3300046471 Bacteria 39497
110 Ga0495650_0001626 3300046471 Bacteria 20921
111 Ga0495650_0013133 3300046471 Bacteria 4401
112 Ga0495650_0031725 3300046471 Bacteria 2373
113 Ga0495582_0012620 3300046473 Bacteria 4658
114 Ga0495582_0039432 3300046473 Bacteria 2600
115 Ga0495582_0117581 3300046473 Bacteria 1496
116 Ga0495605_0000385 3300046474 Bacteria 40742
117 Ga0495605_0003477 3300046474 Bacteria 9369
118 Ga0495605_0033924 3300046474 Bacteria 2588
119 Ga0495605_0051063 3300046474 Bacteria 2014
120 Ga0495639_0126593 3300046475 Bacteria 1221
121 Ga0495584_0000004 3300046491 Bacteria 314714
122 Ga0495584_0000119 3300046491 Bacteria 54120
123 Ga0495584_0000795 3300046491 Bacteria 20799
124 Ga0495584_0017339 3300046491 Bacteria 3667
125 Ga0495584_0019249 3300046491 Bacteria 3467
126 Ga0495584_0169242 3300046491 Bacteria 1110
127 Ga0495585_0000050 3300046492 Bacteria 119283
128 Ga0495585_0001990 3300046492 Bacteria 15167
129 Ga0495585_0004673 3300046492 Bacteria 8828
130 Ga0495585_0012137 3300046492 Bacteria 5083
131 Ga0495585_0012424 3300046492 Bacteria 5017
132 Ga0495585_0015565 3300046492 Bacteria 4419
133 Ga0495585_0035348 3300046492 Bacteria 2824
134 Ga0495585_0051223 3300046492 Bacteria 2288
135 Ga0495585_0075759 3300046492 Bacteria 1828
136 Ga0495585_0079936 3300046492 Bacteria 1772
137 Ga0495585_0143277 3300046492 Bacteria 1250
138 Ga0495594_0001076 3300046499 Bacteria 14247
139 Ga0495594_0004322 3300046499 Bacteria 7306
140 Ga0495594_0010168 3300046499 Bacteria 4876
141 Ga0495594_0074643 3300046499 Bacteria 1889
142 Ga0495596_0001931 3300046500 Bacteria 11486
143 Ga0495596_0002361 3300046500 Bacteria 10212
144 Ga0495596_0003166 3300046500 Bacteria 8477
145 Ga0495596_0003205 3300046500 Bacteria 8414
146 Ga0495607_0003480 3300046501 Bacteria 12055
147 Ga0495607_0004287 3300046501 Bacteria 10539
148 Ga0495607_0004663 3300046501 Bacteria 10031
149 Ga0495607_0004928 3300046501 Bacteria 9700
150 Ga0495607_0006916 3300046501 Bacteria 7908
151 Ga0495607_0008763 3300046501 Bacteria 6889
152 Ga0495583_0000053 3300046506 Bacteria 210542
153 Ga0495583_0000148 3300046506 Bacteria 118749
154 Ga0495583_0003555 3300046506 Bacteria 11742
155 Ga0495583_0013885 3300046506 Bacteria 4465
156 Ga0495583_0014220 3300046506 Bacteria 4401
157 Ga0495583_0015909 3300046506 Bacteria 4069
158 Ga0495583_0031892 3300046506 Bacteria 2548
159 Ga0495606_0000460 3300046507 Bacteria 66820
160 Ga0495606_0008229 3300046507 Bacteria 9110
161 Ga0495606_0038878 3300046507 Bacteria 3214
162 Ga0495606_0042894 3300046507 Bacteria 3022
163 Ga0495606_0089647 3300046507 Bacteria 1894
164 Ga0495608_0032374 3300046511 Bacteria 3534
165 Ga0495610_0001017 3300046512 Bacteria 25842
166 Ga0495610_0001775 3300046512 Bacteria 18867
167 Ga0495610_0006815 3300046512 Bacteria 7749
168 Ga0495610_0022816 3300046512 Bacteria 3414
169 Ga0495610_0027819 3300046512 Bacteria 2999
170 Ga0495616_0003129 3300046513 Bacteria 10692
171 Ga0495616_0004095 3300046513 Bacteria 9250
172 Ga0495616_0005941 3300046513 Bacteria 7444
173 Ga0495616_0007659 3300046513 Bacteria 6458
174 Ga0495616_0010582 3300046513 Bacteria 5332
175 Ga0495616_0058860 3300046513 Bacteria 1891
176 Ga0495616_0064292 3300046513 Bacteria 1790
177 Ga0495618_0011937 3300046514 Bacteria 5272
178 Ga0495628_0006197 3300046516 Bacteria 10459
179 Ga0495630_0019418 3300046517 Bacteria 4996
180 Ga0495630_0020918 3300046517 Bacteria 4829
181 Ga0495631_0000538 3300046518 Bacteria 25449
182 Ga0495631_0002275 3300046518 Bacteria 11000
183 Ga0495631_0004474 3300046518 Bacteria 7443
184 Ga0495631_0007002 3300046518 Bacteria 5771
185 Ga0495631_0010993 3300046518 Bacteria 4468
186 Ga0495631_0065946 3300046518 Bacteria 1566
187 Ga0495632_0000407 3300046519 Bacteria 40604
188 Ga0495632_0072621 3300046519 Bacteria 1651
189 Ga0495637_0000053 3300046520 Bacteria 99739
190 Ga0495637_0022395 3300046520 Bacteria 2882
191 Ga0495643_0000135 3300046522 Bacteria 118587
192 Ga0495643_0000193 3300046522 Bacteria 96406
193 Ga0495643_0007127 3300046522 Bacteria 7255
194 Ga0495643_0012306 3300046522 Bacteria 5167
195 Ga0495643_0102275 3300046522 Bacteria 1467
196 Ga0495644_0000391 3300046523 Bacteria 19655
197 Ga0495644_0000737 3300046523 Bacteria 13526
198 Ga0495644_0004191 3300046523 Bacteria 5662
199 Ga0495644_0018151 3300046523 Bacteria 2686
200 Ga0495648_0000037 3300046524 Bacteria 195401
201 Ga0495648_0000080 3300046524 Bacteria 126026
202 Ga0495648_0002569 3300046524 Bacteria 16638
203 Ga0495648_0002854 3300046524 Bacteria 15558
204 Ga0495648_0003447 3300046524 Bacteria 13910
205 Ga0495648_0011095 3300046524 Bacteria 6822
206 Ga0495648_0011746 3300046524 Bacteria 6571
207 Ga0495648_0023134 3300046524 Bacteria 4262
208 Ga0495648_0046267 3300046524 Bacteria 2698
209 Ga0495648_0064069 3300046524 Bacteria 2167
210 Ga0495648_0089937 3300046524 Bacteria 1721
211 Ga0495663_0010249 3300046525 Bacteria 2605
212 Ga0495666_0010659 3300046526 Bacteria 4583
213 Ga0495666_0030683 3300046526 Bacteria 2636
214 Ga0495666_0073730 3300046526 Bacteria 1619
215 Ga0495642_0000714 3300046528 Bacteria 16528
216 Ga0495642_0005347 3300046528 Bacteria 4924
217 Ga0495642_0005853 3300046528 Bacteria 4717
218 Ga0495642_0007083 3300046528 Bacteria 4302
219 Ga0495642_0010060 3300046528 Bacteria 3621
220 Ga0495642_0013887 3300046528 Bacteria 3119
221 Ga0495642_0022701 3300046528 Bacteria 2473
222 Ga0495652_0016166 3300046529 Bacteria 6672
223 Ga0495652_0062607 3300046529 Bacteria 3136
224 Ga0495654_0011179 3300046530 Bacteria 4872
225 Ga0495654_0067719 3300046530 Bacteria 1699
226 Ga0495665_0002029 3300046531 Bacteria 10962
227 Ga0495586_0059466 3300046535 Bacteria 2076
228 Ga0495587_0012132 3300046536 Bacteria 5440
229 Ga0495587_0052372 3300046536 Bacteria 2408
230 Ga0495609_0000208 3300046538 Bacteria 58639
231 Ga0495609_0002344 3300046538 Bacteria 11689
232 Ga0495609_0004700 3300046538 Bacteria 7391
233 Ga0495609_0009295 3300046538 Bacteria 4763
234 Ga0495609_0019243 3300046538 Bacteria 3162
235 Ga0495609_0029821 3300046538 Bacteria 2483
236 Ga0495609_0031923 3300046538 Bacteria 2393
237 Ga0495609_0072145 3300046538 Bacteria 1516
238 Ga0495597_0000093 3300046542 Bacteria 79411
239 Ga0495597_0000156 3300046542 Bacteria 60520
240 Ga0495597_0000556 3300046542 Bacteria 31021
241 Ga0495597_0001723 3300046542 Bacteria 15087
242 Ga0495597_0004461 3300046542 Bacteria 7683
243 Ga0495597_0016147 3300046542 Bacteria 3529
244 Ga0495597_0041497 3300046542 Bacteria 2055
245 Ga0495645_0032677 3300046543 Bacteria 3796
246 Ga0495622_0000010 3300046557 Bacteria 212375
247 Ga0495622_0000040 3300046557 Bacteria 118542
248 Ga0495622_0005105 3300046557 Bacteria 6082
249 Ga0495633_0000258 3300046558 Bacteria 62715
250 Ga0495633_0000653 3300046558 Bacteria 32049
251 Ga0495633_0001200 3300046558 Bacteria 20826
252 Ga0495633_0001566 3300046558 Bacteria 17538
253 Ga0495633_0018881 3300046558 Bacteria 3491
254 Ga0495633_0023352 3300046558 Bacteria 3065
255 Ga0495656_0003323 3300046615 Bacteria 5433
256 Ga0495656_0010133 3300046615 Bacteria 3415
