F438055

General Info

Members Datasets Scaffolds Average Seq Length
413 248 413 107

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_12101790|Ga0105248_121017901
Length 125
Sequence MQPRPTGGVFLFMDYSKLDGLIPAVIQDAVTSEVLMVGFMNEEALALTRSTGFATFFSRTRNKLWMKGETSGNRLAVVEMLVDCDDDTVLLKVNRLGDGNVCHTGERTCFYRPLDSREGQKESNR

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
173 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
175 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
176 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
177 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
178 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
183 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
184 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
185 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
186 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
187 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
188 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
189 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
190 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
191 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
192 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
193 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
194 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
195 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
196 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
197 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
198 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
199 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
200 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
201 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
202 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
203 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
204 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
205 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
206 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
207 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
208 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
209 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
227 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
228 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
229 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
230 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
231 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
232 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
233 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
234 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
235 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
236 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
237 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
238 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
239 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
240 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
241 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
242 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
243 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
244 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
245 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
246 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
247 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
248 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.87
Nodule 0
Rhizoplane 8.72
Rhizosphere 86.92
Stem 0
Stem Tuber 0
Unclassified 0.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10002945 3300005290 Bacteria 5478
2 Ga0065712_10339967 3300005290 Unclassified 795
3 Ga0065715_10177905 3300005293 Bacteria 1497
4 Ga0065715_10237691 3300005293 Bacteria 1210
5 Ga0065707_10046912 3300005295 Unclassified 895
6 Ga0065707_10093761 3300005295 Bacteria 3583
7 Ga0065707_10472881 3300005295 Bacteria 780
8 Ga0070676_10282006 3300005328 Bacteria 1120
9 Ga0070683_100002324 3300005329 Bacteria 15080
10 Ga0070683_101413338 3300005329 Bacteria 669
11 Ga0070690_100059469 3300005330 Bacteria 2457
12 Ga0070670_100351010 3300005331 Unclassified 1296
13 Ga0070670_101028744 3300005331 Bacteria 750
14 Ga0070670_102194847 3300005331 Bacteria 509
15 Ga0070677_10699264 3300005333 Bacteria 571
16 Ga0068869_100669468 3300005334 Bacteria 883
17 Ga0068869_100931333 3300005334 Bacteria 753
18 Ga0070666_10112861 3300005335 Bacteria 1880
19 Ga0070666_11153556 3300005335 Bacteria 577
20 Ga0070680_100391513 3300005336 Unclassified 1184
21 Ga0070660_100056571 3300005339 Bacteria 3035
22 Ga0070660_100403082 3300005339 Bacteria 1131
23 Ga0070660_100804230 3300005339 Bacteria 791
24 Ga0070689_100162338 3300005340 Bacteria 1807
25 Ga0070661_100004126 3300005344 Bacteria 10015
26 Ga0070661_100053519 3300005344 Unclassified 2954
27 Ga0070661_100275856 3300005344 Bacteria 1303
28 Ga0070661_100382936 3300005344 Bacteria 1109
29 Ga0070692_10245010 3300005345 Bacteria 1070
30 Ga0070668_100073985 3300005347 Bacteria 2657
