metagRoot

F438126

General Info

Members	Datasets	Scaffolds	Average Seq Length
413	254	413	121

Family's Representative Sequence

Representative Sequence	3300045049\|Ga0466959_0145754\|Ga0466959_0145754_1182_1622
Length	146
Sequence	MIHARHARQFVNGVDSRMYLACAADDNHDVMSVLIVDDHPAYRASARRLLEAEGFDVIGEAGDGHAGIAAVRELHPDLVVLDVQLPDIDGFEVAARIAALGLSSAVVLVSSRNRAEYGALVTDSAVRGFVPKAELSGAALTALMSP

Samples

	Sample ID	Description	Type	Environment
1	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
2	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
3	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
4	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
5	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
6	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
7	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
8	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
9	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
10	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
11	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
12	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
13	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
14	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
15	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
16	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
17	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
18	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
19	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
20	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
21	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
22	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
23	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
24	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
25	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
26	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
27	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
28	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
29	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
30	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
31	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
32	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
33	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
34	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
35	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
36	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
37	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
38	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
39	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
40	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
41	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
42	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
43	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
44	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
45	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
46	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
47	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
48	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
49	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
50	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
51	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
52	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
53	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
54	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
55	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
56	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
57	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
58	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
59	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
60	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
61	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
62	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
63	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
64	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
65	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
66	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
67	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
68	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
69	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
70	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
71	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
72	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
73	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
74	3300009982	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG	Metagenome	Rhizosphere
75	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
76	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
77	3300012500	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610	Metagenome	Rhizosphere
78	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
79	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
80	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
81	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
82	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
83	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
84	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
85	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
86	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
87	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
88	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
89	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
90	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
135	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
136	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
137	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
138	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
139	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
140	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
141	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
142	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
143	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
144	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
145	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
146	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
147	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
148	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
149	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
150	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
151	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
152	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
153	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
154	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
155	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
156	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
157	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
158	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
159	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
160	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
161	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
162	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
163	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
164	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
165	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
166	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
167	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
168	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
169	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
170	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
171	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
172	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
173	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
174	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
175	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
176	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
177	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
178	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
179	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
180	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
181	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
182	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
183	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
184	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
185	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
186	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
187	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
188	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
189	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
190	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
191	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
192	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
193	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
194	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
195	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
196	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
197	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
198	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
199	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
200	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
201	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
202	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
203	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
204	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
205	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
206	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
207	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
208	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
209	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
210	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
211	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
212	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
213	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
214	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
215	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
216	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
217	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
218	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
219	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
220	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
221	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
222	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
223	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
224	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
225	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
226	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
227	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
228	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
229	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
230	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
231	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
232	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
233	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
234	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
235	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
236	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
237	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
238	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
239	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
240	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
241	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
242	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
243	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
244	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
245	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
246	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
247	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
248	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
249	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
250	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
251	3300059641	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
252	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
253	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
254	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.76
Metatranscriptomes	0.24
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0.48
Nodule	0
Rhizoplane	13.8
Rhizosphere	82.57
Stem	0
Stem Tuber	0
Unclassified	3.15