257 Ga0495668_0000404 3300046616 Bacteria 56317
258 Ga0495668_0001457 3300046616 Bacteria 22767
259 Ga0495668_0001893 3300046616 Bacteria 18744
260 Ga0495668_0002467 3300046616 Bacteria 15224
261 Ga0495668_0025042 3300046616 Bacteria 3392
262 Ga0495668_0043096 3300046616 Bacteria 2511
263 Ga0495634_0014684 3300046642 Bacteria 5638
264 Ga0495611_0000906 3300046648 Bacteria 16080
265 Ga0495611_0000930 3300046648 Bacteria 15719
266 Ga0495611_0003342 3300046648 Bacteria 7084
267 Ga0495611_0011241 3300046648 Bacteria 3794
268 Ga0495611_0042125 3300046648 Bacteria 2038
269 Ga0495625_0000023 3300046660 Bacteria 274067
270 Ga0495625_0001530 3300046660 Bacteria 27635
271 Ga0495625_0002014 3300046660 Bacteria 22894
272 Ga0495625_0003171 3300046660 Bacteria 16730
273 Ga0495625_0011630 3300046660 Bacteria 7160
274 Ga0495625_0022730 3300046660 Bacteria 4803
275 Ga0495625_0105495 3300046660 Bacteria 1930
276 Ga0495659_0000057 3300046664 Bacteria 49206
277 Ga0495659_0003288 3300046664 Bacteria 5183
278 Ga0495661_0004599 3300046665 Bacteria 9935
279 Ga0495661_0004782 3300046665 Bacteria 9716
280 Ga0495661_0006168 3300046665 Bacteria 8436
281 Ga0495661_0007633 3300046665 Bacteria 7537
282 Ga0495661_0010716 3300046665 Bacteria 6244
283 Ga0495661_0016027 3300046665 Bacteria 4980
284 Ga0495661_0017999 3300046665 Bacteria 4654
285 Ga0495661_0030641 3300046665 Bacteria 3422
286 Ga0495661_0041770 3300046665 Bacteria 2834
287 Ga0495661_0062911 3300046665 Bacteria 2196
288 Ga0495588_0098969 3300046674 Bacteria 1531
289 Ga0495588_0116421 3300046674 Bacteria 1408
290 Ga0495588_0146426 3300046674 Bacteria 1248
291 Ga0495599_0000958 3300046678 Bacteria 16141
292 Ga0495623_0011819 3300046679 Bacteria 5656
293 Ga0495623_0029247 3300046679 Bacteria 3546
294 Ga0495669_0001070 3300046684 Bacteria 11391
295 Ga0495669_0003621 3300046684 Bacteria 6362
296 Ga0495669_0010332 3300046684 Bacteria 3944
297 Ga0495669_0094256 3300046684 Bacteria 1385
298 Ga0495624_0029143 3300046690 Bacteria 3603
299 Ga0495670_0000119 3300046691 Bacteria 34590
300 Ga0495670_0000352 3300046691 Bacteria 22004
301 Ga0495670_0001894 3300046691 Bacteria 10312
302 Ga0495670_0004748 3300046691 Bacteria 6673
303 Ga0495670_0005424 3300046691 Bacteria 6259
304 Ga0495670_0048799 3300046691 Bacteria 2117
305 Ga0495671_0000368 3300046692 Bacteria 36991
306 Ga0495671_0000587 3300046692 Bacteria 26875
307 Ga0495671_0001906 3300046692 Bacteria 13379
308 Ga0495671_0041888 3300046692 Bacteria 2304
309 Ga0495671_0043372 3300046692 Bacteria 2257
310 Ga0495671_0056695 3300046692 Bacteria 1939
311 Ga0495649_0002645 3300046694 Bacteria 12477
312 Ga0495649_0003104 3300046694 Bacteria 11372
313 Ga0495589_0007377 3300046794 Bacteria 5757
314 Ga0495589_0023268 3300046794 Bacteria 3158
315 Ga0495589_0081392 3300046794 Bacteria 1575
316 Ga0495600_0010800 3300046809 Bacteria 5678
317 Ga0495660_0000289 3300046810 Bacteria 46504
318 Ga0495660_0008010 3300046810 Bacteria 6205
319 Ga0495660_0036527 3300046810 Bacteria 2740
320 Ga0495581_0004043 3300047315 Bacteria 8447
321 Ga0495604_0004982 3300047317 Bacteria 10519
322 Ga0495604_0308661 3300047317 Bacteria 1060
323 Ga0495636_0000853 3300047318 Bacteria 11253
324 Ga0495636_0004499 3300047318 Bacteria 5463
325 Ga0495636_0031398 3300047318 Bacteria 2176
326 Ga0495672_0000023 3300047320 Bacteria 419080
327 Ga0495672_0000030 3300047320 Bacteria 305021
328 Ga0495672_0000135 3300047320 Bacteria 110114
329 Ga0495672_0002876 3300047320 Bacteria 15255
330 Ga0495672_0006508 3300047320 Bacteria 9027
331 Ga0495676_0013607 3300047321 Bacteria 7304
332 Ga0495683_0000654 3300047323 Bacteria 25659
333 Ga0495683_0005764 3300047323 Bacteria 6824
334 Ga0495683_0061984 3300047323 Bacteria 1851
335 Ga0495687_000268 3300047443 Bacteria 69524
336 Ga0495687_014406 3300047443 Bacteria 4075
337 Ga0495675_0007241 3300047444 Bacteria 6833
338 Ga0495677_0000394 3300047445 Bacteria 18658
339 Ga0495677_0003171 3300047445 Bacteria 6413
340 Ga0495677_0003804 3300047445 Bacteria 5837
341 Ga0495677_0006408 3300047445 Bacteria 4446
342 Ga0495677_0038889 3300047445 Bacteria 1738
343 Ga0495679_006904 3300047446 Bacteria 4816
344 Ga0495679_015435 3300047446 Bacteria 2794
345 Ga0495685_000031 3300047447 Bacteria 58983
346 Ga0495685_001357 3300047447 Bacteria 7492
347 Ga0495685_041602 3300047447 Bacteria 1570
348 Ga0495673_0000015 3300047469 Bacteria 598766
349 Ga0495673_0004688 3300047469 Bacteria 8490
350 Ga0495681_0000343 3300047470 Bacteria 36522
351 Ga0495681_0007929 3300047470 Bacteria 6708
352 Ga0495681_0013051 3300047470 Bacteria 4847
353 Ga0495681_0017556 3300047470 Bacteria 3969
354 Ga0495681_0024488 3300047470 Bacteria 3179
355 Ga0495681_0034156 3300047470 Bacteria 2537
356 Ga0495681_0074462 3300047470 Bacteria 1531
357 Ga0495686_0001126 3300047472 Bacteria 31591
358 Ga0495686_0006970 3300047472 Bacteria 8538
359 Ga0495686_0052591 3300047472 Bacteria 2553
360 Ga0495686_0059754 3300047472 Bacteria 2371
361 Ga0495593_0016069 3300047673 Bacteria 4225
362 Ga0495593_0088892 3300047673 Bacteria 1592
363 Ga0495602_0189055 3300048088 Bacteria 1580
364 Ga0495614_0024653 3300048089 Bacteria 2597
365 Ga0495626_0003692 3300048091 Bacteria 9697
366 Ga0495626_0003924 3300048091 Bacteria 9309
367 Ga0496102_0000262 3300048905 Bacteria 67362
368 Ga0496108_0111424 3300048911 Bacteria 2341
369 Ga0496109_0061102 3300048912 Bacteria 3444
370 Ga0496110_0000161 3300048913 Bacteria 40531
371 Ga0496110_0019198 3300048913 Bacteria 5748
372 Ga0496111_0262324 3300048914 Bacteria 1282
373 Ga0496113_0002013 3300048916 Bacteria 11661
374 Ga0496115_0017561 3300048918 Bacteria 5473
375 Ga0496115_0116395 3300048918 Bacteria 2198
376 Ga0496122_0001099 3300048925 Bacteria 46763
377 Ga0496123_0001733 3300048926 Bacteria 28920
378 Ga0496124_0032559 3300048927 Bacteria 4601
379 Ga0496124_0143652 3300048927 Bacteria 1880
380 Ga0496125_0025495 3300048928 Bacteria 5412
381 Ga0495678_000115 3300049459 Bacteria 96173
382 Ga0495678_000245 3300049459 Bacteria 60853
383 Ga0495678_000323 3300049459 Bacteria 50951
384 Ga0495678_000706 3300049459 Bacteria 30378
385 Ga0495678_002627 3300049459 Bacteria 11981
386 Ga0495678_009496 3300049459 Bacteria 4809
387 Ga0495682_0000733 3300049460 Bacteria 21253
388 Ga0495682_0001035 3300049460 Bacteria 16383
389 Ga0495682_0004013 3300049460 Bacteria 6411
390 Ga0495682_0020251 3300049460 Bacteria 2497
391 Ga0501207_004537 3300049654 Bacteria 1893
392 nmdc:mga0yw44_160143_c1 3300050492 Bacteria 1473
393 nmdc:mga0k408_4226_c1 3300050493 Bacteria 7618
394 nmdc:mga06z11_12576_c1 3300050494 Bacteria 3685
395 nmdc:mga04h51_5021_c1 3300050495 Bacteria 3344
396 nmdc:mga0qj67_67928_c1 3300050509 Bacteria 2840
397 nmdc:mga06r32_257812_c1 3300050510 Bacteria 1731
398 nmdc:mga08y16_657_c1 3300050511 Bacteria 32513
399 Ga0495601_0037333 3300053077 Bacteria 3037
400 Ga0500572_011010 3300053111 Bacteria 2178
401 Ga0500595_004487 3300053119 Bacteria 6253
402 Ga0500586_000068 3300053145 Bacteria 18196
403 Ga0500619_000600 3300053154 Bacteria 6144
404 Ga0500645_000337 3300053730 Bacteria 33437

