F438120

General Info

Members Datasets Scaffolds Average Seq Length
413 270 345 336

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0011427|Ga0466963_0011427_110_1255
Length 381
Sequence MSKRFDAYGHLGSGELWSPHVTCCHTSVSVVEALRLTSLEDRMVTLAEVAQHAGVSASTVSYVLSGKRSISAGTRQRVEESIRELGYHPHAGARALASSRSNIIALMVPLRTDMYVPVMMEIAIAVATTARAHGYDVLLLTGEEGPDAVRRVTGSGLADAMILMDVELDDERLPLLRASGQPSVLIGLPADPTGLTCVDLDFTATGALCVEHLAMLGHRDLAVVGEAAAVYERHTGFAERTLDGLRTRAGELGLRLLHRPCEGGYDAMAATLARIFDERPDTTGFVVQNESAVEPLLALLRARGRAVPEDVSVIAVCPDQVAVQASVRLTSVAIPAQEMGRRAVDRLVAKLEGRGEDEVVLLAPELSVRASTGPAPAGGRR

Samples

Sample ID Description Type Environment
1 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
2 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
3 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
4 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
5 2643221548 Streptomyces sp. Root55 Isolate Unclassified
6 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
7 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
8 2643221647 Streptomyces sp. Root369 Isolate Unclassified
9 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
10 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
11 2643221714 Streptomyces sp. Root264 Isolate Unclassified
12 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
13 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
14 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
15 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
16 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
17 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
18 2808606448 Streptomyces sp. 193411 Isolate Unclassified
19 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
20 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
21 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
22 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
23 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
24 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
25 2862574272 Streptomyces sp. AcE210 Isolate Nodule
26 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
27 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
28 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
29 2867428634 Streptomyces sp. RP5T Isolate Unclassified
30 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
31 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
32 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
33 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
34 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
35 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
36 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
37 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
38 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
39 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
40 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
41 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
42 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
43 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
44 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
45 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
46 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
47 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
48 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
49 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
50 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
51 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
52 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
53 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
54 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
55 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
56 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
57 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
58 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
59 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
60 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
61 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
62 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
63 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
64 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
65 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
72 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
73 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
82 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
83 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
86 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
95 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
96 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
99 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
100 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
101 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
102 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
103 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
104 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
105 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
106 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
107 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
108 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
109 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
115 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
116 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
117 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
118 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
119 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
120 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
121 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
122 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
123 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
124 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
125 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
126 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
127 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
128 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
129 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
130 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
131 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
132 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
133 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
134 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
135 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
136 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
137 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
138 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
139 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
140 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
143 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
144 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
147 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
148 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
149 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
150 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
151 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
152 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
153 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
154 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
155 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
156 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
157 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
158 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
159 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
160 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
161 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
162 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
163 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
164 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
165 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
166 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
167 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
168 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
172 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
173 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
174 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
175 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
176 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
177 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
178 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
179 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
180 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
181 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
182 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
183 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
184 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
185 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
186 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
187 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
188 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
189 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
190 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
191 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
192 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
193 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
194 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
195 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
196 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
197 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
198 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