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0070658_10034862	3300005327	Bacteria	4051
2	Ga0070658_11172466	3300005327	Bacteria	668
3	Ga0070690_100011988	3300005330	Bacteria	5087
4	Ga0070690_100140546	3300005330	Bacteria	1638
5	Ga0068869_100077094	3300005334	Unclassified	2479
6	Ga0070680_100049972	3300005336	Bacteria	3410
7	Ga0070682_100089181	3300005337	Bacteria	2014
8	Ga0068868_100022664	3300005338	Bacteria	4744
9	Ga0070660_100793476	3300005339	Unclassified	796
10	Ga0070689_100234750	3300005340	Bacteria	1509
11	Ga0070687_100036461	3300005343	Bacteria	2451
12	Ga0070661_100054249	3300005344	Bacteria	2936
13	Ga0070692_10007844	3300005345	Bacteria	4731
14	Ga0070668_101660140	3300005347	Bacteria	586
15	Ga0070675_101879656	3300005354	Bacteria	552
16	Ga0070675_102077349	3300005354	Unclassified	524
17	Ga0070671_100301626	3300005355	Bacteria	1364
18	Ga0070674_100082485	3300005356	Bacteria	2300
19	Ga0070688_100006882	3300005365	Bacteria	6104
20	Ga0070659_100020810	3300005366	Bacteria	4989
21	Ga0070667_100248733	3300005367	Bacteria	1589
22	Ga0070667_100746596	3300005367	Bacteria	907
23	Ga0070703_10056245	3300005406	Bacteria	1273
24	Ga0070714_100012948	3300005435	Bacteria	6670
25	Ga0070714_100184081	3300005435	Bacteria	1902
26	Ga0070714_101362139	3300005435	Unclassified	693
27	Ga0070714_101661679	3300005435	Bacteria	624
28	Ga0070713_100686398	3300005436	Bacteria	977
29	Ga0070710_10021354	3300005437	Bacteria	3372
30	Ga0070710_10767113	3300005437	Bacteria	686
31	Ga0070705_100312491	3300005440	Bacteria	1131
32	Ga0070700_100082993	3300005441	Bacteria	2073
33	Ga0070694_100123616	3300005444	Bacteria	1860
34	Ga0070678_100577991	3300005456	Bacteria	1001
35	Ga0070681_10035455	3300005458	Bacteria	5012
36	Ga0068867_100152129	3300005459	Bacteria	1818
37	Ga0070685_10035328	3300005466	Bacteria	2819
38	Ga0070679_100045953	3300005530	Bacteria	4351
39	Ga0070684_100069403	3300005535	Bacteria	3099
40	Ga0070684_100413717	3300005535	Bacteria	1244
41	Ga0070697_100311226	3300005536	Bacteria	1355
42	Ga0068853_100022240	3300005539	Bacteria	5294
43	Ga0070672_100150851	3300005543	Bacteria	1923
44	Ga0070693_100002012	3300005547	Bacteria	9306
45	Ga0070665_100049397	3300005548	Bacteria	4221
46	Ga0070704_100048993	3300005549	Bacteria	2961
47	Ga0068855_100215761	3300005563	Bacteria	2154
48	Ga0070664_100201405	3300005564	Bacteria	1777
49	Ga0068854_100023457	3300005578	Bacteria	4215
50	Ga0070702_100010417	3300005615	Bacteria	4579
51	Ga0068852_100004245	3300005616	Bacteria	10118
52	Ga0068859_100188470	3300005617	Bacteria	2147
53	Ga0068864_100581454	3300005618	Bacteria	1085
54	Ga0068866_10097807	3300005718	Bacteria	1613
55	Ga0068866_10192248	3300005718	Bacteria	1213
56	Ga0068870_10289710	3300005840	Unclassified	1029
57	Ga0068863_100421181	3300005841	Bacteria	1308
58	Ga0068860_100344036	3300005843	Bacteria	1467
59	Ga0081455_10148884	3300005937	Bacteria	1807
60	Ga0081455_10179087	3300005937	Bacteria	1607
61	Ga0081538_10000010	3300005981	Bacteria	164857
62	Ga0070717_10093815	3300006028	Bacteria	2538
63	Ga0070717_10173600	3300006028	Bacteria	1876
64	Ga0075365_10060425	3300006038	Bacteria	2528
65	Ga0070715_10000385	3300006163	Bacteria	11053
66	Ga0070716_100053876	3300006173	Bacteria	2296
67	Ga0070716_100827045	3300006173	Bacteria	719
68	Ga0070712_100037193	3300006175	Bacteria	3316
69	Ga0070712_100101935	3300006175	Bacteria	2125
70	Ga0070712_100456155	3300006175	Bacteria	1065
71	Ga0070712_100923347	3300006175	Bacteria	753
72	Ga0097621_100032477	3300006237	Bacteria	4150
73	Ga0068871_100198159	3300006358	Bacteria	1732
74	Ga0075428_100045623	3300006844	Bacteria	4815
75	Ga0075431_101123210	3300006847	Unclassified	750
76	Ga0075433_10508517	3300006852	Bacteria	1060
77	Ga0075434_100047727	3300006871	Bacteria	4249
78	Ga0068865_100082018	3300006881	Bacteria	2317
79	Ga0097620_100188475	3300006931	Bacteria	2147
80	Ga0097620_101895610	3300006931	Bacteria	658
81	Ga0075435_100025073	3300007076	Bacteria	4638
82	Ga0111539_10977732	3300009094	Bacteria	984
83	Ga0105245_10027432	3300009098	Bacteria	5017
84	Ga0105245_10034756	3300009098	Bacteria	4472
85	Ga0105245_11924726	3300009098	Bacteria	644
86	Ga0114129_10026901	3300009147	Bacteria	8143
87	Ga0114129_11895658	3300009147	Bacteria	723
88	Ga0105243_10053604	3300009148	Bacteria	3200
89	Ga0105243_10061985	3300009148	Bacteria	2992
90	Ga0105243_11851591	3300009148	Bacteria	635
91	Ga0105241_10026844	3300009174	Bacteria	4286
92	Ga0105242_10246260	3300009176	Bacteria	1609
93	Ga0105242_11814485	3300009176	Bacteria	649
94	Ga0105248_10677208	3300009177	Bacteria	1164
95	Ga0105248_10721932	3300009177	Bacteria	1124
96	Ga0105248_11572427	3300009177	Bacteria	745
97	Ga0105238_11258953	3300009551	Bacteria	765
98	Ga0105249_10459993	3300009553	Bacteria	1312
99	Ga0105249_11178406	3300009553	Unclassified	837
100	Ga0105147_108185	3300009982	Unclassified	888
101	Ga0105239_10281140	3300010375	Bacteria	1873
102	Ga0105239_11347709	3300010375	Bacteria	823
103	Ga0105246_10028527	3300011119	Bacteria	3667
104	Ga0157314_1033589	3300012500	Unclassified	588
105	Ga0157371_10177176	3300013102	Bacteria	1524
106	Ga0157369_10148401	3300013105	Bacteria	2479
107	Ga0157374_10358963	3300013296	Bacteria	1449
108	Ga0157378_10055973	3300013297	Bacteria	3514
109	Ga0157372_10035697	3300013307	Bacteria	5474
110	Ga0157375_10025485	3300013308	Bacteria	5495
111	Ga0163163_10115432	3300014325	Bacteria	2716
112	Ga0157380_10463780	3300014326	Bacteria	1220
113	Ga0157377_10017807	3300014745	Bacteria	3682
114	Ga0157376_10025006	3300014969	Bacteria	4698
115	Ga0213876_10016419	3300021384	Bacteria	3913
116	Ga0213876_10021359	3300021384	Bacteria	3424
117	Ga0213876_10067546	3300021384	Bacteria	1888
118	Ga0213876_10091852	3300021384	Bacteria	1608
119	Ga0213875_10099203	3300021388	Bacteria	1359
120	Ga0213875_10176462	3300021388	Bacteria	1003
121	Ga0207656_10168920	3300025321	Bacteria	1044
122	Ga0207692_10074282	3300025898	Bacteria	1801
123	Ga0207692_10423619	3300025898	Bacteria	834
124	Ga0207642_10073330	3300025899	Bacteria	1637
125	Ga0207642_10253264	3300025899	Bacteria	1000
126	Ga0207642_10783748	3300025899	Bacteria	605
127	Ga0207688_10071185	3300025901	Bacteria	1974
128	Ga0207685_10001225	3300025905	Bacteria	5214
129	Ga0207705_10018047	3300025909	Bacteria	5046
130	Ga0207705_10657840	3300025909	Bacteria	815
131	Ga0207684_10362243	3300025910	Bacteria	1248
132	Ga0207654_10014985	3300025911	Bacteria	4015
133	Ga0207707_10193572	3300025912	Bacteria	1774
134	Ga0207671_10294082	3300025914	Bacteria	1283
135	Ga0207693_10010558	3300025915	Bacteria	7494
136	Ga0207660_10083487	3300025917	Bacteria	2352