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046526 Ga0495666_0030683 Ga0495666_0030683_1144_2157 277
2 3300046455 Ga0495603_0006165 Ga0495603_0006165_3077_4090 278
3 3300046492 Ga0495585_0051223 Ga0495585_0051223_390_1403 278
4 3300046499 Ga0495594_0004322 Ga0495594_0004322_430_1443 278
5 3300046475 Ga0495639_0126593 Ga0495639_0126593_263_1201 282
6 3300046542 Ga0495597_0000093 Ga0495597_0000093_11814_12752 282
7 3300046518 Ga0495631_0007002 Ga0495631_0007002_4793_5755 283
8 3300025272 Ga0209455_1000073 Ga0209455_100007371 287
9 3300046457 Ga0495590_0000034 Ga0495590_0000034_9865_10827 290
10 3300046460 Ga0495638_0000072 Ga0495638_0000072_13641_14603 290
11 3300046460 Ga0495638_0016555 Ga0495638_0016555_3482_4444 290
12 3300046460 Ga0495638_0051407 Ga0495638_0051407_1117_2079 290
13 3300046471 Ga0495650_0000772 Ga0495650_0000772_4481_5443 290
14 3300046471 Ga0495650_0001626 Ga0495650_0001626_6727_7689 290
15 3300046506 Ga0495583_0000148 Ga0495583_0000148_13544_14506 290
16 3300046507 Ga0495606_0000460 Ga0495606_0000460_7902_8864 290
17 3300046507 Ga0495606_0008229 Ga0495606_0008229_8084_9046 290
18 3300046512 Ga0495610_0006815 Ga0495610_0006815_1243_2205 290
19 3300046512 Ga0495610_0022816 Ga0495610_0022816_2233_3195 290
20 3300046522 Ga0495643_0000135 Ga0495643_0000135_104379_105371 290
21 3300046524 Ga0495648_0000037 Ga0495648_0000037_180894_181856 290
22 3300046528 Ga0495642_0010060 Ga0495642_0010060_121_1083 290
23 3300046528 Ga0495642_0013887 Ga0495642_0013887_481_1533 290
24 3300046542 Ga0495597_0000156 Ga0495597_0000156_46177_47169 290
25 3300046557 Ga0495622_0000040 Ga0495622_0000040_104039_105001 290
26 3300046558 Ga0495633_0000258 Ga0495633_0000258_9805_10767 290
27 3300046558 Ga0495633_0000653 Ga0495633_0000653_9757_10719 290
28 3300046616 Ga0495668_0000404 Ga0495668_0000404_45464_46426 290
29 3300046660 Ga0495625_0000023 Ga0495625_0000023_198120_199082 290
30 3300046660 Ga0495625_0001530 Ga0495625_0001530_16586_17548 290
31 3300047469 Ga0495673_0000015 Ga0495673_0000015_164906_165871 290
32 3300048914 Ga0496111_0262324 Ga0496111_0262324_288_1259 290
33 3300049459 Ga0495678_002627 Ga0495678_002627_2404_3366 290
34 3300049459 Ga0495678_009496 Ga0495678_009496_3130_4092 290
35 3300053145 Ga0500586_000068 Ga0500586_000068_13858_14820 290
36 3300046506 Ga0495583_0013885 Ga0495583_0013885_1724_2680 291
37 3300046522 Ga0495643_0102275 Ga0495643_0102275_125_1081 291
38 3300046524 Ga0495648_0011746 Ga0495648_0011746_1332_2288 291
39 3300046538 Ga0495609_0002344 Ga0495609_0002344_5662_6618 291
40 3300046665 Ga0495661_0016027 Ga0495661_0016027_3310_4266 291
41 3300046648 Ga0495611_0042125 Ga0495611_0042125_778_1770 293
42 3300046810 Ga0495660_0008010 Ga0495660_0008010_896_1888 293
43 3300037471 Ga0395905_0076437 Ga0395905_0076437_385_1347 295
44 3300046660 Ga0495625_0011630 Ga0495625_0011630_3840_4802 298
45 iso_pu_bacteria 2643221645 2644252854 302
46 3300003775 Ga0055524_1000010 Ga0055524_1000010250 303
47 3300005262 Ga0065165_1023261 Ga0065165_10232612 303
48 3300025299 Ga0209256_1000007 Ga0209256_1000007628 303
49 3300046542 Ga0495597_0041497 Ga0495597_0041497_144_1109 303
50 3300047443 Ga0495687_014406 Ga0495687_014406_490_1455 303
51 3300047446 Ga0495679_015435 Ga0495679_015435_19_969 304
52 3300048913 Ga0496110_0019198 Ga0496110_0019198_2003_3040 304
53 3300046452 Ga0495617_000027 Ga0495617_000027_26211_27185 305
54 3300046453 Ga0495627_000457 Ga0495627_000457_8342_9310 305
55 3300046471 Ga0495650_0031725 Ga0495650_0031725_246_1238 305
56 3300046474 Ga0495605_0000385 Ga0495605_0000385_26236_27210 305
57 3300046500 Ga0495596_0001931 Ga0495596_0001931_10274_11248 305
58 3300046501 Ga0495607_0004287 Ga0495607_0004287_591_1565 305
59 3300046512 Ga0495610_0001017 Ga0495610_0001017_18269_19201 305
60 3300046513 Ga0495616_0004095 Ga0495616_0004095_4721_5695 305
61 3300046519 Ga0495632_0072621 Ga0495632_0072621_609_1562 305
62 3300046524 Ga0495648_0003447 Ga0495648_0003447_3569_4543 305
63 3300046524 Ga0495648_0046267 Ga0495648_0046267_1346_2278 305
64 3300046538 Ga0495609_0004700 Ga0495609_0004700_1083_2033 305
65 3300046542 Ga0495597_0000556 Ga0495597_0000556_5280_6230 305
66 3300046616 Ga0495668_0001893 Ga0495668_0001893_9380_10354 305
67 3300046660 Ga0495625_0022730 Ga0495625_0022730_1619_2551 305
68 3300046665 Ga0495661_0004782 Ga0495661_0004782_6454_7404 305
69 3300046665 Ga0495661_0007633 Ga0495661_0007633_3137_4111 305
70 3300046691 Ga0495670_0048799 Ga0495670_0048799_684_1646 305
71 3300046694 Ga0495649_0003104 Ga0495649_0003104_1337_2269 305
72 3300046794 Ga0495589_0023268 Ga0495589_0023268_646_1614 305
73 3300046810 Ga0495660_0036527 Ga0495660_0036527_862_1824 305
74 3300047470 Ga0495681_0000343 Ga0495681_0000343_8688_9659 305
75 3300047470 Ga0495681_0034156 Ga0495681_0034156_924_1898 305
76 3300048911 Ga0496108_0111424 Ga0496108_0111424_251_1213 305
77 3300048912 Ga0496109_0061102 Ga0496109_0061102_295_1245 305
78 3300048916 Ga0496113_0002013 Ga0496113_0002013_627_1577 305
79 3300048925 Ga0496122_0001099 Ga0496122_0001099_19603_20553 305
80 3300048926 Ga0496123_0001733 Ga0496123_0001733_6893_7843 305
81 3300048928 Ga0496125_0025495 Ga0496125_0025495_4419_5369 305
82 3300006948 Ga0099826_10000002 Ga0099826_10000002167 306