199 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
200 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
201 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
202 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
203 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
204 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
205 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
206 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
207 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
208 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
209 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
210 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
211 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
212 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
213 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
214 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
215 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
216 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
231 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
232 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
233 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
234 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
237 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
238 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
239 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
240 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
241 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
242 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
243 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
244 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
245 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
246 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
247 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
248 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
249 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
250 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
251 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
252 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
253 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
254 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
255 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
256 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
257 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
258 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
259 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
260 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
261 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
262 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
263 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
264 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
265 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
266 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
267 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
268 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
269 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
270 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.81
Metatranscriptomes 0.73
Isolates 16.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.05
Nodule 0.73
Rhizoplane 0.73
Rhizosphere 79.42
Stem 0
Stem Tuber 0
Unclassified 13.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10000410 3300003316 Bacteria 4599
2 rootH1_10056692 3300003316 Bacteria 3734
3 rootH2_10092353 3300003320 Bacteria 2998
4 rootH1_10068609 3300003323 Bacteria 2222
5 Ga0006562J51391_1086190 3300003578 Bacteria 1060
6 Ga0070714_100059200 3300005435 Bacteria 3283
7 Ga0070713_100019799 3300005436 Bacteria 5149
8 Ga0070710_10015906 3300005437 Bacteria 3816
9 Ga0070706_100016385 3300005467 Bacteria 6848
10 Ga0070698_100102935 3300005471 Bacteria 2826
11 Ga0068853_100087575 3300005539 Bacteria 2733
12 Ga0081455_10077531 3300005937 Bacteria 2733
13 Ga0075365_10055929 3300006038 Bacteria 2622
14 Ga0070712_100047773 3300006175 Bacteria 2964
15 Ga0075367_10001753 3300006178 Bacteria 9518
16 Ga0099826_10041177 3300006948 Bacteria 3207
17 Ga0105251_10012369 3300009011 Bacteria 4829
18 Ga0105250_10089375 3300009092 Bacteria 1252
19 Ga0105243_10023121 3300009148 Bacteria 4728
20 Ga0105248_10033689 3300009177 Bacteria 5724
21 Ga0105246_10037080 3300011119 Bacteria 3270
22 Ga0105246_10269352 3300011119 Bacteria 1361
23 Ga0157369_10078229 3300013105 Bacteria 3544
24 Ga0157372_10032897 3300013307 Bacteria 5690
25 Ga0182008_10005982 3300014497 Bacteria 6849
26 Ga0157379_10034585 3300014968 Bacteria 4505
27 Ga0182007_10000397 3300015262 Bacteria 26971
28 Ga0183367_1013 3300015688 Bacteria 334176
29 Ga0206354_11453619 3300020081 Bacteria 1502
30 Ga0224712_10034799 3300022467 Bacteria 1855
31 Ga0209758_1028213 3300025297 Bacteria 2380
32 Ga0207713_1023898 3300025735 Bacteria 2863
33 Ga0207692_10021203 3300025898 Bacteria 2970
34 Ga0207647_10015132 3300025904 Bacteria 5300
35 Ga0207699_10060977 3300025906 Bacteria 2267
36 Ga0207684_10004232 3300025910 Bacteria 13617
37 Ga0207693_10103498 3300025915 Bacteria 2233
38 Ga0207700_10010447 3300025928 Bacteria 5859
39 Ga0207664_10104191 3300025929 Bacteria 2348
40 Ga0209813_10022141 3300027866 Bacteria 1794
41 Ga0307517_10004438 3300028786 Bacteria 21554
42 Ga0307517_10007934 3300028786 Bacteria 15338
43 Ga0307515_10003217 3300028794 Bacteria 34563
44 Ga0307515_10199718 3300028794 Bacteria 1879
45 Ga0265338_10041769 3300028800 Bacteria 4284
46 Ga0307511_10000330 3300030521 Bacteria 50161
47 Ga0307512_10002763 3300030522 Bacteria 21448
48 Ga0307512_10016776 3300030522 Bacteria 6746
49 Ga0265340_10002282 3300031247 Bacteria 10959
50 Ga0307513_10030690 3300031456 Bacteria 6101
51 Ga0307509_10044756 3300031507 Bacteria 4779
52 Ga0307508_10002014 3300031616 Bacteria 22128
53 Ga0307508_10009978 3300031616 Bacteria 8703
54 Ga0307514_10025441 3300031649 Bacteria 4787
55 Ga0307516_10009775 3300031730 Bacteria 10642
56 Ga0307516_10202812 3300031730 Bacteria 1702
57 Ga0307518_10021358 3300031838 Bacteria 4656
58 Ga0307518_10084778 3300031838 Bacteria 2283
59 Ga0307411_10017364 3300032005 Bacteria 4098
60 Ga0307507_10000158 3300033179 Bacteria 120194
61 Ga0307507_10008032 3300033179 Bacteria 14857
62 Ga0373945_0088659 3300035116 Bacteria 1195
63 Ga0395900_0011600 3300037418 Bacteria 9019
64 Ga0395900_0271108 3300037418 Bacteria 1692
65 Ga0395898_0018381 3300037466 Bacteria 7129
66 Ga0436364_1044466 3300037853 Bacteria 3709
67 Ga0395901_0021348 3300038443 Bacteria 6634
68 Ga0439436_0023004 3300041404 Bacteria 1845
69 Ga0439439_0006112 3300041406 Bacteria 2775
70 Ga0439439_0040843 3300041406 Bacteria 1201
71 Ga0451800_0777421 3300041459 Bacteria 2318
72 Ga0451841_0610447 3300041498 Bacteria 2838
73 Ga0451853_0293138 3300041512 Bacteria 4813
74 Ga0439433_0001537 3300041999 Bacteria 4780
75 Ga0439442_009966 3300042002 Bacteria 1923
76 Ga0439448_0003700 3300042005 Bacteria 4260
77 Ga0439432_022588 3300042006 Bacteria 2078
78 Ga0439449_0000168 3300042007 Bacteria 22536
79 Ga0439455_0003817 3300042012 Bacteria 2922
80 Ga0439457_000053 3300042014 Bacteria 23958
81 Ga0439457_003869 3300042014 Bacteria 4011
82 Ga0439462_0000842 3300042015 Bacteria 6419
83 Ga0450898_001100 3300042134 Bacteria 3450
84 Ga0450899_000134 3300042135 Bacteria 7050
85 Ga0450903_000124 3300042138 Bacteria 16697
86 Ga0450906_000781 3300042145 Bacteria 6939
87 Ga0439458_0005775 3300042157 Bacteria 2774
88 Ga0466969_0002827 3300044656 Bacteria 9282
89 Ga0466969_0003138 3300044656 Bacteria 8804
90 Ga0466969_0035291 3300044656 Bacteria 2529
91 Ga0466969_0042725 3300044656 Bacteria 2261
92 Ga0466972_0033444 3300044658 Bacteria 2521
93 Ga0466965_0005207 3300044683 Bacteria 5842
94 Ga0466965_0032283 3300044683 Bacteria 2557
95 Ga0466966_0002038 3300044684 Bacteria 13129
96 Ga0466966_0120914 3300044684 Bacteria 1608
97 Ga0466961_0001175 3300044693 Bacteria 16120
98 Ga0466961_0005949 3300044693 Bacteria 7729
99 Ga0466961_0030059 3300044693 Bacteria 3491
100 Ga0466963_0000146 3300044694 Bacteria 27935
101 Ga0466963_0011427 3300044694 Bacteria 5407
102 Ga0466963_0227320 3300044694 Bacteria 1307
103 Ga0466963_0326216 3300044694 Bacteria 1080
104 Ga0466964_0009672 3300044706 Bacteria 3632
105 Ga0466971_0000183 3300044719 Bacteria 23740
106 Ga0466971_0000278 3300044719 Bacteria 19566
107 Ga0466971_0003595 3300044719 Bacteria 6625
108 Ga0466971_0051684 3300044719 Bacteria 1850
109 Ga0466970_0001715 3300044765 Bacteria 10546
110 Ga0466970_0004967 3300044765 Bacteria 6570
111 Ga0466970_0005057 3300044765 Bacteria 6520
112 Ga0466970_0010907 3300044765 Bacteria 4622
113 Ga0466970_0085430 3300044765 Bacteria 1709
114 Ga0466957_0011169 3300044842 Bacteria 5172
115 Ga0466957_0131379 3300044842 Bacteria 1605
116 Ga0466960_0002854 3300044901 Bacteria 6549
117 Ga0466959_0000846 3300045049 Bacteria 18072
118 Ga0466959_0007348 3300045049 Bacteria 7723
119 Ga0466959_0007624 3300045049 Bacteria 7607
120 Ga0466958_0054785 3300045836 Bacteria 2419
121 Ga0466958_0243564 3300045836 Bacteria 1149
122 Ga0466967_0054358 3300045976 Bacteria 3523
123 Ga0466967_0287373 3300045976 Bacteria 1579
124 Ga0466967_0494815 3300045976 Bacteria 1199
125 Ga0495592_0005850 3300046454 Bacteria 9126
126 Ga0495592_0015158 3300046454 Bacteria 5854
127 Ga0495592_0023265 3300046454 Bacteria 4712
128 Ga0495603_0001216 3300046455 Bacteria 15038
129 Ga0495603_0024636 3300046455 Bacteria 3640
130 Ga0495603_0030860 3300046455 Bacteria 3227
131 Ga0495629_0002950 3300046459 Bacteria 12958
132 Ga0495629_0158652 3300046459 Bacteria 1571
133 Ga0495638_0034388 3300046460 Bacteria 3235
134 Ga0495638_0087551 3300046460 Bacteria 1881
135 Ga0495651_0000524 3300046462 Bacteria 29820
136 Ga0495651_0001617 3300046462 Bacteria 17458