137	Ga0207662_10314182	3300025918	Bacteria	1045
138	Ga0207657_10024560	3300025919	Bacteria	5574
139	Ga0207652_11226074	3300025921	Bacteria	652
140	Ga0207687_10233291	3300025927	Bacteria	1455
141	Ga0207687_10254390	3300025927	Bacteria	1398
142	Ga0207700_10193842	3300025928	Bacteria	1709
143	Ga0207664_10019423	3300025929	Bacteria	5023
144	Ga0207664_10158113	3300025929	Bacteria	1931
145	Ga0207644_10201324	3300025931	Bacteria	1571
146	Ga0207690_10080665	3300025932	Bacteria	2271
147	Ga0207686_10190850	3300025934	Bacteria	1460
148	Ga0207670_10035057	3300025936	Bacteria	3250
149	Ga0207669_10010726	3300025937	Bacteria	4425
150	Ga0207665_10317042	3300025939	Unclassified	1169
151	Ga0207691_10593381	3300025940	Bacteria	938
152	Ga0207711_10296207	3300025941	Bacteria	1492
153	Ga0207711_10651945	3300025941	Bacteria	982
154	Ga0207689_10111244	3300025942	Bacteria	2251
155	Ga0207661_10200742	3300025944	Bacteria	1753
156	Ga0207679_10184022	3300025945	Bacteria	1731
157	Ga0207667_10211531	3300025949	Bacteria	1988
158	Ga0207712_10451737	3300025961	Bacteria	1090
159	Ga0207668_10089835	3300025972	Bacteria	2253
160	Ga0207668_10440588	3300025972	Bacteria	1110
161	Ga0207640_10065083	3300025981	Bacteria	2431
162	Ga0207658_11689906	3300025986	Bacteria	578
163	Ga0207677_10089641	3300026023	Bacteria	2233
164	Ga0207639_10120299	3300026041	Bacteria	2156
165	Ga0207678_11017464	3300026067	Bacteria	733
166	Ga0207708_10001058	3300026075	Bacteria	20624
167	Ga0207708_11882167	3300026075	Bacteria	524
168	Ga0207702_10188613	3300026078	Unclassified	1903
169	Ga0207648_10050404	3300026089	Bacteria	3640
170	Ga0207674_10027032	3300026116	Bacteria	6080
171	Ga0207675_100537722	3300026118	Bacteria	1166
172	Ga0207683_10293657	3300026121	Bacteria	1486
173	Ga0207683_10318960	3300026121	Unclassified	1423
174	Ga0268266_10146395	3300028379	Bacteria	2124
175	Ga0373954_0098241	3300035118	Bacteria	1411
176	Ga0373943_0111544	3300035170	Bacteria	1443
177	Ga0373943_0583871	3300035170	Bacteria	657
178	Ga0373955_0170470	3300035172	Bacteria	1288
179	Ga0373962_0117169	3300035242	Bacteria	846
180	Ga0373935_1397138	3300035692	Bacteria	523
181	Ga0373927_0910855	3300035695	Bacteria	580
182	Ga0373937_0082298	3300036401	Bacteria	2978
183	Ga0373937_2139010	3300036401	Bacteria	506
184	Ga0373925_0613430	3300037068	Bacteria	896
185	Ga0395898_1611814	3300037466	Bacteria	573
186	Ga0436364_0585441	3300037853	Bacteria	6252
187	Ga0436364_0601973	3300037853	Bacteria	29284
188	Ga0395901_0197570	3300038443	Bacteria	2109
189	Ga0436365_1236969	3300039437	Bacteria	9369
190	Ga0436365_1398074	3300039437	Bacteria	12911
191	Ga0436365_1519764	3300039437	Bacteria	12777
192	Ga0436365_1596326	3300039437	Bacteria	2630
193	Ga0436363_0168801	3300039450	Bacteria	3340
194	Ga0436362_0506620	3300039453	Bacteria	4988
195	Ga0466963_0111221	3300044694	Bacteria	1880
196	Ga0466963_0239269	3300044694	Bacteria	1273
197	Ga0466963_0732512	3300044694	Bacteria	697
198	Ga0466968_0137921	3300044735	Bacteria	1114
199	Ga0466957_0329420	3300044842	Bacteria	1032
200	Ga0466957_0350785	3300044842	Bacteria	1001
201	Ga0466960_0512873	3300044901	Bacteria	704
202	Ga0466959_0145754	3300045049	Bacteria	1671
203	Ga0466959_0303169	3300045049	Unclassified	1094
204	Ga0466959_0379391	3300045049	Bacteria	962
205	Ga0466959_0388355	3300045049	Bacteria	949
206	Ga0466959_0589551	3300045049	Bacteria	748
207	Ga0466959_0685998	3300045049	Bacteria	687
208	Ga0466958_0048986	3300045836	Bacteria	2555
209	Ga0466958_0079749	3300045836	Bacteria	2013
210	Ga0466958_0118493	3300045836	Bacteria	1656
211	Ga0466958_0606797	3300045836	Bacteria	712
212	Ga0466958_0776613	3300045836	Bacteria	625
213	Ga0466967_0044633	3300045976	Bacteria	3846
214	Ga0466967_0146352	3300045976	Bacteria	2204
215	Ga0466967_0393227	3300045976	Bacteria	1348
216	Ga0466967_1534668	3300045976	Bacteria	663
217	Ga0495592_0206960	3300046454	Bacteria	1320
218	Ga0495603_0070232	3300046455	Bacteria	2059
219	Ga0495603_0297976	3300046455	Bacteria	926
220	Ga0495629_0103312	3300046459	Bacteria	1988
221	Ga0495651_0032007	3300046462	Bacteria	4102
222	Ga0495582_0032040	3300046473	Bacteria	2892
223	Ga0495582_0198950	3300046473	Bacteria	1144
224	Ga0495639_0123071	3300046475	Bacteria	1238
225	Ga0495584_0207602	3300046491	Bacteria	996
226	Ga0495608_0032206	3300046511	Bacteria	3543
227	Ga0495618_0017849	3300046514	Bacteria	4354
228	Ga0495628_0578916	3300046516	Bacteria	804
229	Ga0495628_0585121	3300046516	Unclassified	798
230	Ga0495630_0012509	3300046517	Bacteria	6164
231	Ga0495630_0838631	3300046517	Bacteria	701
232	Ga0495652_0600081	3300046529	Unclassified	751
233	Ga0495665_0180561	3300046531	Bacteria	1097
234	Ga0495640_0042362	3300046533	Bacteria	3177
235	Ga0495640_0275795	3300046533	Unclassified	1048
236	Ga0495640_0335200	3300046533	Bacteria	935
237	Ga0495586_0004184	3300046535	Bacteria	7730
238	Ga0495587_0072289	3300046536	Bacteria	2005
239	Ga0495645_0551183	3300046543	Bacteria	715
240	Ga0495667_0008888	3300046559	Bacteria	6829
241	Ga0495667_0799079	3300046559	Bacteria	582
242	Ga0495634_0043153	3300046642	Bacteria	3057
243	Ga0495634_0118508	3300046642	Bacteria	1696
244	Ga0495635_0086976	3300046663	Bacteria	2138
245	Ga0495635_0670429	3300046663	Bacteria	674
246	Ga0495635_0724257	3300046663	Bacteria	644
247	Ga0495657_0025369	3300046675	Bacteria	4210
248	Ga0495599_0360624	3300046678	Bacteria	870
249	Ga0495646_0316667	3300046680	Unclassified	822
250	Ga0495647_0100305	3300046681	Bacteria	1198
251	Ga0495658_0025224	3300046683	Bacteria	3175
252	Ga0495658_0228980	3300046683	Bacteria	1165
253	Ga0495658_0309496	3300046683	Bacteria	1000
254	Ga0495613_0046765	3300046689	Bacteria	3199
255	Ga0495613_0085791	3300046689	Bacteria	2284
256	Ga0495613_0821104	3300046689	Bacteria	606
257	Ga0495649_0584048	3300046694	Bacteria	552
258	Ga0495600_0047253	3300046809	Bacteria	2807
259	Ga0495581_0108329	3300047315	Bacteria	1615
260	Ga0495604_0110029	3300047317	Bacteria	2010
261	Ga0495674_0043379	3300047319	Bacteria	4003
262	Ga0495674_0044887	3300047319	Bacteria	3927
263	Ga0495674_0163538	3300047319	Bacteria	1861
264	Ga0495674_1470962	3300047319	Unclassified	505
265	Ga0495676_0003139	3300047321	Bacteria	14946
266	Ga0495676_0215185	3300047321	Unclassified	1327
267	Ga0495676_0938661	3300047321	Unclassified	553
268	Ga0495680_0073913	3300047322	Bacteria	2589
269	Ga0495675_0024205	3300047444	Bacteria	3871
270	Ga0495684_0073281	3300047471	Bacteria	2601
271	Ga0495593_0038140	3300047673	Bacteria	2596
272	Ga0495602_0106508	3300048088	Bacteria	2288
273	Ga0496100_0041276	3300048903	Bacteria	2940
274	Ga0496100_0057329	3300048903	Bacteria	2551
275	Ga0496100_0354332	3300048903	Unclassified	1109