83 3300027666 Ga0209282_1000001 Ga0209282_1000001980 306
84 3300046455 Ga0495603_0000675 Ga0495603_0000675_4477_5433 306
85 3300046471 Ga0495650_0013133 Ga0495650_0013133_1762_2739 306
86 3300046474 Ga0495605_0033924 Ga0495605_0033924_1388_2350 306
87 3300046491 Ga0495584_0000795 Ga0495584_0000795_3001_3957 306
88 3300046492 Ga0495585_0079936 Ga0495585_0079936_674_1630 306
89 3300046499 Ga0495594_0074643 Ga0495594_0074643_215_1171 306
90 3300046506 Ga0495583_0015909 Ga0495583_0015909_394_1365 306
91 3300046513 Ga0495616_0005941 Ga0495616_0005941_4827_5783 306
92 3300046518 Ga0495631_0004474 Ga0495631_0004474_3907_4863 306
93 3300046519 Ga0495632_0000407 Ga0495632_0000407_28058_29020 306
94 3300046524 Ga0495648_0011095 Ga0495648_0011095_2717_3673 306
95 3300046538 Ga0495609_0072145 Ga0495609_0072145_429_1391 306
96 3300046674 Ga0495588_0116421 Ga0495588_0116421_239_1195 306
97 3300046684 Ga0495669_0010332 Ga0495669_0010332_1011_1973 306
98 3300046692 Ga0495671_0041888 Ga0495671_0041888_617_1624 306
99 3300046794 Ga0495589_0007377 Ga0495589_0007377_380_1336 306
100 3300047445 Ga0495677_0000394 Ga0495677_0000394_8960_9916 306
101 3300046492 Ga0495585_0001990 Ga0495585_0001990_2465_3415 307
102 3300046500 Ga0495596_0003205 Ga0495596_0003205_3401_4351 307
103 3300046507 Ga0495606_0042894 Ga0495606_0042894_82_1035 307
104 3300046522 Ga0495643_0000193 Ga0495643_0000193_80602_81540 307
105 3300046523 Ga0495644_0018151 Ga0495644_0018151_11_961 307
106 3300046616 Ga0495668_0002467 Ga0495668_0002467_5142_6098 307
107 3300046648 Ga0495611_0003342 Ga0495611_0003342_5267_6217 307
108 3300046665 Ga0495661_0041770 Ga0495661_0041770_1756_2706 307
109 3300046684 Ga0495669_0001070 Ga0495669_0001070_8905_9855 307
110 3300047320 Ga0495672_0000030 Ga0495672_0000030_14574_15512 307
111 3300047470 Ga0495681_0074462 Ga0495681_0074462_93_1049 307
112 3300048091 Ga0495626_0003924 Ga0495626_0003924_6768_7718 307
113 3300048913 Ga0496110_0000161 Ga0496110_0000161_12138_13094 307
114 3300049459 Ga0495678_000115 Ga0495678_000115_14857_15795 307
115 3300046492 Ga0495585_0012137 Ga0495585_0012137_569_1525 308
116 3300046500 Ga0495596_0003166 Ga0495596_0003166_3754_4707 308
117 3300046501 Ga0495607_0004928 Ga0495607_0004928_3147_4103 308
118 3300046506 Ga0495583_0003555 Ga0495583_0003555_7615_8571 308
119 3300046512 Ga0495610_0001775 Ga0495610_0001775_2987_3943 308
120 3300046513 Ga0495616_0058860 Ga0495616_0058860_832_1788 308
121 3300046518 Ga0495631_0065946 Ga0495631_0065946_18_950 308
122 3300046520 Ga0495637_0000053 Ga0495637_0000053_28590_29546 308
123 3300046522 Ga0495643_0007127 Ga0495643_0007127_1511_2467 308
124 3300046524 Ga0495648_0002854 Ga0495648_0002854_4120_5082 308
125 3300046528 Ga0495642_0022701 Ga0495642_0022701_1010_1978 308
126 3300046542 Ga0495597_0001723 Ga0495597_0001723_4301_5263 308
127 3300046558 Ga0495633_0001200 Ga0495633_0001200_6674_7630 308
128 3300046648 Ga0495611_0011241 Ga0495611_0011241_951_1907 308
129 3300046660 Ga0495625_0105495 Ga0495625_0105495_240_1196 308
130 3300046665 Ga0495661_0010716 Ga0495661_0010716_2686_3642 308
131 3300046684 Ga0495669_0094256 Ga0495669_0094256_14_970 308
132 3300046694 Ga0495649_0002645 Ga0495649_0002645_8408_9364 308
133 3300047320 Ga0495672_0000135 Ga0495672_0000135_26533_27489 308
134 3300047323 Ga0495683_0000654 Ga0495683_0000654_21719_22675 308
135 3300047447 Ga0495685_041602 Ga0495685_041602_436_1392 308
136 3300047470 Ga0495681_0013051 Ga0495681_0013051_211_1167 308
137 3300047472 Ga0495686_0001126 Ga0495686_0001126_4609_5562 308
138 3300047472 Ga0495686_0006970 Ga0495686_0006970_7435_8391 308
139 3300048927 Ga0496124_0143652 Ga0496124_0143652_244_1200 308
140 3300049459 Ga0495678_000245 Ga0495678_000245_24826_25782 308
141 3300049460 Ga0495682_0004013 Ga0495682_0004013_2993_3946 308
142 3300049460 Ga0495682_0020251 Ga0495682_0020251_662_1618 308
143 3300053730 Ga0500645_000337 Ga0500645_000337_20367_21296 308
144 3300046674 Ga0495588_0146426 Ga0495588_0146426_41_1054 309
145 3300047321 Ga0495676_0013607 Ga0495676_0013607_5640_6653 309
146 3300048927 Ga0496124_0032559 Ga0496124_0032559_2358_3290 310
147 3300005455 Ga0070663_100031335 Ga0070663_1000313352 311
148 3300025917 Ga0207660_10007892 Ga0207660_100078925 311
149 3300046557 Ga0495622_0000010 Ga0495622_0000010_199097_200068 311
150 iso_pu_bacteria 2842711865 2842713296 311
151 iso_pu_bacteria 2857558681 2857562748 311
152 iso_pu_bacteria 2643221664 2644355100 312
153 iso_pu_bacteria 2738541280 2738737745 312
154 iso_pu_bacteria 2738541300 2738841952 312
155 iso_pu_bacteria 2738543018 2739272811 312
156 iso_pu_bacteria 2738543030 2739341855 312
157 iso_pu_bacteria 2818991436 2819541986 312
158 3300005843 Ga0068860_100025152 Ga0068860_1000251528 313
159 3300006028 Ga0070717_10335194 Ga0070717_103351942 313
160 3300009147 Ga0114129_10316824 Ga0114129_103168243 313
161 3300028381 Ga0268264_10006696 Ga0268264_100066966 313
162 3300046491 Ga0495584_0019249 Ga0495584_0019249_405_1352 314
163 3300046528 Ga0495642_0005347 Ga0495642_0005347_2994_3941 314
164 3300046557 Ga0495622_0005105 Ga0495622_0005105_1967_2914 314
165 3300046674 Ga0495588_0098969 Ga0495588_0098969_105_1052 314