137 Ga0495651_0014919 3300046462 Bacteria 6007
138 Ga0495651_0033191 3300046462 Bacteria 4026
139 Ga0495651_0156255 3300046462 Bacteria 1639
140 Ga0495653_0172639 3300046463 Bacteria 1491
141 Ga0495580_0072008 3300046472 Bacteria 2414
142 Ga0495582_0022579 3300046473 Bacteria 3444
143 Ga0495605_0008627 3300046474 Bacteria 5758
144 Ga0495639_0014031 3300046475 Bacteria 3466
145 Ga0495662_0011168 3300046476 Bacteria 4388
146 Ga0495662_0040295 3300046476 Bacteria 2256
147 Ga0495662_0096925 3300046476 Bacteria 1441
148 Ga0495664_0001079 3300046477 Bacteria 14083
149 Ga0495664_0024639 3300046477 Bacteria 3499
150 Ga0495664_0174924 3300046477 Bacteria 1302
151 Ga0495584_0089026 3300046491 Bacteria 1556
152 Ga0495585_0065197 3300046492 Bacteria 1996
153 Ga0495594_0020148 3300046499 Bacteria 3551
154 Ga0495594_0048988 3300046499 Bacteria 2321
155 Ga0495596_0028174 3300046500 Bacteria 2256
156 Ga0495607_0018245 3300046501 Bacteria 4479
157 Ga0495583_0046832 3300046506 Bacteria 1992
158 Ga0495583_0131839 3300046506 Bacteria 1045
159 Ga0495606_0024704 3300046507 Bacteria 4323
160 Ga0495608_0104569 3300046511 Bacteria 1823
161 Ga0495616_0013088 3300046513 Bacteria 4690
162 Ga0495618_0031950 3300046514 Bacteria 3296
163 Ga0495620_0079247 3300046515 Bacteria 1331
164 Ga0495628_0012123 3300046516 Bacteria 7268
165 Ga0495628_0118263 3300046516 Bacteria 2034
166 Ga0495630_0207112 3300046517 Bacteria 1497
167 Ga0495631_0007611 3300046518 Bacteria 5504
168 Ga0495637_0037693 3300046520 Bacteria 2097
169 Ga0495643_0001394 3300046522 Bacteria 22534
170 Ga0495643_0007416 3300046522 Bacteria 7076
171 Ga0495644_0090923 3300046523 Bacteria 1152
172 Ga0495652_0001233 3300046529 Bacteria 28673
173 Ga0495652_0001571 3300046529 Bacteria 24996
174 Ga0495652_0002029 3300046529 Bacteria 21510
175 Ga0495652_0003213 3300046529 Bacteria 16304
176 Ga0495652_0034807 3300046529 Bacteria 4388
177 Ga0495652_0117669 3300046529 Bacteria 2125
178 Ga0495654_0016419 3300046530 Bacteria 3916
179 Ga0495640_0002129 3300046533 Bacteria 15806
180 Ga0495640_0010617 3300046533 Bacteria 7104
181 Ga0495587_0054527 3300046536 Bacteria 2356
182 Ga0495587_0082921 3300046536 Bacteria 1857
183 Ga0495609_0077063 3300046538 Bacteria 1460
184 Ga0495645_0002213 3300046543 Bacteria 13232
185 Ga0495645_0005940 3300046543 Bacteria 8436
186 Ga0495645_0035635 3300046543 Bacteria 3627
187 Ga0495622_0031052 3300046557 Bacteria 2497
188 Ga0495622_0039616 3300046557 Bacteria 2194
189 Ga0495622_0115189 3300046557 Bacteria 1229
190 Ga0495633_0015923 3300046558 Bacteria 3891
191 Ga0495667_0225834 3300046559 Bacteria 1194
192 Ga0495634_0003067 3300046642 Bacteria 13601
193 Ga0495634_0009578 3300046642 Bacteria 7139
194 Ga0495611_0114950 3300046648 Bacteria 1253
195 Ga0495625_0011616 3300046660 Bacteria 7162
196 Ga0495625_0108063 3300046660 Bacteria 1903
197 Ga0495635_0002772 3300046663 Bacteria 12017
198 Ga0495635_0090367 3300046663 Bacteria 2094
199 Ga0495661_0019468 3300046665 Bacteria 4448
200 Ga0495661_0174867 3300046665 Bacteria 1142
201 Ga0495588_0002553 3300046674 Bacteria 7780
202 Ga0495588_0003476 3300046674 Bacteria 6859
203 Ga0495588_0031769 3300046674 Bacteria 2659
204 Ga0495588_0102157 3300046674 Bacteria 1507
205 Ga0495657_0001197 3300046675 Bacteria 22744
206 Ga0495657_0001943 3300046675 Bacteria 17640
207 Ga0495657_0072724 3300046675 Bacteria 2241
208 Ga0495623_0038350 3300046679 Bacteria 3064
209 Ga0495623_0084619 3300046679 Bacteria 1957
210 Ga0495646_0001151 3300046680 Bacteria 15445
211 Ga0495646_0001634 3300046680 Bacteria 13363
212 Ga0495646_0147093 3300046680 Bacteria 1313
213 Ga0495658_0026633 3300046683 Bacteria 3101
214 Ga0495613_0000891 3300046689 Bacteria 22993
215 Ga0495613_0004432 3300046689 Bacteria 10514
216 Ga0495613_0030584 3300046689 Bacteria 3999
217 Ga0495613_0113676 3300046689 Bacteria 1949
218 Ga0495613_0152788 3300046689 Bacteria 1645
219 Ga0495624_0019071 3300046690 Bacteria 4582
220 Ga0495624_0022727 3300046690 Bacteria 4139
221 Ga0495670_0009087 3300046691 Bacteria 4887
222 Ga0495671_0016495 3300046692 Bacteria 3943
223 Ga0495649_0151593 3300046694 Bacteria 1217
224 Ga0495589_0028409 3300046794 Bacteria 2823
225 Ga0495589_0127794 3300046794 Bacteria 1221
226 Ga0495600_0000764 3300046809 Bacteria 16907
227 Ga0495600_0020638 3300046809 Bacteria 4212
228 Ga0495600_0062271 3300046809 Bacteria 2437
229 Ga0495660_0004850 3300046810 Bacteria 8101
230 Ga0495581_0003896 3300047315 Bacteria 8586
231 Ga0495581_0077442 3300047315 Bacteria 1924
232 Ga0495581_0133032 3300047315 Bacteria 1449
233 Ga0495604_0002075 3300047317 Bacteria 16170
234 Ga0495604_0007564 3300047317 Bacteria 8596
235 Ga0495604_0008214 3300047317 Bacteria 8260
236 Ga0495604_0072429 3300047317 Bacteria 2604
237 Ga0495636_0106877 3300047318 Bacteria 1228
238 Ga0495674_0138681 3300047319 Bacteria 2045
239 Ga0495676_0003699 3300047321 Bacteria 13888
240 Ga0495676_0006919 3300047321 Bacteria 10417
241 Ga0495676_0010115 3300047321 Bacteria 8567
242 Ga0495676_0033289 3300047321 Bacteria 4342
243 Ga0495676_0049916 3300047321 Bacteria 3359
244 Ga0495680_0031808 3300047322 Bacteria 4289
245 Ga0495687_004714 3300047443 Bacteria 9036
246 Ga0495687_007193 3300047443 Bacteria 6622
247 Ga0495687_089447 3300047443 Bacteria 1182
248 Ga0495675_0064496 3300047444 Bacteria 2317
249 Ga0495675_0132703 3300047444 Bacteria 1547
250 Ga0495685_001078 3300047447 Bacteria 8308
251 Ga0495685_008472 3300047447 Bacteria 3417
252 Ga0495685_018200 3300047447 Bacteria 2409
253 Ga0495681_0001129 3300047470 Bacteria 20294
254 Ga0495681_0001720 3300047470 Bacteria 16174
255 Ga0495681_0078149 3300047470 Bacteria 1483
256 Ga0495686_0031290 3300047472 Bacteria 3452
257 Ga0495686_0105796 3300047472 Bacteria 1692
258 Ga0495686_0128037 3300047472 Bacteria 1508
259 Ga0495593_0000452 3300047673 Bacteria 23040
260 Ga0495593_0106665 3300047673 Bacteria 1433
261 Ga0495602_0008634 3300048088 Bacteria 10642
262 Ga0495602_0073385 3300048088 Bacteria 2913
263 Ga0495614_0000375 3300048089 Bacteria 18039
264 Ga0495626_0031176 3300048091 Bacteria 2567
265 Ga0496109_0097396 3300048912 Bacteria 2726
266 Ga0501032_0070020 3300049569 Bacteria 2340
267 Ga0501032_0109903 3300049569 Bacteria 1825
268 Ga0501033_0014740 3300049570 Bacteria 5934
269 Ga0501033_0047998 3300049570 Bacteria 3173
270 Ga0501033_0116889 3300049570 Bacteria 1937
271 Ga0501034_0002564 3300049571 Bacteria 21634
272 Ga0501034_0033184 3300049571 Bacteria 5239
273 Ga0501034_0036250 3300049571 Bacteria 4996
274 Ga0501034_0235512 3300049571 Bacteria 1778
275 Ga0501036_0009392 3300049572 Bacteria 8046
276 Ga0501036_0014482 3300049572 Bacteria 6569
277 Ga0501036_0022270 3300049572 Bacteria 5329
278 Ga0501037_0016004 3300049573 Bacteria 5520
279 Ga0501038_0008293 3300049574 Bacteria 9564
280 Ga0501038_0074681 3300049574 Bacteria 2868
281 Ga0501038_0081144 3300049574 Bacteria 2733
282 Ga0501039_0015671 3300049575 Bacteria 5800
283 Ga0501039_0299911 3300049575 Bacteria 1263
284 Ga0501042_0176617 3300049578 Bacteria 1540
285 Ga0501043_0010045 3300049579 Bacteria 7424
286 Ga0501043_0011402 3300049579 Bacteria 6959
287 Ga0501043_0070177 3300049579 Bacteria 2752
288 Ga0501043_0083619 3300049579 Bacteria 2509
289 Ga0501046_0157263 3300049580 Bacteria 1711
290 Ga0501047_0016233 3300049581 Bacteria 7103
291 Ga0501047_0065615 3300049581 Bacteria 3499
292 Ga0501047_0111188 3300049581 Bacteria 2622
293 Ga0501047_0128183 3300049581 Bacteria 2417
294 Ga0501048_0005317 3300049582 Bacteria 9802
295 Ga0501048_0106633 3300049582 Bacteria 1978
296 Ga0501070_0011949 3300049586 Bacteria 7333
297 Ga0501070_0018669 3300049586 Bacteria 5818
298 Ga0501070_0282786 3300049586 Bacteria 1353
299 Ga0501070_0338055 3300049586 Bacteria 1223
300 Ga0501072_0370431 3300049588 Bacteria 1137
301 Ga0501074_0012839 3300049590 Bacteria 6089
302 Ga0501080_0148882 3300049742 Bacteria 2164
303 Ga0501035_0009429 3300049822 Bacteria 9075
304 Ga0501035_0011560 3300049822 Bacteria 8181
305 Ga0501035_0013256 3300049822 Bacteria 7606
306 Ga0501035_0032451 3300049822 Bacteria 4751
307 Ga0501035_0054593 3300049822 Bacteria 3570
308 Ga0501035_0190156 3300049822 Bacteria 1765
309 Ga0501035_0252662 3300049822 Bacteria 1496
310 Ga0501044_0010851 3300049823 Bacteria 9883
311 Ga0501044_0061616 3300049823 Bacteria 3837
312 Ga0501044_0072560 3300049823 Bacteria 3499
313 Ga0501044_0141979 3300049823 Bacteria 2390
314 Ga0501044_0223395 3300049823 Bacteria 1833
315 Ga0501044_0252012 3300049823 Bacteria 1706
316 Ga0501045_0006535 3300049824 Bacteria 8082
317 nmdc:mga0yw44_45898_c1 3300050492 Bacteria 2621
318 nmdc:mga06z11_928_c1 3300050494 Bacteria 10650
319 nmdc:mga04h51_18215_c1 3300050495 Bacteria 2065
320 Ga0495601_0000374 3300053077 Bacteria 23656
321 Ga0495612_0000802 3300053078 Bacteria 12799
322 Ga0495612_0007800 3300053078 Bacteria 4368
323 Ga0495655_0031820 3300053083 Bacteria 1286
324 Ga0495619_0036547 3300053085 Bacteria 3199
325 Ga0500578_0016568 3300053086 Bacteria 4735
326 Ga0500578_0071115 3300053086 Bacteria 2218
327 Ga0500566_0045023 3300053094 Bacteria 2541
328 Ga0500640_000774 3300053095 Bacteria 8688
329 Ga0500654_017852 3300053099 Bacteria 4620
330 Ga0500569_009469 3300053109 Bacteria 2265
331 Ga0500652_002313 3300053131 Bacteria 5731
332 Ga0500658_0002215 3300053134 Bacteria 7553
333 Ga0500561_0000856 3300053137 Bacteria 4883
334 Ga0500573_0016289 3300053140 Bacteria 4219
335 Ga0500573_0049007 3300053140 Bacteria 2431
336 Ga0500573_0083601 3300053140 Bacteria 1812
337 Ga0500573_0113927 3300053140 Bacteria 1511
338 Ga0500579_047921 3300053143 Bacteria 2634
339 Ga0500600_0013770 3300053149 Bacteria 4916
340 Ga0500616_0005774 3300053153 Bacteria 8306
341 Ga0500633_0004674 3300053160 Bacteria 3172
342 Ga0500634_0004836 3300053161 Bacteria 6305
343 Ga0466962_0000066 3300061719 Bacteria 43509
344 Ga0466962_0003151 3300061719 Bacteria 7833
345 Ga0466962_0097905 3300061719 Bacteria 1407