276	Ga0496101_0046249	3300048904	Bacteria	3120
277	Ga0496101_0063044	3300048904	Bacteria	2697
278	Ga0496101_0251274	3300048904	Bacteria	1378
279	Ga0496102_0137755	3300048905	Bacteria	2287
280	Ga0496102_0146812	3300048905	Bacteria	2214
281	Ga0496102_0228767	3300048905	Bacteria	1753
282	Ga0496103_0394919	3300048906	Bacteria	888
283	Ga0496103_0438113	3300048906	Bacteria	838
284	Ga0496104_0001004	3300048907	Bacteria	24153
285	Ga0496104_0112195	3300048907	Bacteria	2614
286	Ga0496104_0214140	3300048907	Bacteria	1838
287	Ga0496104_0642435	3300048907	Bacteria	970
288	Ga0496105_0009822	3300048908	Bacteria	7499
289	Ga0496105_0012611	3300048908	Bacteria	6693
290	Ga0496105_0158414	3300048908	Unclassified	1859
291	Ga0496106_0135091	3300048909	Bacteria	1936
292	Ga0496106_0420205	3300048909	Bacteria	1074
293	Ga0496106_1111150	3300048909	Bacteria	619
294	Ga0496106_1439584	3300048909	Bacteria	531
295	Ga0496107_0023776	3300048910	Bacteria	4331
296	Ga0496107_0101994	3300048910	Bacteria	2104
297	Ga0496107_0135283	3300048910	Bacteria	1821
298	Ga0496107_0986277	3300048910	Bacteria	612
299	Ga0496108_0024898	3300048911	Bacteria	4929
300	Ga0496108_0114602	3300048911	Bacteria	2308
301	Ga0496108_0174539	3300048911	Bacteria	1860
302	Ga0496108_0808423	3300048911	Bacteria	809
303	Ga0496109_0035261	3300048912	Bacteria	4511
304	Ga0496109_0107805	3300048912	Bacteria	2588
305	Ga0496109_0175478	3300048912	Bacteria	2011
306	Ga0496109_0179752	3300048912	Bacteria	1986
307	Ga0496109_1537051	3300048912	Bacteria	600
308	Ga0496109_1997061	3300048912	Bacteria	512
309	Ga0496110_0087857	3300048913	Bacteria	2776
310	Ga0496110_0274460	3300048913	Bacteria	1535
311	Ga0496110_1639442	3300048913	Bacteria	553
312	Ga0496111_0130505	3300048914	Bacteria	1859
313	Ga0496111_0325360	3300048914	Bacteria	1138
314	Ga0496111_0375191	3300048914	Bacteria	1052
315	Ga0496112_0182477	3300048915	Unclassified	2062
316	Ga0496112_0270712	3300048915	Bacteria	1647
317	Ga0496112_0842396	3300048915	Bacteria	841
318	Ga0496113_0102165	3300048916	Unclassified	2223
319	Ga0496113_0147090	3300048916	Bacteria	1857
320	Ga0496113_0524746	3300048916	Bacteria	950
321	Ga0496113_0657274	3300048916	Bacteria	838
322	Ga0496114_0139156	3300048917	Bacteria	2100
323	Ga0496114_0190644	3300048917	Bacteria	1794
324	Ga0496114_0278656	3300048917	Bacteria	1474
325	Ga0496114_0563023	3300048917	Bacteria	1006
326	Ga0496114_1269540	3300048917	Unclassified	623
327	Ga0496115_0022435	3300048918	Bacteria	4891
328	Ga0496115_0036727	3300048918	Bacteria	3880
329	Ga0496115_1390549	3300048918	Bacteria	519
330	Ga0501031_0054684	3300049568	Bacteria	2600
331	Ga0501031_0063181	3300049568	Bacteria	2412
332	Ga0501032_0119922	3300049569	Bacteria	1739
333	Ga0501033_0137964	3300049570	Bacteria	1764
334	Ga0501033_0196719	3300049570	Bacteria	1441
335	Ga0501036_0007611	3300049572	Bacteria	8842
336	Ga0501036_0024532	3300049572	Bacteria	5084
337	Ga0501037_0006018	3300049573	Bacteria	8854
338	Ga0501038_0043372	3300049574	Bacteria	3911
339	Ga0501039_0005166	3300049575	Bacteria	9891
340	Ga0501039_0086466	3300049575	Bacteria	2441
341	Ga0501040_0007503	3300049576	Bacteria	7056
342	Ga0501040_0032928	3300049576	Bacteria	3508
343	Ga0501041_0009454	3300049577	Bacteria	5747
344	Ga0501041_0024200	3300049577	Bacteria	3644
345	Ga0501042_0007022	3300049578	Bacteria	7352
346	Ga0501042_1166670	3300049578	Bacteria	561
347	Ga0501043_0260661	3300049579	Bacteria	1333
348	Ga0501046_0005774	3300049580	Bacteria	11047
349	Ga0501046_0111213	3300049580	Bacteria	2092
350	Ga0501047_0928364	3300049581	Bacteria	684
351	Ga0501048_0006542	3300049582	Bacteria	8858
352	Ga0501048_0175336	3300049582	Bacteria	1519
353	Ga0501067_0127561	3300049583	Unclassified	1415
354	Ga0501068_0000099	3300049584	Bacteria	37456
355	Ga0501068_0117188	3300049584	Bacteria	1659
356	Ga0501068_0202341	3300049584	Bacteria	1259
357	Ga0501068_0429504	3300049584	Bacteria	853
358	Ga0501069_0000464	3300049585	Bacteria	18535
359	Ga0501069_0128341	3300049585	Unclassified	1451
360	Ga0501069_0349252	3300049585	Bacteria	872
361	Ga0501069_0463889	3300049585	Bacteria	753
362	Ga0501070_0037578	3300049586	Bacteria	4042
363	Ga0501070_0041928	3300049586	Bacteria	3811
364	Ga0501071_0047484	3300049587	Bacteria	3084
365	Ga0501071_0094665	3300049587	Bacteria	2197
366	Ga0501072_0007315	3300049588	Bacteria	8373
367	Ga0501072_0009217	3300049588	Bacteria	7499
368	Ga0501073_0103182	3300049589	Bacteria	1980
369	Ga0501073_0572419	3300049589	Bacteria	780
370	Ga0501074_0024636	3300049590	Bacteria	4371
371	Ga0501075_0015911	3300049591	Bacteria	5409
372	Ga0501075_0111342	3300049591	Bacteria	2081
373	Ga0501075_0777332	3300049591	Bacteria	729
374	Ga0501076_0010224	3300049592	Bacteria	6955
375	Ga0501076_0118025	3300049592	Bacteria	2147
376	Ga0501077_0016943	3300049593	Bacteria	4596
377	Ga0501077_0024566	3300049593	Bacteria	3827
378	Ga0501079_0020352	3300049741	Bacteria	5070
379	Ga0501079_1235515	3300049741	Bacteria	588
380	Ga0501080_0027831	3300049742	Bacteria	5256
381	Ga0501080_0172312	3300049742	Bacteria	1995
382	Ga0501081_0018426	3300049743	Bacteria	4637
383	Ga0501081_0027738	3300049743	Bacteria	3817
384	Ga0501081_0281955	3300049743	Bacteria	1217
385	Ga0501083_0122892	3300049744	Bacteria	1702
386	Ga0501083_0346020	3300049744	Bacteria	966
387	Ga0501035_0118196	3300049822	Bacteria	2319
388	Ga0501044_0377251	3300049823	Bacteria	1334
389	Ga0501044_0764967	3300049823	Bacteria	847
390	Ga0501045_0076302	3300049824	Bacteria	2469
391	Ga0501045_0132564	3300049824	Bacteria	1852
392	nmdc:mga0yw44_93113_c1	3300050492	Bacteria	1908
393	nmdc:mga05p37_119329_c1	3300050507	Bacteria	3240
394	nmdc:mga0n895_261607_c1	3300050512	Bacteria	1756
395	nmdc:mga0rr50_1366367_c1	3300050513	Bacteria	600
396	nmdc:mga0rr50_24472_c1	3300050513	Bacteria	4181
397	nmdc:mga0a205_45380_c1	3300050515	Bacteria	4237
398	Ga0495601_0145512	3300053077	Bacteria	1547
399	Ga0495612_0043846	3300053078	Bacteria	1829
400	Ga0495655_0116116	3300053083	Unclassified	810
401	Ga0495595_0017151	3300053084	Bacteria	3112
402	Ga0495619_0020613	3300053085	Bacteria	4202
403	Ga0495619_0700883	3300053085	Unclassified	688
404	Ga0501084_0026177	3300054114	Bacteria	4865
405	Ga0501084_0058092	3300054114	Bacteria	3236
406	Ga0587068_054291	3300059641	Bacteria	757
407	Ga0501082_0004324	3300060353	Bacteria	12422
408	Ga0501082_0062024	3300060353	Bacteria	3217
409	Ga0466962_0168835	3300061719	Bacteria	1065
410	Ga0530510_0002988	3300061734	Bacteria	11597
411	Ga0530510_0038992	3300061734	Bacteria	3430
412	Ga0530510_0197305	3300061734	Bacteria	1494
413	Ga0530510_0897695	3300061734	Unclassified	677