166 3300031456 Ga0307513_10000219 Ga0307513_1000021937 315
167 3300031548 Ga0307408_100001201 Ga0307408_1000012018 315
168 3300044735 Ga0466968_0042914 Ga0466968_0042914_335_1291 315
169 3300046491 Ga0495584_0000004 Ga0495584_0000004_132834_133784 315
170 3300046492 Ga0495585_0000050 Ga0495585_0000050_82892_83842 315
171 3300046492 Ga0495585_0015565 Ga0495585_0015565_2797_3750 315
172 3300046492 Ga0495585_0075759 Ga0495585_0075759_673_1623 315
173 3300046507 Ga0495606_0038878 Ga0495606_0038878_586_1536 315
174 3300046513 Ga0495616_0003129 Ga0495616_0003129_9012_9962 315
175 3300046524 Ga0495648_0000080 Ga0495648_0000080_41642_42592 315
176 3300046525 Ga0495663_0010249 Ga0495663_0010249_1610_2563 315
177 3300046558 Ga0495633_0018881 Ga0495633_0018881_1104_2057 315
178 3300046558 Ga0495633_0023352 Ga0495633_0023352_139_1089 315
179 3300046665 Ga0495661_0006168 Ga0495661_0006168_3759_4835 315
180 3300046665 Ga0495661_0030641 Ga0495661_0030641_136_1089 315
181 3300046691 Ga0495670_0000119 Ga0495670_0000119_10696_11646 315
182 3300046691 Ga0495670_0000352 Ga0495670_0000352_17966_19042 315
183 3300047323 Ga0495683_0061984 Ga0495683_0061984_606_1556 315
184 3300047470 Ga0495681_0024488 Ga0495681_0024488_579_1532 315
185 3300048089 Ga0495614_0024653 Ga0495614_0024653_1625_2575 315
186 3300048091 Ga0495626_0003692 Ga0495626_0003692_8703_9653 315
187 3300048918 Ga0496115_0017561 Ga0496115_0017561_553_1503 315
188 3300049654 Ga0501207_004537 Ga0501207_004537_307_1263 315
189 3300003771 Ga0055526_1000939 Ga0055526_10009398 316
190 3300003773 Ga0055537_1000400 Ga0055537_100040022 316
191 3300003784 Ga0055534_1000139 Ga0055534_100013924 316
192 3300003790 Ga0055528_1000011 Ga0055528_100001131 316
193 3300005338 Ga0068868_100121752 Ga0068868_1001217523 316
194 3300005340 Ga0070689_100011944 Ga0070689_1000119441 316
195 3300005343 Ga0070687_100011479 Ga0070687_1000114791 316
196 3300005354 Ga0070675_100040734 Ga0070675_1000407342 316
197 3300005365 Ga0070688_100012865 Ga0070688_1000128651 316
198 3300005434 Ga0070709_10000005 Ga0070709_10000005132 316
199 3300005441 Ga0070700_100025988 Ga0070700_1000259882 316
200 3300005457 Ga0070662_100164290 Ga0070662_1001642902 316
201 3300005459 Ga0068867_100014108 Ga0068867_1000141082 316
202 3300005577 Ga0068857_100469809 Ga0068857_1004698091 316
203 3300005618 Ga0068864_100108218 Ga0068864_1001082183 316
204 3300005840 Ga0068870_10216564 Ga0068870_102165641 316
205 3300005841 Ga0068863_100021040 Ga0068863_1000210406 316
206 3300005842 Ga0068858_100047788 Ga0068858_1000477883 316
207 3300005843 Ga0068860_100209293 Ga0068860_1002092932 316
208 3300006051 Ga0075364_10060101 Ga0075364_100601013 316
209 3300006173 Ga0070716_100073238 Ga0070716_1000732382 316
210 3300006177 Ga0075362_10006632 Ga0075362_100066323 316
211 3300006178 Ga0075367_10012546 Ga0075367_100125462 316
212 3300006195 Ga0075366_10001483 Ga0075366_100014838 316
213 3300006844 Ga0075428_100222395 Ga0075428_1002223952 316
214 3300006846 Ga0075430_100050699 Ga0075430_1000506993 316
215 3300006847 Ga0075431_100130712 Ga0075431_1001307123 316
216 3300006880 Ga0075429_100120790 Ga0075429_1001207903 316
217 3300006881 Ga0068865_100075983 Ga0068865_1000759831 316
218 3300009094 Ga0111539_10004599 Ga0111539_100045994 316
219 3300009148 Ga0105243_10101288 Ga0105243_101012882 316
220 3300009177 Ga0105248_10014186 Ga0105248_100141864 316
221 3300009545 Ga0105237_10400931 Ga0105237_104009311 316
222 3300009553 Ga0105249_10052195 Ga0105249_100521952 316
223 3300013308 Ga0157375_10023960 Ga0157375_100239603 316
224 3300015262 Ga0182007_10005662 Ga0182007_100056623 316
225 3300015265 Ga0182005_1000151 Ga0182005_100015111 316
226 3300025263 Ga0209565_1000003 Ga0209565_1000003705 316
227 3300025273 Ga0209673_1000003 Ga0209673_1000003591 316
228 3300025291 Ga0209675_1000003 Ga0209675_1000003333 316
229 3300025295 Ga0209564_1000012 Ga0209564_1000012141 316
230 3300025299 Ga0209256_1000029 Ga0209256_100002992 316
231 3300025899 Ga0207642_10087482 Ga0207642_100874821 316
232 3300025906 Ga0207699_10000015 Ga0207699_1000001519 316
233 3300025908 Ga0207643_10008791 Ga0207643_100087913 316
234 3300025918 Ga0207662_10007399 Ga0207662_100073996 316
235 3300025923 Ga0207681_10456945 Ga0207681_104569451 316
236 3300025926 Ga0207659_10173074 Ga0207659_101730742 316
237 3300025940 Ga0207691_10014710 Ga0207691_100147102 316
238 3300025942 Ga0207689_10004757 Ga0207689_100047578 316
239 3300026088 Ga0207641_10155992 Ga0207641_101559922 316
240 3300026089 Ga0207648_10002128 Ga0207648_1000212812 316
241 3300026121 Ga0207683_10093706 Ga0207683_100937063 316
242 3300027907 Ga0207428_10000220 Ga0207428_1000022043 316
243 3300028380 Ga0268265_10079681 Ga0268265_100796812 316
244 3300028381 Ga0268264_10186975 Ga0268264_101869752 316
245 3300030736 Ga0316180_1119166 Ga0316180_11191662 316
246 3300030745 Ga0316182_1218658 Ga0316182_12186583 316
247 3300044765 Ga0466970_0086273 Ga0466970_0086273_120_1073 316
248 3300046452 Ga0495617_000935 Ga0495617_000935_4905_5861 316
249 3300046452 Ga0495617_058886 Ga0495617_058886_61_1017 316
250 3300046457 Ga0495590_0033685 Ga0495590_0033685_550_1500 316
251 3300046460 Ga0495638_0047508 Ga0495638_0047508_1221_2177 316
252 3300046463 Ga0495653_0035155 Ga0495653_0035155_782_1732 316