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046462 Ga0495651_0001617 Ga0495651_0001617_6859_7905 301
2 3300046529 Ga0495652_0001571 Ga0495652_0001571_4444_5490 301
3 3300046536 Ga0495587_0054527 Ga0495587_0054527_576_1622 301
4 3300046809 Ga0495600_0000764 Ga0495600_0000764_3727_4773 301
5 3300047317 Ga0495604_0072429 Ga0495604_0072429_71_1117 301
6 3300044656 Ga0466969_0003138 Ga0466969_0003138_1923_2936 312
7 3300044693 Ga0466961_0001175 Ga0466961_0001175_6018_7031 312
8 3300044719 Ga0466971_0000278 Ga0466971_0000278_2648_3661 312
9 3300045049 Ga0466959_0000846 Ga0466959_0000846_5662_6675 312
10 3300061719 Ga0466962_0000066 Ga0466962_0000066_12888_13901 312
11 3300037853 Ga0436364_1044466 Ga0436364_1044466_181_1188 315
12 3300044694 Ga0466963_0326216 Ga0466963_0326216_85_1050 315
13 3300046506 Ga0495583_0131839 Ga0495583_0131839_37_999 318
14 3300046517 Ga0495630_0207112 Ga0495630_0207112_15_977 318
15 3300046557 Ga0495622_0115189 Ga0495622_0115189_231_1193 318
16 3300049574 Ga0501038_0008293 Ga0501038_0008293_8585_9550 318
17 iso_pu_bacteria 8056829672 8056831635 319
18 3300005435 Ga0070714_100059200 Ga0070714_1000592002 320
19 3300033179 Ga0307507_10000158 Ga0307507_1000015825 321
20 3300009177 Ga0105248_10033689 Ga0105248_100336892 322
21 3300044765 Ga0466970_0004967 Ga0466970_0004967_3774_4820 322
22 3300044656 Ga0466969_0002827 Ga0466969_0002827_1845_2885 323
23 3300044656 Ga0466969_0035291 Ga0466969_0035291_895_1926 323
24 3300044684 Ga0466966_0120914 Ga0466966_0120914_77_1117 323
25 3300044719 Ga0466971_0003595 Ga0466971_0003595_5342_6382 323
26 3300044765 Ga0466970_0010907 Ga0466970_0010907_1270_2301 323
27 3300044765 Ga0466970_0085430 Ga0466970_0085430_203_1243 323
28 3300045049 Ga0466959_0007624 Ga0466959_0007624_685_1725 323
29 3300045976 Ga0466967_0287373 Ga0466967_0287373_576_1559 323
30 3300061719 Ga0466962_0097905 Ga0466962_0097905_233_1273 323
31 3300044694 Ga0466963_0227320 Ga0466963_0227320_237_1265 324
32 3300049580 Ga0501046_0157263 Ga0501046_0157263_545_1534 325
33 3300049572 Ga0501036_0022270 Ga0501036_0022270_2190_3281 329
34 3300049579 Ga0501043_0011402 Ga0501043_0011402_625_1716 329
35 3300049581 Ga0501047_0016233 Ga0501047_0016233_2234_3325 329
36 3300049586 Ga0501070_0011949 Ga0501070_0011949_5517_6608 329
37 3300049822 Ga0501035_0011560 Ga0501035_0011560_3356_4447 329
38 3300049822 Ga0501035_0013256 Ga0501035_0013256_310_1410 329
39 3300049823 Ga0501044_0072560 Ga0501044_0072560_2235_3335 329
40 3300049824 Ga0501045_0006535 Ga0501045_0006535_1998_3089 329
41 iso_pu_bacteria 2912757875 2912764975 329
42 3300053078 Ga0495612_0000802 Ga0495612_0000802_6165_7241 331
43 3300053140 Ga0500573_0113927 Ga0500573_0113927_210_1214 331
44 iso_pu_bacteria 2554235005 2554260143 331
45 iso_pu_bacteria 2582581313 2585307833 331
46 iso_pu_bacteria 2582581314 2585316814 331
47 iso_pu_bacteria 2616644814 2616700098 331
48 iso_pu_bacteria 2643221548 2643762225 331
49 iso_pu_bacteria 2643221601 2644013638 331
50 iso_pu_bacteria 2643221631 2644178732 331
51 iso_pu_bacteria 2643221647 2644269644 331
52 iso_pu_bacteria 2643221678 2644437716 331
53 iso_pu_bacteria 2643221682 2644458996 331
54 iso_pu_bacteria 2643221714 2644629896 331
55 iso_pu_bacteria 2784132148 2784590684 331
56 iso_pu_bacteria 2784746763 2785340889 331
57 iso_pu_bacteria 2784746768 2785371859 331
58 iso_pu_bacteria 2786546132 2786672972 331
59 iso_pu_bacteria 2808606359 2808844361 331
60 iso_pu_bacteria 2808606375 2808913938 331
61 iso_pu_bacteria 2808606448 2809234376 331
62 iso_pu_bacteria 2811994879 2812355629 331
63 iso_pu_bacteria 2818991463 2819699488 331
64 iso_pu_bacteria 2852635781 2852639775 331
65 iso_pu_bacteria 2862281513 2862284284 331
66 iso_pu_bacteria 2862507626 2862514289 331
67 iso_pu_bacteria 2862574272 2862581853 331
68 iso_pu_bacteria 2862705112 2862710979 331
69 iso_pu_bacteria 2863404153 2863408956 331
70 iso_pu_bacteria 2867346516 2867350927 331
71 iso_pu_bacteria 2867428634 2867428801 331
72 iso_pu_bacteria 2873151551 2873152912 331
73 iso_pu_bacteria 2877676314 2877678722 331
74 iso_pu_bacteria 2912715099 2912717281 331
75 iso_pu_bacteria 2912723979 2912727478 331
76 iso_pu_bacteria 2946045630 2946052329 331
77 iso_pu_bacteria 2946064051 2946070161 331
78 iso_pu_bacteria 2946072368 2946078038 331
79 iso_pu_bacteria 2947224130 2947226633 331
80 iso_pu_bacteria 2954002825 2954005849 331
81 iso_pu_bacteria 2954380949 2954383693 331
82 iso_pu_bacteria 2954673503 2954679281 331
83 iso_pu_bacteria 2954682443 2954684874 331
84 iso_pu_bacteria 2954691527 2954694493 331
85 iso_pu_bacteria 2954701450 2954709695 331
86 iso_pu_bacteria 2954711539 2954713982 331
87 iso_pu_bacteria 2954721474 2954723951 331
88 iso_pu_bacteria 2954731030 2954737886 331
89 iso_pu_bacteria 2954740390 2954742848 331
90 iso_pu_bacteria 2954749733 2954756741 331
91 iso_pu_bacteria 2954759201 2954761807 331
92 iso_pu_bacteria 2966598605 2966599694 331
93 iso_pu_bacteria 2990044586 2990045942 331
94 iso_pu_bacteria 2990059506 2990062391 331
95 iso_pu_bacteria 3006425503 3006426492 331
96 iso_pu_bacteria 3006493962 3006499983 331
97 iso_pu_bacteria 8008485437 8008487290 331
98 iso_pu_bacteria 8008558824 8008563117 331
99 iso_pu_bacteria 8008574985 8008576850 331
100 iso_pu_bacteria 8023623736 8023625659 331
101 iso_pu_bacteria 8025524527 8025526277 331
102 iso_pu_bacteria 8047893842 8047895776 331
103 iso_pu_bacteria 8048356638 8048363158 331
104 iso_pu_bacteria 8048369669 8048372800 331
105 iso_pu_bacteria 8048379754 8048381734 331
106 iso_pu_bacteria 8048406513 8048409846 331
107 3300031247 Ga0265340_10002282 Ga0265340_100022825 333
108 3300049581 Ga0501047_0111188 Ga0501047_0111188_850_1860 333
109 3300031838 Ga0307518_10021358 Ga0307518_100213585 334
110 3300033179 Ga0307507_10008032 Ga0307507_100080327 334
111 3300049569 Ga0501032_0109903 Ga0501032_0109903_138_1142 334
112 3300049823 Ga0501044_0141979 Ga0501044_0141979_559_1563 334
113 3300003316 rootH1_10000410 rootH1_100004104 335
114 3300003316 rootH1_10056692 rootH1_100566923 335
115 3300003320 rootH2_10092353 rootH2_100923532 335
116 3300003323 rootH1_10068609 rootH1_100686092 335
117 3300003578 Ga0006562J51391_1086190 Ga0006562J51391_10861901 335
118 3300005436 Ga0070713_100019799 Ga0070713_1000197993 335