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300005435	Ga0070714_101661679	Ga0070714_1016616791	110
2	3300009147	Ga0114129_10026901	Ga0114129_100269016	111
3	3300050507	nmdc:mga05p37_119329_c1	nmdc:mga05p37_119329_c1_2555_2896	111
4	3300005937	Ga0081455_10179087	Ga0081455_101790872	115
5	3300006844	Ga0075428_100045623	Ga0075428_1000456236	115
6	3300006847	Ga0075431_101123210	Ga0075431_1011232101	115
7	3300009553	Ga0105249_11178406	Ga0105249_111784062	115
8	3300047319	Ga0495674_1470962	Ga0495674_1470962_79_456	115
9	3300048908	Ga0496105_0158414	Ga0496105_0158414_1423_1800	115
10	3300005435	Ga0070714_100012948	Ga0070714_1000129484	116
11	3300005436	Ga0070713_100686398	Ga0070713_1006863982	116
12	3300005437	Ga0070710_10767113	Ga0070710_107671132	116
13	3300005981	Ga0081538_10000010	Ga0081538_1000001033	116
14	3300006028	Ga0070717_10093815	Ga0070717_100938152	116
15	3300006028	Ga0070717_10173600	Ga0070717_101736002	116
16	3300021384	Ga0213876_10021359	Ga0213876_100213592	116
17	3300025928	Ga0207700_10193842	Ga0207700_101938422	116
18	3300025929	Ga0207664_10019423	Ga0207664_100194235	116
19	3300037853	Ga0436364_0601973	Ga0436364_0601973_19577_19930	116
20	3300039437	Ga0436365_1398074	Ga0436365_1398074_9165_9518	116
21	3300039437	Ga0436365_1519764	Ga0436365_1519764_2652_3005	116
22	3300039450	Ga0436363_0168801	Ga0436363_0168801_2603_2956	116
23	3300039453	Ga0436362_0506620	Ga0436362_0506620_2551_2904	116
24	3300005327	Ga0070658_10034862	Ga0070658_100348623	117
25	3300005327	Ga0070658_11172466	Ga0070658_111724662	117
26	3300005330	Ga0070690_100011988	Ga0070690_1000119882	117
27	3300005330	Ga0070690_100140546	Ga0070690_1001405462	117
28	3300005334	Ga0068869_100077094	Ga0068869_1000770942	117
29	3300005336	Ga0070680_100049972	Ga0070680_1000499721	117
30	3300005337	Ga0070682_100089181	Ga0070682_1000891812	117
31	3300005338	Ga0068868_100022664	Ga0068868_1000226642	117
32	3300005339	Ga0070660_100793476	Ga0070660_1007934762	117
33	3300005340	Ga0070689_100234750	Ga0070689_1002347503	117
34	3300005343	Ga0070687_100036461	Ga0070687_1000364612	117
35	3300005344	Ga0070661_100054249	Ga0070661_1000542493	117
36	3300005345	Ga0070692_10007844	Ga0070692_100078442	117
37	3300005347	Ga0070668_101660140	Ga0070668_1016601402	117
38	3300005354	Ga0070675_101879656	Ga0070675_1018796561	117
39	3300005354	Ga0070675_102077349	Ga0070675_1020773491	117
40	3300005355	Ga0070671_100301626	Ga0070671_1003016262	117
41	3300005356	Ga0070674_100082485	Ga0070674_1000824852	117
42	3300005365	Ga0070688_100006882	Ga0070688_1000068822	117
43	3300005366	Ga0070659_100020810	Ga0070659_1000208104	117
44	3300005367	Ga0070667_100248733	Ga0070667_1002487332	117
45	3300005367	Ga0070667_100746596	Ga0070667_1007465962	117
46	3300005406	Ga0070703_10056245	Ga0070703_100562452	117
47	3300005435	Ga0070714_100184081	Ga0070714_1001840812	117
48	3300005435	Ga0070714_101362139	Ga0070714_1013621392	117
49	3300005437	Ga0070710_10021354	Ga0070710_100213543	117
50	3300005440	Ga0070705_100312491	Ga0070705_1003124911	117
51	3300005441	Ga0070700_100082993	Ga0070700_1000829932	117
52	3300005444	Ga0070694_100123616	Ga0070694_1001236162	117
53	3300005456	Ga0070678_100577991	Ga0070678_1005779912	117
54	3300005458	Ga0070681_10035455	Ga0070681_100354552	117
55	3300005459	Ga0068867_100152129	Ga0068867_1001521292	117
56	3300005466	Ga0070685_10035328	Ga0070685_100353282	117
57	3300005530	Ga0070679_100045953	Ga0070679_1000459536	117
58	3300005535	Ga0070684_100069403	Ga0070684_1000694031	117
59	3300005535	Ga0070684_100413717	Ga0070684_1004137171	117
60	3300005536	Ga0070697_100311226	Ga0070697_1003112262	117
61	3300005539	Ga0068853_100022240	Ga0068853_1000222402	117
62	3300005543	Ga0070672_100150851	Ga0070672_1001508512	117
63	3300005547	Ga0070693_100002012	Ga0070693_1000020126	117
64	3300005548	Ga0070665_100049397	Ga0070665_1000493974	117
65	3300005549	Ga0070704_100048993	Ga0070704_1000489932	117
66	3300005563	Ga0068855_100215761	Ga0068855_1002157612	117
67	3300005564	Ga0070664_100201405	Ga0070664_1002014053	117
68	3300005578	Ga0068854_100023457	Ga0068854_1000234572	117
69	3300005615	Ga0070702_100010417	Ga0070702_1000104172	117
70	3300005616	Ga0068852_100004245	Ga0068852_1000042455	117
71	3300005617	Ga0068859_100188470	Ga0068859_1001884702	117
72	3300005618	Ga0068864_100581454	Ga0068864_1005814542	117
73	3300005718	Ga0068866_10097807	Ga0068866_100978072	117
74	3300005718	Ga0068866_10192248	Ga0068866_101922482	117
75	3300005840	Ga0068870_10289710	Ga0068870_102897102	117
76	3300005841	Ga0068863_100421181	Ga0068863_1004211812	117
77	3300005843	Ga0068860_100344036	Ga0068860_1003440362	117
78	3300005937	Ga0081455_10148884	Ga0081455_101488842	117
79	3300006038	Ga0075365_10060425	Ga0075365_100604252	117
80	3300006163	Ga0070715_10000385	Ga0070715_1000038511	117
81	3300006173	Ga0070716_100053876	Ga0070716_1000538762	117
82	3300006173	Ga0070716_100827045	Ga0070716_1008270452	117
83	3300006175	Ga0070712_100037193	Ga0070712_1000371933	117
84	3300006175	Ga0070712_100101935	Ga0070712_1001019352	117
85	3300006175	Ga0070712_100456155	Ga0070712_1004561552	117
86	3300006175	Ga0070712_100923347	Ga0070712_1009233471	117
87	3300006237	Ga0097621_100032477	Ga0097621_1000324776	117
88	3300006358	Ga0068871_100198159	Ga0068871_1001981592	117
89	3300006852	Ga0075433_10508517	Ga0075433_105085172	117
90	3300006871	Ga0075434_100047727	Ga0075434_1000477272	117
91	3300006881	Ga0068865_100082018	Ga0068865_1000820183	117
92	3300006931	Ga0097620_100188475	Ga0097620_1001884752	117
93	3300006931	Ga0097620_101895610	Ga0097620_1018956102	117
94	3300007076	Ga0075435_100025073	Ga0075435_1000250733	117
95	3300009094	Ga0111539_10977732	Ga0111539_109777322	117
96	3300009098	Ga0105245_10027432	Ga0105245_100274323	117
97	3300009098	Ga0105245_10034756	Ga0105245_100347562	117
98	3300009098	Ga0105245_11924726	Ga0105245_119247261	117
99	3300009147	Ga0114129_11895658	Ga0114129_118956582	117
100	3300009148	Ga0105243_10053604	Ga0105243_100536043	117
101	3300009148	Ga0105243_10061985	Ga0105243_100619854	117
102	3300009148	Ga0105243_11851591	Ga0105243_118515911	117
103	3300009174	Ga0105241_10026844	Ga0105241_100268443	117
104	3300009176	Ga0105242_10246260	Ga0105242_102462602	117
105	3300009176	Ga0105242_11814485	Ga0105242_118144852	117
106	3300009177	Ga0105248_10677208	Ga0105248_106772082	117
107	3300009177	Ga0105248_10721932	Ga0105248_107219322	117
108	3300009177	Ga0105248_11572427	Ga0105248_115724272	117
109	3300009551	Ga0105238_11258953	Ga0105238_112589531	117
110	3300009553	Ga0105249_10459993	Ga0105249_104599932	117
111	3300009982	Ga0105147_108185	Ga0105147_1081852	117
112	3300010375	Ga0105239_10281140	Ga0105239_102811402	117
113	3300010375	Ga0105239_11347709	Ga0105239_113477092	117
114	3300011119	Ga0105246_10028527	Ga0105246_100285274	117
115	3300012500	Ga0157314_1033589	Ga0157314_10335891	117
116	3300013102	Ga0157371_10177176	Ga0157371_101771762	117
117	3300013105	Ga0157369_10148401	Ga0157369_101484012	117
118	3300013296	Ga0157374_10358963	Ga0157374_103589632	117
119	3300013297	Ga0157378_10055973	Ga0157378_100559732	117
120	3300013307	Ga0157372_10035697	Ga0157372_100356977	117
121	3300013308	Ga0157375_10025485	Ga0157375_100254856	117
122	3300014325	Ga0163163_10115432	Ga0163163_101154322	117
123	3300014326	Ga0157380_10463780	Ga0157380_104637802	117
124	3300014745	Ga0157377_10017807	Ga0157377_100178072	117
125	3300014969	Ga0157376_10025006	Ga0157376_100250062	117
126	3300021384	Ga0213876_10016419	Ga0213876_100164192	117
127	3300021384	Ga0213876_10067546	Ga0213876_100675463	117
128	3300021384	Ga0213876_10091852	Ga0213876_100918522	117
129	3300021388	Ga0213875_10099203	Ga0213875_100992032	117
130	3300021388	Ga0213875_10176462	Ga0213875_101764621	117
131	3300025321	Ga0207656_10168920	Ga0207656_101689202	117
132	3300025898	Ga0207692_10074282	Ga0207692_100742822	117
133	3300025898	Ga0207692_10423619	Ga0207692_104236192	117
134	3300025899	Ga0207642_10073330	Ga0207642_100733302	117
135	3300025899	Ga0207642_10253264	Ga0207642_102532642	117
136	3300025899	Ga0207642_10783748	Ga0207642_107837481	117
137	3300025901	Ga0207688_10071185	Ga0207688_100711853	117
138	3300025905	Ga0207685_10001225	Ga0207685_100012256	117
139	3300025909	Ga0207705_10018047	Ga0207705_100180473	117
140	3300025909	Ga0207705_10657840	Ga0207705_106578402	117
141	3300025910	Ga0207684_10362243	Ga0207684_103622432	117
142	3300025911	Ga0207654_10014985	Ga0207654_100149852	117
143	3300025912	Ga0207707_10193572	Ga0207707_101935722	117
144	3300025914	Ga0207671_10294082	Ga0207671_102940822	117