253 3300046473 Ga0495582_0012620 Ga0495582_0012620_11_961 316
254 3300046473 Ga0495582_0039432 Ga0495582_0039432_1482_2492 316
255 3300046473 Ga0495582_0117581 Ga0495582_0117581_471_1475 316
256 3300046474 Ga0495605_0003477 Ga0495605_0003477_5690_6646 316
257 3300046491 Ga0495584_0000119 Ga0495584_0000119_46428_47384 316
258 3300046491 Ga0495584_0017339 Ga0495584_0017339_1653_2633 316
259 3300046491 Ga0495584_0169242 Ga0495584_0169242_93_1049 316
260 3300046492 Ga0495585_0004673 Ga0495585_0004673_2431_3387 316
261 3300046492 Ga0495585_0012424 Ga0495585_0012424_187_1143 316
262 3300046492 Ga0495585_0035348 Ga0495585_0035348_42_998 316
263 3300046492 Ga0495585_0143277 Ga0495585_0143277_100_1056 316
264 3300046499 Ga0495594_0001076 Ga0495594_0001076_12683_13693 316
265 3300046499 Ga0495594_0010168 Ga0495594_0010168_3734_4684 316
266 3300046501 Ga0495607_0003480 Ga0495607_0003480_8725_9681 316
267 3300046501 Ga0495607_0004663 Ga0495607_0004663_8388_9344 316
268 3300046501 Ga0495607_0006916 Ga0495607_0006916_4864_5820 316
269 3300046501 Ga0495607_0008763 Ga0495607_0008763_2422_3378 316
270 3300046506 Ga0495583_0000053 Ga0495583_0000053_125836_126792 316
271 3300046507 Ga0495606_0089647 Ga0495606_0089647_645_1598 316
272 3300046512 Ga0495610_0027819 Ga0495610_0027819_1065_2021 316
273 3300046513 Ga0495616_0010582 Ga0495616_0010582_2741_3697 316
274 3300046513 Ga0495616_0064292 Ga0495616_0064292_304_1260 316
275 3300046517 Ga0495630_0019418 Ga0495630_0019418_2718_3668 316
276 3300046517 Ga0495630_0020918 Ga0495630_0020918_2309_3313 316
277 3300046518 Ga0495631_0010993 Ga0495631_0010993_2015_3064 316
278 3300046523 Ga0495644_0000391 Ga0495644_0000391_10438_11394 316
279 3300046523 Ga0495644_0000737 Ga0495644_0000737_7490_8446 316
280 3300046524 Ga0495648_0002569 Ga0495648_0002569_14261_15217 316
281 3300046524 Ga0495648_0064069 Ga0495648_0064069_1086_2042 316
282 3300046526 Ga0495666_0010659 Ga0495666_0010659_3174_4124 316
283 3300046526 Ga0495666_0073730 Ga0495666_0073730_480_1490 316
284 3300046528 Ga0495642_0005853 Ga0495642_0005853_1678_2667 316
285 3300046529 Ga0495652_0016166 Ga0495652_0016166_5145_6095 316
286 3300046530 Ga0495654_0067719 Ga0495654_0067719_690_1643 316
287 3300046531 Ga0495665_0002029 Ga0495665_0002029_3843_4793 316
288 3300046535 Ga0495586_0059466 Ga0495586_0059466_175_1179 316
289 3300046536 Ga0495587_0012132 Ga0495587_0012132_1621_2625 316
290 3300046536 Ga0495587_0052372 Ga0495587_0052372_296_1246 316
291 3300046538 Ga0495609_0000208 Ga0495609_0000208_30105_31061 316
292 3300046538 Ga0495609_0029821 Ga0495609_0029821_1123_2076 316
293 3300046538 Ga0495609_0031923 Ga0495609_0031923_830_1786 316
294 3300046542 Ga0495597_0004461 Ga0495597_0004461_4115_5068 316
295 3300046558 Ga0495633_0001566 Ga0495633_0001566_914_1870 316
296 3300046615 Ga0495656_0003323 Ga0495656_0003323_3971_4927 316
297 3300046616 Ga0495668_0025042 Ga0495668_0025042_2171_3160 316
298 3300046616 Ga0495668_0043096 Ga0495668_0043096_1254_2204 316
299 3300046642 Ga0495634_0014684 Ga0495634_0014684_2698_3648 316
300 3300046648 Ga0495611_0000906 Ga0495611_0000906_5413_6369 316
301 3300046648 Ga0495611_0000930 Ga0495611_0000930_7050_8006 316
302 3300046660 Ga0495625_0002014 Ga0495625_0002014_13680_14633 316
303 3300046664 Ga0495659_0000057 Ga0495659_0000057_13840_14793 316
304 3300046664 Ga0495659_0003288 Ga0495659_0003288_205_1161 316
305 3300046665 Ga0495661_0017999 Ga0495661_0017999_1585_2574 316
306 3300046665 Ga0495661_0062911 Ga0495661_0062911_1165_2121 316
307 3300046679 Ga0495623_0011819 Ga0495623_0011819_4331_5281 316
308 3300046691 Ga0495670_0001894 Ga0495670_0001894_6382_7338 316
309 3300046691 Ga0495670_0004748 Ga0495670_0004748_952_1929 316
310 3300046691 Ga0495670_0005424 Ga0495670_0005424_2102_3058 316
311 3300046692 Ga0495671_0000368 Ga0495671_0000368_14581_15534 316
312 3300046692 Ga0495671_0043372 Ga0495671_0043372_1087_2043 316
313 3300046692 Ga0495671_0056695 Ga0495671_0056695_155_1111 316
314 3300046794 Ga0495589_0081392 Ga0495589_0081392_178_1155 316
315 3300046810 Ga0495660_0000289 Ga0495660_0000289_27326_28279 316
316 3300047315 Ga0495581_0004043 Ga0495581_0004043_7092_8096 316
317 3300047317 Ga0495604_0308661 Ga0495604_0308661_81_1031 316
318 3300047318 Ga0495636_0000853 Ga0495636_0000853_1820_2776 316
319 3300047318 Ga0495636_0004499 Ga0495636_0004499_3478_4455 316
320 3300047320 Ga0495672_0000023 Ga0495672_0000023_257279_258232 316
321 3300047320 Ga0495672_0002876 Ga0495672_0002876_5083_6039 316
322 3300047320 Ga0495672_0006508 Ga0495672_0006508_5699_6655 316
323 3300047323 Ga0495683_0005764 Ga0495683_0005764_5719_6675 316
324 3300047443 Ga0495687_000268 Ga0495687_000268_55248_56204 316
325 3300047444 Ga0495675_0007241 Ga0495675_0007241_3015_3965 316
326 3300047445 Ga0495677_0003171 Ga0495677_0003171_5364_6320 316
327 3300047445 Ga0495677_0003804 Ga0495677_0003804_2376_3353 316
328 3300047445 Ga0495677_0038889 Ga0495677_0038889_42_998 316
329 3300047447 Ga0495685_000031 Ga0495685_000031_3327_4283 316
330 3300047469 Ga0495673_0004688 Ga0495673_0004688_6121_7077 316
331 3300047470 Ga0495681_0017556 Ga0495681_0017556_1795_2775 316
332 3300047472 Ga0495686_0059754 Ga0495686_0059754_696_1649 316