119 3300005437 Ga0070710_10015906 Ga0070710_100159062 335
120 3300005467 Ga0070706_100016385 Ga0070706_1000163856 335
121 3300005471 Ga0070698_100102935 Ga0070698_1001029353 335
122 3300005539 Ga0068853_100087575 Ga0068853_1000875752 335
123 3300005937 Ga0081455_10077531 Ga0081455_100775312 335
124 3300006038 Ga0075365_10055929 Ga0075365_100559291 335
125 3300006175 Ga0070712_100047773 Ga0070712_1000477733 335
126 3300006178 Ga0075367_10001753 Ga0075367_100017536 335
127 3300006948 Ga0099826_10041177 Ga0099826_100411772 335
128 3300009011 Ga0105251_10012369 Ga0105251_100123691 335
129 3300009092 Ga0105250_10089375 Ga0105250_100893751 335
130 3300009148 Ga0105243_10023121 Ga0105243_100231211 335
131 3300011119 Ga0105246_10037080 Ga0105246_100370802 335
132 3300011119 Ga0105246_10269352 Ga0105246_102693521 335
133 3300013105 Ga0157369_10078229 Ga0157369_100782291 335
134 3300013307 Ga0157372_10032897 Ga0157372_100328972 335
135 3300014497 Ga0182008_10005982 Ga0182008_100059824 335
136 3300014968 Ga0157379_10034585 Ga0157379_100345853 335
137 3300015262 Ga0182007_10000397 Ga0182007_1000039714 335
138 3300015688 Ga0183367_1013 Ga0183367_101340 335
139 3300020081 Ga0206354_11453619 Ga0206354_114536192 335
140 3300022467 Ga0224712_10034799 Ga0224712_100347992 335
141 3300025297 Ga0209758_1028213 Ga0209758_10282131 335
142 3300025735 Ga0207713_1023898 Ga0207713_10238982 335
143 3300025898 Ga0207692_10021203 Ga0207692_100212033 335
144 3300025904 Ga0207647_10015132 Ga0207647_100151322 335
145 3300025906 Ga0207699_10060977 Ga0207699_100609771 335
146 3300025910 Ga0207684_10004232 Ga0207684_100042322 335
147 3300025915 Ga0207693_10103498 Ga0207693_101034981 335
148 3300025928 Ga0207700_10010447 Ga0207700_100104473 335
149 3300025929 Ga0207664_10104191 Ga0207664_101041912 335
150 3300027866 Ga0209813_10022141 Ga0209813_100221412 335
151 3300028786 Ga0307517_10004438 Ga0307517_100044383 335
152 3300028786 Ga0307517_10007934 Ga0307517_1000793413 335
153 3300028794 Ga0307515_10003217 Ga0307515_100032176 335
154 3300028794 Ga0307515_10199718 Ga0307515_101997181 335
155 3300028800 Ga0265338_10041769 Ga0265338_100417692 335
156 3300030521 Ga0307511_10000330 Ga0307511_1000033025 335
157 3300030522 Ga0307512_10002763 Ga0307512_1000276315 335
158 3300030522 Ga0307512_10016776 Ga0307512_100167764 335
159 3300031456 Ga0307513_10030690 Ga0307513_100306906 335
160 3300031507 Ga0307509_10044756 Ga0307509_100447564 335
161 3300031616 Ga0307508_10002014 Ga0307508_1000201412 335
162 3300031616 Ga0307508_10009978 Ga0307508_100099784 335
163 3300031649 Ga0307514_10025441 Ga0307514_100254414 335
164 3300031730 Ga0307516_10009775 Ga0307516_100097752 335
165 3300031730 Ga0307516_10202812 Ga0307516_102028121 335
166 3300031838 Ga0307518_10084778 Ga0307518_100847781 335
167 3300032005 Ga0307411_10017364 Ga0307411_100173642 335
168 3300035116 Ga0373945_0088659 Ga0373945_0088659_97_1110 335
169 3300037418 Ga0395900_0011600 Ga0395900_0011600_1558_2571 335
170 3300037418 Ga0395900_0271108 Ga0395900_0271108_63_1076 335
171 3300037466 Ga0395898_0018381 Ga0395898_0018381_5151_6167 335
172 3300038443 Ga0395901_0021348 Ga0395901_0021348_3068_4081 335
173 3300041404 Ga0439436_0023004 Ga0439436_0023004_662_1672 335
174 3300041406 Ga0439439_0006112 Ga0439439_0006112_1750_2763 335
175 3300041406 Ga0439439_0040843 Ga0439439_0040843_23_1033 335
176 3300041459 Ga0451800_0777421 Ga0451800_0777421_1073_2086 335
177 3300041498 Ga0451841_0610447 Ga0451841_0610447_1563_2570 335
178 3300041512 Ga0451853_0293138 Ga0451853_0293138_3733_4743 335
179 3300041999 Ga0439433_0001537 Ga0439433_0001537_283_1296 335
180 3300042002 Ga0439442_009966 Ga0439442_009966_129_1142 335
181 3300042005 Ga0439448_0003700 Ga0439448_0003700_1972_2985 335
182 3300042006 Ga0439432_022588 Ga0439432_022588_845_1858 335
183 3300042007 Ga0439449_0000168 Ga0439449_0000168_6215_7222 335
184 3300042012 Ga0439455_0003817 Ga0439455_0003817_494_1507 335
185 3300042014 Ga0439457_000053 Ga0439457_000053_5866_6876 335
186 3300042014 Ga0439457_003869 Ga0439457_003869_1456_2469 335
187 3300042015 Ga0439462_0000842 Ga0439462_0000842_1192_2205 335
188 3300042134 Ga0450898_001100 Ga0450898_001100_2377_3390 335
189 3300042135 Ga0450899_000134 Ga0450899_000134_4612_5625 335
190 3300042138 Ga0450903_000124 Ga0450903_000124_11761_12774 335
191 3300042145 Ga0450906_000781 Ga0450906_000781_1315_2328 335
192 3300042157 Ga0439458_0005775 Ga0439458_0005775_219_1232 335
193 3300044656 Ga0466969_0042725 Ga0466969_0042725_291_1310 335
194 3300044658 Ga0466972_0033444 Ga0466972_0033444_581_1594 335
195 3300044683 Ga0466965_0005207 Ga0466965_0005207_1609_2628 335
196 3300044683 Ga0466965_0032283 Ga0466965_0032283_1447_2460 335
197 3300044684 Ga0466966_0002038 Ga0466966_0002038_8642_9661 335
198 3300044693 Ga0466961_0005949 Ga0466961_0005949_4360_5379 335
199 3300044693 Ga0466961_0030059 Ga0466961_0030059_133_1146 335
200 3300044694 Ga0466963_0000146 Ga0466963_0000146_2372_3391 335
201 3300044694 Ga0466963_0011427 Ga0466963_0011427_110_1255 335
202 3300044706 Ga0466964_0009672 Ga0466964_0009672_2357_3376 335
203 3300044719 Ga0466971_0000183 Ga0466971_0000183_18447_19466 335
204 3300044719 Ga0466971_0051684 Ga0466971_0051684_604_1617 335
205 3300044765 Ga0466970_0001715 Ga0466970_0001715_6213_7226 335
206 3300044765 Ga0466970_0005057 Ga0466970_0005057_2343_3362 335
207 3300044842 Ga0466957_0011169 Ga0466957_0011169_3362_4381 335
208 3300044842 Ga0466957_0131379 Ga0466957_0131379_475_1482 335
209 3300044901 Ga0466960_0002854 Ga0466960_0002854_5016_6029 335
210 3300045049 Ga0466959_0007348 Ga0466959_0007348_4357_5376 335
211 3300045836 Ga0466958_0054785 Ga0466958_0054785_1399_2409 335
212 3300045836 Ga0466958_0243564 Ga0466958_0243564_66_1079 335
213 3300045976 Ga0466967_0054358 Ga0466967_0054358_2335_3354 335
214 3300045976 Ga0466967_0494815 Ga0466967_0494815_31_1044 335
215 3300046454 Ga0495592_0005850 Ga0495592_0005850_4362_5375 335
216 3300046454 Ga0495592_0015158 Ga0495592_0015158_365_1378 335
217 3300046454 Ga0495592_0023265 Ga0495592_0023265_1719_2732 335
218 3300046455 Ga0495603_0001216 Ga0495603_0001216_10972_11979 335
219 3300046455 Ga0495603_0024636 Ga0495603_0024636_361_1374 335