145	3300025915	Ga0207693_10010558	Ga0207693_100105582	117
146	3300025917	Ga0207660_10083487	Ga0207660_100834871	117
147	3300025918	Ga0207662_10314182	Ga0207662_103141822	117
148	3300025919	Ga0207657_10024560	Ga0207657_100245605	117
149	3300025921	Ga0207652_11226074	Ga0207652_112260741	117
150	3300025927	Ga0207687_10233291	Ga0207687_102332912	117
151	3300025927	Ga0207687_10254390	Ga0207687_102543901	117
152	3300025929	Ga0207664_10158113	Ga0207664_101581132	117
153	3300025931	Ga0207644_10201324	Ga0207644_102013242	117
154	3300025932	Ga0207690_10080665	Ga0207690_100806652	117
155	3300025934	Ga0207686_10190850	Ga0207686_101908502	117
156	3300025936	Ga0207670_10035057	Ga0207670_100350572	117
157	3300025937	Ga0207669_10010726	Ga0207669_100107261	117
158	3300025939	Ga0207665_10317042	Ga0207665_103170422	117
159	3300025940	Ga0207691_10593381	Ga0207691_105933812	117
160	3300025941	Ga0207711_10296207	Ga0207711_102962072	117
161	3300025941	Ga0207711_10651945	Ga0207711_106519452	117
162	3300025942	Ga0207689_10111244	Ga0207689_101112442	117
163	3300025944	Ga0207661_10200742	Ga0207661_102007423	117
164	3300025945	Ga0207679_10184022	Ga0207679_101840223	117
165	3300025949	Ga0207667_10211531	Ga0207667_102115312	117
166	3300025961	Ga0207712_10451737	Ga0207712_104517372	117
167	3300025972	Ga0207668_10089835	Ga0207668_100898352	117
168	3300025972	Ga0207668_10440588	Ga0207668_104405882	117
169	3300025981	Ga0207640_10065083	Ga0207640_100650832	117
170	3300025986	Ga0207658_11689906	Ga0207658_116899062	117
171	3300026023	Ga0207677_10089641	Ga0207677_100896412	117
172	3300026041	Ga0207639_10120299	Ga0207639_101202992	117
173	3300026067	Ga0207678_11017464	Ga0207678_110174641	117
174	3300026075	Ga0207708_10001058	Ga0207708_1000105811	117
175	3300026075	Ga0207708_11882167	Ga0207708_118821672	117
176	3300026078	Ga0207702_10188613	Ga0207702_101886132	117
177	3300026089	Ga0207648_10050404	Ga0207648_100504042	117
178	3300026116	Ga0207674_10027032	Ga0207674_100270323	117
179	3300026118	Ga0207675_100537722	Ga0207675_1005377222	117
180	3300026121	Ga0207683_10293657	Ga0207683_102936572	117
181	3300026121	Ga0207683_10318960	Ga0207683_103189602	117
182	3300028379	Ga0268266_10146395	Ga0268266_101463951	117
183	3300035118	Ga0373954_0098241	Ga0373954_0098241_278_646	117
184	3300035170	Ga0373943_0111544	Ga0373943_0111544_937_1290	117
185	3300035170	Ga0373943_0583871	Ga0373943_0583871_177_545	117
186	3300035172	Ga0373955_0170470	Ga0373955_0170470_227_595	117
187	3300035242	Ga0373962_0117169	Ga0373962_0117169_235_636	117
188	3300035692	Ga0373935_1397138	Ga0373935_1397138_129_491	117
189	3300035695	Ga0373927_0910855	Ga0373927_0910855_95_448	117
190	3300036401	Ga0373937_0082298	Ga0373937_0082298_385_753	117
191	3300036401	Ga0373937_2139010	Ga0373937_2139010_91_468	117
192	3300037068	Ga0373925_0613430	Ga0373925_0613430_109_462	117
193	3300037466	Ga0395898_1611814	Ga0395898_1611814_112_465	117
194	3300037853	Ga0436364_0585441	Ga0436364_0585441_3644_4012	117
195	3300038443	Ga0395901_0197570	Ga0395901_0197570_1690_2046	117
196	3300039437	Ga0436365_1236969	Ga0436365_1236969_4971_5378	117
197	3300039437	Ga0436365_1596326	Ga0436365_1596326_502_870	117
198	3300044694	Ga0466963_0111221	Ga0466963_0111221_1344_1712	117
199	3300044694	Ga0466963_0239269	Ga0466963_0239269_57_446	117
200	3300044694	Ga0466963_0732512	Ga0466963_0732512_160_528	117
201	3300044735	Ga0466968_0137921	Ga0466968_0137921_179_568	117
202	3300044842	Ga0466957_0329420	Ga0466957_0329420_537_905	117
203	3300044842	Ga0466957_0350785	Ga0466957_0350785_478_834	117
204	3300044901	Ga0466960_0512873	Ga0466960_0512873_168_578	117
205	3300045049	Ga0466959_0145754	Ga0466959_0145754_1182_1622	117
206	3300045049	Ga0466959_0303169	Ga0466959_0303169_661_1050	117
207	3300045049	Ga0466959_0379391	Ga0466959_0379391_224_613	117
208	3300045049	Ga0466959_0388355	Ga0466959_0388355_206_562	117
209	3300045049	Ga0466959_0589551	Ga0466959_0589551_96_485	117
210	3300045049	Ga0466959_0685998	Ga0466959_0685998_35_424	117
211	3300045836	Ga0466958_0048986	Ga0466958_0048986_1633_2001	117
212	3300045836	Ga0466958_0079749	Ga0466958_0079749_1044_1484	117
213	3300045836	Ga0466958_0118493	Ga0466958_0118493_59_448	117
214	3300045836	Ga0466958_0606797	Ga0466958_0606797_114_503	117
215	3300045836	Ga0466958_0776613	Ga0466958_0776613_167_523	117
216	3300045976	Ga0466967_0044633	Ga0466967_0044633_764_1132	117
217	3300045976	Ga0466967_0146352	Ga0466967_0146352_458_841	117
218	3300045976	Ga0466967_0393227	Ga0466967_0393227_631_999	117
219	3300045976	Ga0466967_1534668	Ga0466967_1534668_86_475	117
220	3300046454	Ga0495592_0206960	Ga0495592_0206960_341_748	117
221	3300046455	Ga0495603_0070232	Ga0495603_0070232_144_545	117
222	3300046455	Ga0495603_0297976	Ga0495603_0297976_101_463	117
223	3300046459	Ga0495629_0103312	Ga0495629_0103312_1483_1845	117
224	3300046462	Ga0495651_0032007	Ga0495651_0032007_1737_2144	117
225	3300046473	Ga0495582_0032040	Ga0495582_0032040_1799_2200	117
226	3300046473	Ga0495582_0198950	Ga0495582_0198950_446_808	117
227	3300046475	Ga0495639_0123071	Ga0495639_0123071_755_1156	117
228	3300046491	Ga0495584_0207602	Ga0495584_0207602_194_583	117
229	3300046511	Ga0495608_0032206	Ga0495608_0032206_1152_1520	117
230	3300046514	Ga0495618_0017849	Ga0495618_0017849_2953_3321	117
231	3300046516	Ga0495628_0578916	Ga0495628_0578916_196_564	117
232	3300046516	Ga0495628_0585121	Ga0495628_0585121_398_766	117
233	3300046517	Ga0495630_0012509	Ga0495630_0012509_3334_3696	117
234	3300046517	Ga0495630_0838631	Ga0495630_0838631_142_495	117
235	3300046529	Ga0495652_0600081	Ga0495652_0600081_298_666	117
236	3300046531	Ga0495665_0180561	Ga0495665_0180561_546_914	117
237	3300046533	Ga0495640_0042362	Ga0495640_0042362_901_1269	117
238	3300046533	Ga0495640_0275795	Ga0495640_0275795_550_918	117
239	3300046533	Ga0495640_0335200	Ga0495640_0335200_216_578	117
240	3300046535	Ga0495586_0004184	Ga0495586_0004184_612_974	117
241	3300046536	Ga0495587_0072289	Ga0495587_0072289_196_564	117
242	3300046543	Ga0495645_0551183	Ga0495645_0551183_143_511	117
243	3300046559	Ga0495667_0008888	Ga0495667_0008888_1583_1951	117
244	3300046559	Ga0495667_0799079	Ga0495667_0799079_173_541	117
245	3300046642	Ga0495634_0043153	Ga0495634_0043153_907_1275	117
246	3300046642	Ga0495634_0118508	Ga0495634_0118508_473_835	117
247	3300046663	Ga0495635_0086976	Ga0495635_0086976_124_531	117
248	3300046663	Ga0495635_0670429	Ga0495635_0670429_198_560	117
249	3300046663	Ga0495635_0724257	Ga0495635_0724257_26_382	117
250	3300046675	Ga0495657_0025369	Ga0495657_0025369_1872_2240	117
251	3300046678	Ga0495599_0360624	Ga0495599_0360624_145_552	117
252	3300046680	Ga0495646_0316667	Ga0495646_0316667_48_416	117
253	3300046681	Ga0495647_0100305	Ga0495647_0100305_246_647	117
254	3300046683	Ga0495658_0025224	Ga0495658_0025224_1204_1566	117
255	3300046683	Ga0495658_0228980	Ga0495658_0228980_220_621	117
256	3300046683	Ga0495658_0309496	Ga0495658_0309496_477_836	117
257	3300046689	Ga0495613_0046765	Ga0495613_0046765_725_1087	117
258	3300046689	Ga0495613_0085791	Ga0495613_0085791_103_510	117
259	3300046689	Ga0495613_0821104	Ga0495613_0821104_107_484	117
260	3300046694	Ga0495649_0584048	Ga0495649_0584048_52_423	117
261	3300046809	Ga0495600_0047253	Ga0495600_0047253_2316_2684	117
262	3300047315	Ga0495581_0108329	Ga0495581_0108329_1149_1550	117
263	3300047317	Ga0495604_0110029	Ga0495604_0110029_490_858	117
264	3300047319	Ga0495674_0043379	Ga0495674_0043379_1181_1588	117
265	3300047319	Ga0495674_0044887	Ga0495674_0044887_474_836	117
266	3300047319	Ga0495674_0163538	Ga0495674_0163538_988_1356	117
267	3300047321	Ga0495676_0003139	Ga0495676_0003139_13435_13812	117
268	3300047321	Ga0495676_0215185	Ga0495676_0215185_404_757	117
269	3300047321	Ga0495676_0938661	Ga0495676_0938661_114_467	117
270	3300047322	Ga0495680_0073913	Ga0495680_0073913_1737_2105	117
271	3300047444	Ga0495675_0024205	Ga0495675_0024205_2805_3173	117
272	3300047471	Ga0495684_0073281	Ga0495684_0073281_566_973	117
273	3300047673	Ga0495593_0038140	Ga0495593_0038140_2039_2407	117
274	3300048088	Ga0495602_0106508	Ga0495602_0106508_941_1309	117
275	3300048903	Ga0496100_0041276	Ga0496100_0041276_683_1036	117
276	3300048903	Ga0496100_0057329	Ga0496100_0057329_1730_2089	117
277	3300048903	Ga0496100_0354332	Ga0496100_0354332_696_1049	117
278	3300048904	Ga0496101_0046249	Ga0496101_0046249_822_1175	117
279	3300048904	Ga0496101_0063044	Ga0496101_0063044_1116_1475	117
280	3300048904	Ga0496101_0251274	Ga0496101_0251274_375_731	117
281	3300048905	Ga0496102_0137755	Ga0496102_0137755_905_1264	117