333 3300047673 Ga0495593_0016069 Ga0495593_0016069_2926_3876 316
334 3300047673 Ga0495593_0088892 Ga0495593_0088892_430_1413 316
335 3300048905 Ga0496102_0000262 Ga0496102_0000262_13843_14823 316
336 3300048918 Ga0496115_0116395 Ga0496115_0116395_348_1322 316
337 3300049459 Ga0495678_000706 Ga0495678_000706_2322_3278 316
338 3300049460 Ga0495682_0000733 Ga0495682_0000733_15282_16238 316
339 3300049460 Ga0495682_0001035 Ga0495682_0001035_14571_15527 316
340 3300050492 nmdc:mga0yw44_160143_c1 nmdc:mga0yw44_160143_c1_202_1179 316
341 3300050493 nmdc:mga0k408_4226_c1 nmdc:mga0k408_4226_c1_4560_5537 316
342 3300050494 nmdc:mga06z11_12576_c1 nmdc:mga06z11_12576_c1_1110_2087 316
343 3300050495 nmdc:mga04h51_5021_c1 nmdc:mga04h51_5021_c1_1165_2142 316
344 3300050509 nmdc:mga0qj67_67928_c1 nmdc:mga0qj67_67928_c1_1282_2259 316
345 3300050510 nmdc:mga06r32_257812_c1 nmdc:mga06r32_257812_c1_553_1530 316
346 3300050511 nmdc:mga08y16_657_c1 nmdc:mga08y16_657_c1_5583_6560 316
347 3300002737 JGI25162J39368_1000079 JGI25162J39368_100007963 317
348 3300003214 JGI25165J46597_1000135 JGI25165J46597_100013569 317
349 3300003751 Ga0055538_1000055 Ga0055538_100005569 317
350 3300003752 Ga0055539_1000080 Ga0055539_100008035 317
351 3300003756 Ga0055533_1000086 Ga0055533_100008635 317
352 3300003759 Ga0055525_1000114 Ga0055525_100011469 317
353 3300003841 Ga0055541_1000057 Ga0055541_100005735 317
354 3300025224 Ga0209784_100010 Ga0209784_100010102 317
355 3300025225 Ga0209566_100008 Ga0209566_100008102 317
356 3300025226 Ga0209674_100019 Ga0209674_100019102 317
357 3300025230 Ga0209563_100021 Ga0209563_100021102 317
358 3300025231 Ga0207427_100232 Ga0207427_10023210 317
359 3300025233 Ga0209437_100019 Ga0209437_100019102 317
360 3300025253 Ga0209677_100011 Ga0209677_100011102 317
361 3300025261 Ga0209233_1000025 Ga0209233_1000025102 317
362 3300046454 Ga0495592_0014124 Ga0495592_0014124_2771_3724 317
363 3300046457 Ga0495590_0001791 Ga0495590_0001791_7557_8657 317
364 3300046460 Ga0495638_0092233 Ga0495638_0092233_786_1769 317
365 3300046462 Ga0495651_0008008 Ga0495651_0008008_2985_3938 317
366 3300046463 Ga0495653_0003132 Ga0495653_0003132_4542_5495 317
367 3300046474 Ga0495605_0051063 Ga0495605_0051063_817_1917 317
368 3300046500 Ga0495596_0002361 Ga0495596_0002361_526_1491 317
369 3300046506 Ga0495583_0014220 Ga0495583_0014220_1256_2344 317
370 3300046506 Ga0495583_0031892 Ga0495583_0031892_1320_2285 317
371 3300046511 Ga0495608_0032374 Ga0495608_0032374_612_1565 317
372 3300046513 Ga0495616_0007659 Ga0495616_0007659_3844_4944 317
373 3300046514 Ga0495618_0011937 Ga0495618_0011937_257_1210 317
374 3300046516 Ga0495628_0006197 Ga0495628_0006197_4965_5918 317
375 3300046518 Ga0495631_0000538 Ga0495631_0000538_11898_12998 317
376 3300046518 Ga0495631_0002275 Ga0495631_0002275_4758_5726 317
377 3300046520 Ga0495637_0022395 Ga0495637_0022395_1847_2830 317
378 3300046522 Ga0495643_0012306 Ga0495643_0012306_2221_3321 317
379 3300046523 Ga0495644_0004191 Ga0495644_0004191_3490_4458 317
380 3300046524 Ga0495648_0023134 Ga0495648_0023134_2852_3835 317
381 3300046524 Ga0495648_0089937 Ga0495648_0089937_320_1303 317
382 3300046528 Ga0495642_0000714 Ga0495642_0000714_7196_8164 317
383 3300046528 Ga0495642_0007083 Ga0495642_0007083_628_1728 317
384 3300046529 Ga0495652_0062607 Ga0495652_0062607_59_1012 317
385 3300046530 Ga0495654_0011179 Ga0495654_0011179_931_2031 317
386 3300046538 Ga0495609_0009295 Ga0495609_0009295_2279_3247 317
387 3300046538 Ga0495609_0019243 Ga0495609_0019243_901_1884 317
388 3300046542 Ga0495597_0016147 Ga0495597_0016147_199_1182 317
389 3300046543 Ga0495645_0032677 Ga0495645_0032677_2349_3302 317
390 3300046615 Ga0495656_0010133 Ga0495656_0010133_1054_2022 317
391 3300046616 Ga0495668_0001457 Ga0495668_0001457_7258_8358 317
392 3300046660 Ga0495625_0003171 Ga0495625_0003171_5212_6312 317
393 3300046665 Ga0495661_0004599 Ga0495661_0004599_963_2063 317
394 3300046678 Ga0495599_0000958 Ga0495599_0000958_4931_5884 317
395 3300046679 Ga0495623_0029247 Ga0495623_0029247_1333_2286 317
396 3300046684 Ga0495669_0003621 Ga0495669_0003621_3501_4469 317
397 3300046690 Ga0495624_0029143 Ga0495624_0029143_2598_3551 317
398 3300046692 Ga0495671_0000587 Ga0495671_0000587_7631_8599 317
399 3300046692 Ga0495671_0001906 Ga0495671_0001906_7480_8580 317
400 3300046809 Ga0495600_0010800 Ga0495600_0010800_134_1087 317
401 3300047317 Ga0495604_0004982 Ga0495604_0004982_2434_3387 317
402 3300047318 Ga0495636_0031398 Ga0495636_0031398_827_1795 317
403 3300047445 Ga0495677_0006408 Ga0495677_0006408_1360_2328 317
404 3300047446 Ga0495679_006904 Ga0495679_006904_1074_2174 317
405 3300047447 Ga0495685_001357 Ga0495685_001357_3894_4994 317
406 3300047470 Ga0495681_0007929 Ga0495681_0007929_2808_3908 317
407 3300047472 Ga0495686_0052591 Ga0495686_0052591_991_1959 317
408 3300048088 Ga0495602_0189055 Ga0495602_0189055_152_1105 317
409 3300049459 Ga0495678_000323 Ga0495678_000323_22039_23022 317
410 3300053077 Ga0495601_0037333 Ga0495601_0037333_1619_2572 317
411 3300053111 Ga0500572_011010 Ga0500572_011010_818_1771 317
412 3300053119 Ga0500595_004487 Ga0500595_004487_2926_3879 317
413 3300053154 Ga0500619_000600 Ga0500619_000600_2501_3454 317