220 3300046455 Ga0495603_0030860 Ga0495603_0030860_264_1277 335
221 3300046459 Ga0495629_0002950 Ga0495629_0002950_10930_11937 335
222 3300046459 Ga0495629_0158652 Ga0495629_0158652_321_1346 335
223 3300046460 Ga0495638_0034388 Ga0495638_0034388_372_1385 335
224 3300046460 Ga0495638_0087551 Ga0495638_0087551_858_1871 335
225 3300046462 Ga0495651_0000524 Ga0495651_0000524_19703_20716 335
226 3300046462 Ga0495651_0014919 Ga0495651_0014919_1666_2676 335
227 3300046462 Ga0495651_0033191 Ga0495651_0033191_1071_2084 335
228 3300046462 Ga0495651_0156255 Ga0495651_0156255_414_1439 335
229 3300046463 Ga0495653_0172639 Ga0495653_0172639_432_1445 335
230 3300046472 Ga0495580_0072008 Ga0495580_0072008_1329_2342 335
231 3300046473 Ga0495582_0022579 Ga0495582_0022579_1344_2357 335
232 3300046474 Ga0495605_0008627 Ga0495605_0008627_1255_2268 335
233 3300046475 Ga0495639_0014031 Ga0495639_0014031_2392_3405 335
234 3300046476 Ga0495662_0011168 Ga0495662_0011168_2777_3790 335
235 3300046476 Ga0495662_0040295 Ga0495662_0040295_990_2003 335
236 3300046476 Ga0495662_0096925 Ga0495662_0096925_165_1178 335
237 3300046477 Ga0495664_0001079 Ga0495664_0001079_8311_9324 335
238 3300046477 Ga0495664_0024639 Ga0495664_0024639_1899_2912 335
239 3300046477 Ga0495664_0174924 Ga0495664_0174924_67_1092 335
240 3300046491 Ga0495584_0089026 Ga0495584_0089026_183_1196 335
241 3300046492 Ga0495585_0065197 Ga0495585_0065197_225_1238 335
242 3300046499 Ga0495594_0020148 Ga0495594_0020148_264_1277 335
243 3300046499 Ga0495594_0048988 Ga0495594_0048988_668_1681 335
244 3300046500 Ga0495596_0028174 Ga0495596_0028174_849_1862 335
245 3300046501 Ga0495607_0018245 Ga0495607_0018245_814_1827 335
246 3300046506 Ga0495583_0046832 Ga0495583_0046832_385_1398 335
247 3300046507 Ga0495606_0024704 Ga0495606_0024704_2581_3594 335
248 3300046511 Ga0495608_0104569 Ga0495608_0104569_662_1675 335
249 3300046513 Ga0495616_0013088 Ga0495616_0013088_1740_2753 335
250 3300046514 Ga0495618_0031950 Ga0495618_0031950_2179_3192 335
251 3300046515 Ga0495620_0079247 Ga0495620_0079247_212_1228 335
252 3300046516 Ga0495628_0012123 Ga0495628_0012123_3373_4398 335
253 3300046516 Ga0495628_0118263 Ga0495628_0118263_958_1971 335
254 3300046518 Ga0495631_0007611 Ga0495631_0007611_3263_4276 335
255 3300046520 Ga0495637_0037693 Ga0495637_0037693_665_1678 335
256 3300046522 Ga0495643_0001394 Ga0495643_0001394_14782_15795 335
257 3300046522 Ga0495643_0007416 Ga0495643_0007416_4298_5311 335
258 3300046523 Ga0495644_0090923 Ga0495644_0090923_80_1093 335
259 3300046529 Ga0495652_0001233 Ga0495652_0001233_3383_4393 335
260 3300046529 Ga0495652_0002029 Ga0495652_0002029_13532_14545 335
261 3300046529 Ga0495652_0003213 Ga0495652_0003213_10587_11600 335
262 3300046529 Ga0495652_0034807 Ga0495652_0034807_211_1224 335
263 3300046529 Ga0495652_0117669 Ga0495652_0117669_1038_2063 335
264 3300046530 Ga0495654_0016419 Ga0495654_0016419_302_1315 335
265 3300046533 Ga0495640_0002129 Ga0495640_0002129_12002_13027 335
266 3300046533 Ga0495640_0010617 Ga0495640_0010617_2245_3258 335
267 3300046536 Ga0495587_0082921 Ga0495587_0082921_659_1672 335
268 3300046538 Ga0495609_0077063 Ga0495609_0077063_195_1208 335
269 3300046543 Ga0495645_0002213 Ga0495645_0002213_4178_5191 335
270 3300046543 Ga0495645_0005940 Ga0495645_0005940_1071_2084 335
271 3300046543 Ga0495645_0035635 Ga0495645_0035635_284_1294 335
272 3300046557 Ga0495622_0031052 Ga0495622_0031052_438_1451 335
273 3300046557 Ga0495622_0039616 Ga0495622_0039616_954_1964 335
274 3300046558 Ga0495633_0015923 Ga0495633_0015923_1726_2739 335
275 3300046559 Ga0495667_0225834 Ga0495667_0225834_15_1028 335
276 3300046642 Ga0495634_0003067 Ga0495634_0003067_8293_9306 335
277 3300046642 Ga0495634_0009578 Ga0495634_0009578_912_1937 335
278 3300046648 Ga0495611_0114950 Ga0495611_0114950_29_1042 335
279 3300046660 Ga0495625_0011616 Ga0495625_0011616_1877_2890 335
280 3300046660 Ga0495625_0108063 Ga0495625_0108063_674_1687 335
281 3300046663 Ga0495635_0002772 Ga0495635_0002772_10791_11804 335
282 3300046663 Ga0495635_0090367 Ga0495635_0090367_199_1212 335
283 3300046665 Ga0495661_0019468 Ga0495661_0019468_2285_3298 335
284 3300046665 Ga0495661_0174867 Ga0495661_0174867_106_1122 335
285 3300046674 Ga0495588_0002553 Ga0495588_0002553_3862_4875 335
286 3300046674 Ga0495588_0003476 Ga0495588_0003476_2365_3378 335
287 3300046674 Ga0495588_0031769 Ga0495588_0031769_1245_2258 335
288 3300046674 Ga0495588_0102157 Ga0495588_0102157_176_1186 335
289 3300046675 Ga0495657_0001197 Ga0495657_0001197_15833_16846 335
290 3300046675 Ga0495657_0001943 Ga0495657_0001943_14961_15974 335
291 3300046675 Ga0495657_0072724 Ga0495657_0072724_1099_2112 335
292 3300046679 Ga0495623_0038350 Ga0495623_0038350_1300_2325 335
293 3300046679 Ga0495623_0084619 Ga0495623_0084619_724_1737 335
294 3300046680 Ga0495646_0001151 Ga0495646_0001151_4776_5789 335
295 3300046680 Ga0495646_0001634 Ga0495646_0001634_7930_8943 335
296 3300046680 Ga0495646_0147093 Ga0495646_0147093_289_1302 335
297 3300046683 Ga0495658_0026633 Ga0495658_0026633_1734_2747 335
298 3300046689 Ga0495613_0000891 Ga0495613_0000891_9420_10445 335
299 3300046689 Ga0495613_0004432 Ga0495613_0004432_5934_6947 335
300 3300046689 Ga0495613_0030584 Ga0495613_0030584_582_1589 335
301 3300046689 Ga0495613_0113676 Ga0495613_0113676_868_1881 335
302 3300046689 Ga0495613_0152788 Ga0495613_0152788_43_1056 335
303 3300046690 Ga0495624_0019071 Ga0495624_0019071_2436_3449 335
304 3300046690 Ga0495624_0022727 Ga0495624_0022727_2002_3027 335
305 3300046691 Ga0495670_0009087 Ga0495670_0009087_193_1206 335
306 3300046692 Ga0495671_0016495 Ga0495671_0016495_2136_3149 335
307 3300046694 Ga0495649_0151593 Ga0495649_0151593_144_1157 335
308 3300046794 Ga0495589_0028409 Ga0495589_0028409_289_1302 335
309 3300046794 Ga0495589_0127794 Ga0495589_0127794_91_1104 335
310 3300046809 Ga0495600_0020638 Ga0495600_0020638_214_1227 335
311 3300046809 Ga0495600_0062271 Ga0495600_0062271_246_1259 335
312 3300046810 Ga0495660_0004850 Ga0495660_0004850_3596_4609 335
313 3300047315 Ga0495581_0003896 Ga0495581_0003896_240_1253 335
314 3300047315 Ga0495581_0077442 Ga0495581_0077442_438_1451 335
315 3300047315 Ga0495581_0133032 Ga0495581_0133032_98_1111 335
316 3300047317 Ga0495604_0002075 Ga0495604_0002075_5158_6171 335