282	3300048905	Ga0496102_0146812	Ga0496102_0146812_631_990	117
283	3300048905	Ga0496102_0228767	Ga0496102_0228767_375_728	117
284	3300048906	Ga0496103_0394919	Ga0496103_0394919_156_515	117
285	3300048906	Ga0496103_0438113	Ga0496103_0438113_102_455	117
286	3300048907	Ga0496104_0001004	Ga0496104_0001004_20542_20904	117
287	3300048907	Ga0496104_0112195	Ga0496104_0112195_512_871	117
288	3300048907	Ga0496104_0214140	Ga0496104_0214140_1409_1816	117
289	3300048907	Ga0496104_0642435	Ga0496104_0642435_235_588	117
290	3300048908	Ga0496105_0009822	Ga0496105_0009822_6341_6703	117
291	3300048908	Ga0496105_0012611	Ga0496105_0012611_4493_4852	117
292	3300048909	Ga0496106_0135091	Ga0496106_0135091_89_442	117
293	3300048909	Ga0496106_0420205	Ga0496106_0420205_324_683	117
294	3300048909	Ga0496106_1111150	Ga0496106_1111150_173_526	117
295	3300048909	Ga0496106_1439584	Ga0496106_1439584_112_465	117
296	3300048910	Ga0496107_0023776	Ga0496107_0023776_130_483	117
297	3300048910	Ga0496107_0101994	Ga0496107_0101994_581_940	117
298	3300048910	Ga0496107_0135283	Ga0496107_0135283_267_623	117
299	3300048910	Ga0496107_0986277	Ga0496107_0986277_117_470	117
300	3300048911	Ga0496108_0024898	Ga0496108_0024898_3264_3617	117
301	3300048911	Ga0496108_0114602	Ga0496108_0114602_1310_1669	117
302	3300048911	Ga0496108_0174539	Ga0496108_0174539_1131_1490	117
303	3300048911	Ga0496108_0808423	Ga0496108_0808423_346_708	117
304	3300048912	Ga0496109_0035261	Ga0496109_0035261_1091_1450	117
305	3300048912	Ga0496109_0107805	Ga0496109_0107805_1744_2103	117
306	3300048912	Ga0496109_0175478	Ga0496109_0175478_200_553	117
307	3300048912	Ga0496109_0179752	Ga0496109_0179752_56_409	117
308	3300048912	Ga0496109_1537051	Ga0496109_1537051_144_503	117
309	3300048912	Ga0496109_1997061	Ga0496109_1997061_34_387	117
310	3300048913	Ga0496110_0087857	Ga0496110_0087857_721_1080	117
311	3300048913	Ga0496110_0274460	Ga0496110_0274460_918_1277	117
312	3300048913	Ga0496110_1639442	Ga0496110_1639442_148_510	117
313	3300048914	Ga0496111_0130505	Ga0496111_0130505_676_1035	117
314	3300048914	Ga0496111_0325360	Ga0496111_0325360_69_422	117
315	3300048914	Ga0496111_0375191	Ga0496111_0375191_370_723	117
316	3300048915	Ga0496112_0182477	Ga0496112_0182477_787_1140	117
317	3300048915	Ga0496112_0270712	Ga0496112_0270712_747_1100	117
318	3300048915	Ga0496112_0842396	Ga0496112_0842396_165_524	117
319	3300048916	Ga0496113_0102165	Ga0496113_0102165_1078_1431	117
320	3300048916	Ga0496113_0147090	Ga0496113_0147090_392_751	117
321	3300048916	Ga0496113_0524746	Ga0496113_0524746_303_656	117
322	3300048916	Ga0496113_0657274	Ga0496113_0657274_70_432	117
323	3300048917	Ga0496114_0139156	Ga0496114_0139156_652_1005	117
324	3300048917	Ga0496114_0190644	Ga0496114_0190644_48_401	117
325	3300048917	Ga0496114_0278656	Ga0496114_0278656_223_579	117
326	3300048917	Ga0496114_0563023	Ga0496114_0563023_273_632	117
327	3300048917	Ga0496114_1269540	Ga0496114_1269540_188_556	117
328	3300048918	Ga0496115_0022435	Ga0496115_0022435_911_1270	117
329	3300048918	Ga0496115_0036727	Ga0496115_0036727_646_1002	117
330	3300048918	Ga0496115_1390549	Ga0496115_1390549_74_481	117
331	3300049568	Ga0501031_0054684	Ga0501031_0054684_608_988	117
332	3300049568	Ga0501031_0063181	Ga0501031_0063181_409_789	117
333	3300049569	Ga0501032_0119922	Ga0501032_0119922_665_1045	117
334	3300049570	Ga0501033_0137964	Ga0501033_0137964_1220_1600	117
335	3300049570	Ga0501033_0196719	Ga0501033_0196719_184_564	117
336	3300049572	Ga0501036_0007611	Ga0501036_0007611_3340_3720	117
337	3300049572	Ga0501036_0024532	Ga0501036_0024532_909_1289	117
338	3300049573	Ga0501037_0006018	Ga0501037_0006018_3527_3907	117
339	3300049574	Ga0501038_0043372	Ga0501038_0043372_515_895	117
340	3300049575	Ga0501039_0005166	Ga0501039_0005166_5415_5795	117
341	3300049575	Ga0501039_0086466	Ga0501039_0086466_1678_2058	117
342	3300049576	Ga0501040_0007503	Ga0501040_0007503_3594_3974	117
343	3300049576	Ga0501040_0032928	Ga0501040_0032928_1168_1548	117
344	3300049577	Ga0501041_0009454	Ga0501041_0009454_3423_3803	117
345	3300049577	Ga0501041_0024200	Ga0501041_0024200_3234_3614	117
346	3300049578	Ga0501042_0007022	Ga0501042_0007022_1613_1993	117
347	3300049578	Ga0501042_1166670	Ga0501042_1166670_108_488	117
348	3300049579	Ga0501043_0260661	Ga0501043_0260661_400_780	117
349	3300049580	Ga0501046_0005774	Ga0501046_0005774_7683_8063	117
350	3300049580	Ga0501046_0111213	Ga0501046_0111213_58_438	117
351	3300049581	Ga0501047_0928364	Ga0501047_0928364_50_430	117
352	3300049582	Ga0501048_0006542	Ga0501048_0006542_468_848	117
353	3300049582	Ga0501048_0175336	Ga0501048_0175336_147_527	117
354	3300049583	Ga0501067_0127561	Ga0501067_0127561_121_474	117
355	3300049584	Ga0501068_0000099	Ga0501068_0000099_7956_8309	117
356	3300049584	Ga0501068_0117188	Ga0501068_0117188_1039_1419	117
357	3300049584	Ga0501068_0202341	Ga0501068_0202341_621_974	117
358	3300049584	Ga0501068_0429504	Ga0501068_0429504_284_664	117
359	3300049585	Ga0501069_0000464	Ga0501069_0000464_14856_15209	117
360	3300049585	Ga0501069_0128341	Ga0501069_0128341_519_872	117
361	3300049585	Ga0501069_0349252	Ga0501069_0349252_378_737	117
362	3300049585	Ga0501069_0463889	Ga0501069_0463889_127_507	117
363	3300049586	Ga0501070_0037578	Ga0501070_0037578_50_430	117
364	3300049586	Ga0501070_0041928	Ga0501070_0041928_146_526	117
365	3300049587	Ga0501071_0047484	Ga0501071_0047484_1490_1870	117
366	3300049587	Ga0501071_0094665	Ga0501071_0094665_356_736	117
367	3300049588	Ga0501072_0007315	Ga0501072_0007315_2762_3142	117
368	3300049588	Ga0501072_0009217	Ga0501072_0009217_749_1129	117
369	3300049589	Ga0501073_0103182	Ga0501073_0103182_1461_1841	117
370	3300049589	Ga0501073_0572419	Ga0501073_0572419_157_537	117
371	3300049590	Ga0501074_0024636	Ga0501074_0024636_3407_3787	117
372	3300049591	Ga0501075_0015911	Ga0501075_0015911_1640_2020	117
373	3300049591	Ga0501075_0111342	Ga0501075_0111342_931_1311	117
374	3300049591	Ga0501075_0777332	Ga0501075_0777332_291_662	117
375	3300049592	Ga0501076_0010224	Ga0501076_0010224_3719_4099	117
376	3300049592	Ga0501076_0118025	Ga0501076_0118025_555_935	117
377	3300049593	Ga0501077_0016943	Ga0501077_0016943_3082_3462	117
378	3300049593	Ga0501077_0024566	Ga0501077_0024566_3265_3645	117
379	3300049741	Ga0501079_0020352	Ga0501079_0020352_1678_2058	117
380	3300049741	Ga0501079_1235515	Ga0501079_1235515_63_443	117
381	3300049742	Ga0501080_0027831	Ga0501080_0027831_2892_3272	117
382	3300049742	Ga0501080_0172312	Ga0501080_0172312_1456_1836	117
383	3300049743	Ga0501081_0018426	Ga0501081_0018426_2720_3100	117
384	3300049743	Ga0501081_0027738	Ga0501081_0027738_3100_3480	117
385	3300049743	Ga0501081_0281955	Ga0501081_0281955_27_380	117
386	3300049744	Ga0501083_0122892	Ga0501083_0122892_264_644	117
387	3300049744	Ga0501083_0346020	Ga0501083_0346020_508_888	117
388	3300049822	Ga0501035_0118196	Ga0501035_0118196_984_1364	117
389	3300049823	Ga0501044_0377251	Ga0501044_0377251_194_574	117
390	3300049823	Ga0501044_0764967	Ga0501044_0764967_316_696	117
391	3300049824	Ga0501045_0076302	Ga0501045_0076302_2026_2406	117
392	3300049824	Ga0501045_0132564	Ga0501045_0132564_770_1150	117
393	3300050492	nmdc:mga0yw44_93113_c1	nmdc:mga0yw44_93113_c1_623_979	117
394	3300050512	nmdc:mga0n895_261607_c1	nmdc:mga0n895_261607_c1_370_723	117
395	3300050513	nmdc:mga0rr50_1366367_c1	nmdc:mga0rr50_1366367_c1_98_451	117
396	3300050513	nmdc:mga0rr50_24472_c1	nmdc:mga0rr50_24472_c1_2988_3341	117
397	3300050515	nmdc:mga0a205_45380_c1	nmdc:mga0a205_45380_c1_621_974	117
398	3300053077	Ga0495601_0145512	Ga0495601_0145512_653_1021	117
399	3300053078	Ga0495612_0043846	Ga0495612_0043846_282_650	117
400	3300053083	Ga0495655_0116116	Ga0495655_0116116_250_639	117
401	3300053084	Ga0495595_0017151	Ga0495595_0017151_2352_2720	117
402	3300053085	Ga0495619_0020613	Ga0495619_0020613_3209_3571	117
403	3300053085	Ga0495619_0700883	Ga0495619_0700883_37_405	117
404	3300054114	Ga0501084_0026177	Ga0501084_0026177_2785_3165	117
405	3300054114	Ga0501084_0058092	Ga0501084_0058092_596_976	117
406	3300059641	Ga0587068_054291	Ga0587068_054291_12_371	117
407	3300060353	Ga0501082_0004324	Ga0501082_0004324_3930_4310	117
408	3300060353	Ga0501082_0062024	Ga0501082_0062024_1196_1576	117
409	3300061719	Ga0466962_0168835	Ga0466962_0168835_301_657	117
410	3300061734	Ga0530510_0002988	Ga0530510_0002988_5702_6055	117
411	3300061734	Ga0530510_0038992	Ga0530510_0038992_652_1032	117
412	3300061734	Ga0530510_0197305	Ga0530510_0197305_159_539	117
413	3300061734	Ga0530510_0897695	Ga0530510_0897695_50_403	117