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08279

HTH_11

HTH domain

46

101

0.96

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

45

88

0.96

PF09339

HTH_IclR

IclR helix-turn-helix domain

43

88

0.95

PF13280

WYL

WYL domain

180

350

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qlz-assembly2.cif.gz_D crystal structure of transcription factor pf0095 from pyrococcus furiosus 0.9205 8 64
2ewn-assembly1.cif.gz_B ecoli biotin repressor with co-repressor analog 0.9026 6 63
5way-assembly1.cif.gz_B mgaspn protein, mga regulator from streptococcus pneumoniae 0.8966 1 47
4wf2-assembly1.cif.gz_A structure of e. coli bira g142a bound to biotinol-5'-amp 0.8926 6 69
8fi3-assembly1.cif.gz_B bifunctional ligase/repressor bira from klebsiella pneumoniae complexed with biotin (domain swapped dimer) 0.8915 6 69
ID Description Score Start End Superfamily
4a0zA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9531 4 45 1.10.10.10
4wf2A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9401 6 63 1.10.10.10
4a12C01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9344 3 45 1.10.10.10
1hxdB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9248 6 63 1.10.10.10
2vbwB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9131 6 48 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A535ERZ4-F1-model_v4 HTH domain-containing protein 0.9539 1 68 GO:0003700
AF-A0A1F5V9G1-F1-model_v4 Exonuclease domain-containing protein 0.9522 144 210 GO:0003677
GO:0003887
GO:0005829
GO:0008408
GO:0045004
AF-A0A1F6PI14-F1-model_v4 WYL domain-containing protein 0.9488 145 215
AF-A0A2N6E8Z0-F1-model_v4 WYL domain-containing protein 0.9424 146 215
AF-A0A535ERZ4-F1-model_v4 HTH domain-containing protein 0.9407 1 68 GO:0003700

Feature Viewer

pLDDT pTM Quality
80.69 0.54 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map