317 3300047317 Ga0495604_0007564 Ga0495604_0007564_2142_3167 335
318 3300047317 Ga0495604_0008214 Ga0495604_0008214_2399_3424 335
319 3300047318 Ga0495636_0106877 Ga0495636_0106877_149_1162 335
320 3300047319 Ga0495674_0138681 Ga0495674_0138681_977_1990 335
321 3300047321 Ga0495676_0003699 Ga0495676_0003699_8116_9129 335
322 3300047321 Ga0495676_0006919 Ga0495676_0006919_2888_3913 335
323 3300047321 Ga0495676_0010115 Ga0495676_0010115_3250_4257 335
324 3300047321 Ga0495676_0033289 Ga0495676_0033289_38_1051 335
325 3300047321 Ga0495676_0049916 Ga0495676_0049916_38_1051 335
326 3300047322 Ga0495680_0031808 Ga0495680_0031808_347_1360 335
327 3300047443 Ga0495687_004714 Ga0495687_004714_7157_8170 335
328 3300047443 Ga0495687_007193 Ga0495687_007193_4104_5117 335
329 3300047443 Ga0495687_089447 Ga0495687_089447_120_1133 335
330 3300047444 Ga0495675_0064496 Ga0495675_0064496_11_1036 335
331 3300047444 Ga0495675_0132703 Ga0495675_0132703_149_1174 335
332 3300047447 Ga0495685_001078 Ga0495685_001078_3590_4603 335
333 3300047447 Ga0495685_008472 Ga0495685_008472_428_1444 335
334 3300047447 Ga0495685_018200 Ga0495685_018200_1262_2272 335
335 3300047470 Ga0495681_0001129 Ga0495681_0001129_3577_4590 335
336 3300047470 Ga0495681_0001720 Ga0495681_0001720_5126_6139 335
337 3300047470 Ga0495681_0078149 Ga0495681_0078149_39_1052 335
338 3300047472 Ga0495686_0031290 Ga0495686_0031290_2118_3131 335
339 3300047472 Ga0495686_0105796 Ga0495686_0105796_505_1518 335
340 3300047472 Ga0495686_0128037 Ga0495686_0128037_317_1330 335
341 3300047673 Ga0495593_0000452 Ga0495593_0000452_15268_16281 335
342 3300047673 Ga0495593_0106665 Ga0495593_0106665_120_1127 335
343 3300048088 Ga0495602_0008634 Ga0495602_0008634_6364_7377 335
344 3300048088 Ga0495602_0073385 Ga0495602_0073385_1344_2357 335
345 3300048089 Ga0495614_0000375 Ga0495614_0000375_11314_12321 335
346 3300048091 Ga0495626_0031176 Ga0495626_0031176_1445_2458 335
347 3300048912 Ga0496109_0097396 Ga0496109_0097396_1160_2173 335
348 3300049569 Ga0501032_0070020 Ga0501032_0070020_384_1400 335
349 3300049570 Ga0501033_0014740 Ga0501033_0014740_224_1252 335
350 3300049570 Ga0501033_0047998 Ga0501033_0047998_2081_3106 335
351 3300049570 Ga0501033_0116889 Ga0501033_0116889_654_1667 335
352 3300049571 Ga0501034_0002564 Ga0501034_0002564_324_1352 335
353 3300049571 Ga0501034_0033184 Ga0501034_0033184_2267_3280 335
354 3300049571 Ga0501034_0036250 Ga0501034_0036250_512_1537 335
355 3300049571 Ga0501034_0235512 Ga0501034_0235512_514_1533 335
356 3300049572 Ga0501036_0009392 Ga0501036_0009392_5481_6509 335
357 3300049572 Ga0501036_0014482 Ga0501036_0014482_2934_3947 335
358 3300049573 Ga0501037_0016004 Ga0501037_0016004_257_1282 335
359 3300049574 Ga0501038_0074681 Ga0501038_0074681_1671_2696 335
360 3300049574 Ga0501038_0081144 Ga0501038_0081144_113_1141 335
361 3300049575 Ga0501039_0015671 Ga0501039_0015671_1547_2575 335
362 3300049575 Ga0501039_0299911 Ga0501039_0299911_116_1141 335
363 3300049578 Ga0501042_0176617 Ga0501042_0176617_206_1231 335
364 3300049579 Ga0501043_0010045 Ga0501043_0010045_3189_4214 335
365 3300049579 Ga0501043_0070177 Ga0501043_0070177_1510_2538 335
366 3300049579 Ga0501043_0083619 Ga0501043_0083619_769_1785 335
367 3300049581 Ga0501047_0065615 Ga0501047_0065615_1989_3017 335
368 3300049581 Ga0501047_0128183 Ga0501047_0128183_376_1392 335
369 3300049582 Ga0501048_0005317 Ga0501048_0005317_6471_7496 335
370 3300049582 Ga0501048_0106633 Ga0501048_0106633_933_1949 335
371 3300049586 Ga0501070_0018669 Ga0501070_0018669_3256_4284 335
372 3300049586 Ga0501070_0282786 Ga0501070_0282786_26_1042 335
373 3300049586 Ga0501070_0338055 Ga0501070_0338055_109_1116 335
374 3300049588 Ga0501072_0370431 Ga0501072_0370431_57_1073 335
375 3300049590 Ga0501074_0012839 Ga0501074_0012839_4932_5945 335
376 3300049742 Ga0501080_0148882 Ga0501080_0148882_753_1769 335
377 3300049822 Ga0501035_0009429 Ga0501035_0009429_4232_5257 335
378 3300049822 Ga0501035_0032451 Ga0501035_0032451_2170_3198 335
379 3300049822 Ga0501035_0054593 Ga0501035_0054593_2332_3357 335
380 3300049822 Ga0501035_0190156 Ga0501035_0190156_126_1139 335
381 3300049822 Ga0501035_0252662 Ga0501035_0252662_49_1065 335
382 3300049823 Ga0501044_0010851 Ga0501044_0010851_1026_2042 335
383 3300049823 Ga0501044_0061616 Ga0501044_0061616_1823_2848 335
384 3300049823 Ga0501044_0223395 Ga0501044_0223395_748_1764 335
385 3300049823 Ga0501044_0252012 Ga0501044_0252012_81_1094 335
386 3300050492 nmdc:mga0yw44_45898_c1 nmdc:mga0yw44_45898_c1_148_1161 335
387 3300050494 nmdc:mga06z11_928_c1 nmdc:mga06z11_928_c1_7579_8595 335
388 3300050495 nmdc:mga04h51_18215_c1 nmdc:mga04h51_18215_c1_205_1221 335
389 3300053077 Ga0495601_0000374 Ga0495601_0000374_13640_14653 335
390 3300053078 Ga0495612_0007800 Ga0495612_0007800_1926_2939 335
391 3300053083 Ga0495655_0031820 Ga0495655_0031820_73_1086 335
392 3300053085 Ga0495619_0036547 Ga0495619_0036547_1497_2510 335
393 3300053086 Ga0500578_0016568 Ga0500578_0016568_1310_2323 335
394 3300053086 Ga0500578_0071115 Ga0500578_0071115_545_1558 335
395 3300053094 Ga0500566_0045023 Ga0500566_0045023_551_1564 335
396 3300053095 Ga0500640_000774 Ga0500640_000774_3884_4897 335
397 3300053099 Ga0500654_017852 Ga0500654_017852_3448_4461 335
398 3300053109 Ga0500569_009469 Ga0500569_009469_1054_2067 335
399 3300053131 Ga0500652_002313 Ga0500652_002313_2285_3298 335
400 3300053134 Ga0500658_0002215 Ga0500658_0002215_2914_3927 335
401 3300053137 Ga0500561_0000856 Ga0500561_0000856_3678_4691 335
402 3300053140 Ga0500573_0016289 Ga0500573_0016289_1532_2545 335
403 3300053140 Ga0500573_0049007 Ga0500573_0049007_1139_2146 335
404 3300053140 Ga0500573_0083601 Ga0500573_0083601_460_1476 335
405 3300053143 Ga0500579_047921 Ga0500579_047921_417_1430 335
406 3300053149 Ga0500600_0013770 Ga0500600_0013770_410_1423 335
407 3300053153 Ga0500616_0005774 Ga0500616_0005774_3713_4726 335
408 3300053160 Ga0500633_0004674 Ga0500633_0004674_1829_2842 335
409 3300053161 Ga0500634_0004836 Ga0500634_0004836_3697_4710 335
410 3300061719 Ga0466962_0003151 Ga0466962_0003151_2336_3355 335
411 iso_pu_bacteria 2811994917 2812478476 335
412 iso_pu_bacteria 2919468124 2919472546 335
413 iso_pu_bacteria 8048127548 8048129038 335