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

33

143

0.97 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
2v0n-assembly1.cif.gz_B	activated response regulator pled in complex with c-digmp and gtp- alpha-s	0.9183	4	104
5f64-assembly2.cif.gz_C	putative positive transcription regulator (sensor evgs) from shigella flexneri	0.9043	3	113
4qyw-assembly1.cif.gz_A	structure of phosphono-chey from t.maritima	0.8993	3	116
2wb4-assembly1.cif.gz_B	activated diguanylate cyclase pled in complex with c-di-gmp	0.8983	4	116
3f6c-assembly2.cif.gz_A	crystal structure of n-terminal domain of positive transcription regulator evga from escherichia coli	0.8977	3	116

ID	Description	Score	Start	End	Superfamily
af_P9WGM1_5_87_3.40.50.2300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.9543	1	80	3.40.50.2300
af_O07776_22_102_3.40.50.2300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.9506	3	82	3.40.50.2300
af_P30843_1_80_3.40.50.2300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.9433	4	82	3.40.50.2300
af_P71814_19_100_3.40.50.2300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.9348	4	82	3.40.50.2300
af_P9WGN1_2_80_3.40.50.2300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.9275	3	80	3.40.50.2300

ID	Description	Score	Start	End	GO Terms
AF-A0A6V8K734-F1-model_v4	Response regulatory domain-containing protein	0.9952	6	116	GO:0000160
AF-A0A2V2SVZ5-F1-model_v4	deleted	0.993	1	117
AF-K4QXL8-F1-model_v4	Response regulatory domain-containing protein	0.9852	6	117	GO:0000160
AF-A0A2V2SVZ5-F1-model_v4	deleted	0.9847	1	117
AF-A0A1I7BNK3-F1-model_v4	Response regulator receiver domain-containing protein	0.9846	1	116	GO:0000160

Feature Viewer

pLDDT	pTM	Quality
96.69	0.9	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F438126

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00072

Response_reg

Response regulator receiver domain

33

143

0.97

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map