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00356

LacI

Bacterial regulatory proteins, lacI family

45

90

0.98

PF13377

Peripla_BP_3

Periplasmic binding protein-like domain

210

372

0.87

PF00532

Peripla_BP_1

Periplasmic binding proteins and sugar binding domain of LacI family

102

369

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
1osl-assembly1.cif.gz_B solution structure of a dimeric lactose dna-binding domain complexed to a nonspecific dna sequence 0.8941 2 48
1osl-assembly1.cif.gz_A solution structure of a dimeric lactose dna-binding domain complexed to a nonspecific dna sequence 0.8885 2 48
4o5a-assembly1.cif.gz_A-2 the crystal structure of a laci family transcriptional regulator from bifidobacterium animalis subsp. lactis dsm 10140 0.8779 57 334
4o5a-assembly1.cif.gz_A-2 the crystal structure of a laci family transcriptional regulator from bifidobacterium animalis subsp. lactis dsm 10140 0.8749 57 334
3bbl-assembly1.cif.gz_A crystal structure of a regulatory protein of laci family from chloroflexus aggregans 0.8664 60 331
ID Description Score Start End Superfamily
2jcgA01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9276 2 49 1.10.260.40
2jcgA01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.876 2 49 1.10.260.40
2hsgA01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8746 1 55 1.10.260.40
3c3kB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8667 161 289 3.40.50.2300
1lqcA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8598 2 48 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A0K8QF23-F1-model_v4 HTH-type transcriptional repressor PurR 0.9007 58 335 GO:0000976
GO:0003700
AF-A0A4Y3PNJ6-F1-model_v4 DNA-binding transcriptional regulator CytR 0.8873 74 331 GO:0000976
GO:0003700
AF-A0A847B1A5-F1-model_v4 LacI family transcriptional regulator 0.883 64 331 GO:0000976
GO:0003700
AF-A0A0K8QF23-F1-model_v4 HTH-type transcriptional repressor PurR 0.8686 58 335 GO:0000976
GO:0003700
AF-A0A154MPU9-F1-model_v4 Transcriptional regulator LacI/GalR-like sensor domain-containing protein 0.8644 156 335 GO:0000976
GO:0003700

Feature Viewer

pLDDT pTM Quality
89.44 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map