31 Ga0070668_100803579 3300005347 Bacteria 836
32 Ga0070669_100549740 3300005353 Bacteria 962
33 Ga0070675_100169106 3300005354 Bacteria 1884
34 Ga0070675_101281535 3300005354 Unclassified 675
35 Ga0070671_100188256 3300005355 Unclassified 1749
36 Ga0070674_100160995 3300005356 Bacteria 1703
37 Ga0070674_100554486 3300005356 Bacteria 965
38 Ga0070673_100579945 3300005364 Bacteria 1021
39 Ga0070688_100010104 3300005365 Bacteria 5190
40 Ga0070659_101301579 3300005366 Unclassified 644
41 Ga0070659_101571617 3300005366 Bacteria 587
42 Ga0070667_100216038 3300005367 Bacteria 1705
43 Ga0070667_100680024 3300005367 Unclassified 951
44 Ga0070703_10032877 3300005406 Bacteria 1577
45 Ga0070709_10119012 3300005434 Bacteria 1787
46 Ga0070714_100079912 3300005435 Bacteria 2844
47 Ga0070713_100347729 3300005436 Bacteria 1375
48 Ga0070713_100506371 3300005436 Bacteria 1140
49 Ga0070701_11115863 3300005438 Bacteria 556
50 Ga0070711_100037865 3300005439 Bacteria 3238
51 Ga0070700_100789521 3300005441 Bacteria 764
52 Ga0070694_100021125 3300005444 Bacteria 4156
53 Ga0070694_100038581 3300005444 Bacteria 3175
54 Ga0070708_100842161 3300005445 Bacteria 862
55 Ga0070663_100270581 3300005455 Bacteria 1350
56 Ga0070678_100127864 3300005456 Bacteria 2014
57 Ga0070678_100839959 3300005456 Unclassified 836
58 Ga0070678_100978185 3300005456 Bacteria 777
59 Ga0070662_100571807 3300005457 Bacteria 949
60 Ga0070662_100881158 3300005457 Bacteria 763
61 Ga0070662_101215548 3300005457 Unclassified 648
62 Ga0070681_10569440 3300005458 Unclassified 1046
63 Ga0068867_100027034 3300005459 Bacteria 4122
64 Ga0070698_100036368 3300005471 Bacteria 5087
65 Ga0070698_100162397 3300005471 Bacteria 2177
66 Ga0070698_101547256 3300005471 Bacteria 615
67 Ga0070699_100953683 3300005518 Unclassified 786
68 Ga0070679_100087753 3300005530 Bacteria 3098
69 Ga0070679_100100591 3300005530 Bacteria 2877
70 Ga0070684_100047572 3300005535 Bacteria 3717
71 Ga0070684_100100644 3300005535 Bacteria 2581
72 Ga0070684_100995306 3300005535 Bacteria 787
73 Ga0070697_101961491 3300005536 Bacteria 524
74 Ga0068853_100443103 3300005539 Bacteria 1221
75 Ga0068853_100620154 3300005539 Bacteria 1028
76 Ga0070672_100014651 3300005543 Bacteria 5561
77 Ga0070686_100001728 3300005544 Bacteria 12204
78 Ga0070695_100005860 3300005545 Bacteria 7250
79 Ga0070695_101479791 3300005545 Bacteria 565
80 Ga0070696_100811575 3300005546 Unclassified 771
81 Ga0070693_100023522 3300005547 Bacteria 3294
82 Ga0070693_100381721 3300005547 Bacteria 972
83 Ga0070704_100005836 3300005549 Bacteria 7209
84 Ga0070704_100670962 3300005549 Bacteria 917
85 Ga0068855_100228612 3300005563 Bacteria 2084
86 Ga0068855_100250136 3300005563 Unclassified 1977
87 Ga0068855_101260292 3300005563 Bacteria 767
88 Ga0070664_100002207 3300005564 Bacteria 15653
89 Ga0070664_100038845 3300005564 Unclassified 4008
90 Ga0070664_101179585 3300005564 Bacteria 722
91 Ga0068857_100077800 3300005577 Unclassified 2960
92 Ga0068854_100035591 3300005578 Bacteria 3486
93 Ga0068856_100025435 3300005614 Bacteria 5774
94 Ga0070702_100692356 3300005615 Bacteria 776
95 Ga0068852_100214451 3300005616 Unclassified 1828
96 Ga0068859_100002238 3300005617 Bacteria 19628
97 Ga0068859_100427543 3300005617 Bacteria 1421
98 Ga0068864_100065786 3300005618 Bacteria 3145
99 Ga0068866_10702782 3300005718 Bacteria 694
100 Ga0068861_100219467 3300005719 Bacteria 1606
101 Ga0068861_100817705 3300005719 Bacteria 876
102 Ga0068861_102193526 3300005719 Unclassified 553
103 Ga0068851_10018040 3300005834 Unclassified 3398
104 Ga0068863_100106497 3300005841 Bacteria 2668
105 Ga0068858_100229468 3300005842 Bacteria 1760
106 Ga0068858_100231465 3300005842 Bacteria 1752
107 Ga0068862_100289954 3300005844 Bacteria 1503
108 Ga0081540_1100875 3300005983 Archaea 1243
109 Ga0075368_10050115 3300006042 Bacteria 1657
110 Ga0075364_10357671 3300006051 Bacteria 995
111 Ga0075432_10370028 3300006058 Bacteria 612
112 Ga0070716_100047147 3300006173 Bacteria 2429
113 Ga0070716_100777467 3300006173 Unclassified 739
114 Ga0070712_100001771 3300006175 Bacteria 13214
115 Ga0075362_10044295 3300006177 Bacteria 1973
116 Ga0075367_10035832 3300006178 Bacteria 2874
117 Ga0075367_10062809 3300006178 Bacteria 2219
118 Ga0075366_10027064 3300006195 Bacteria 3363
119 Ga0097621_100140986 3300006237 Bacteria 2059
120 Ga0097621_100447689 3300006237 Bacteria 1163
121 Ga0068871_100002048 3300006358 Bacteria 13659
122 Ga0068871_100868137 3300006358 Bacteria 835
123 Ga0075428_100546919 3300006844 Bacteria 1238
124 Ga0075433_10593438 3300006852 Bacteria 973
125 Ga0075434_101077777 3300006871 Bacteria 817
126 Ga0075429_100613026 3300006880 Bacteria 954
127 Ga0068865_100052056 3300006881 Bacteria 2836
128 Ga0075436_100064493 3300006914 Bacteria 2532
129 Ga0075436_101128635 3300006914 Bacteria 591
130 Ga0097620_100002238 3300006931 Bacteria 19628
131 Ga0097620_100427547 3300006931 Bacteria 1421
132 Ga0075435_100062058 3300007076 Bacteria 3033
133 Ga0105240_10075729 3300009093 Bacteria 4150
134 Ga0105240_10185270 3300009093 Bacteria 2452
135 Ga0105240_12361233 3300009093 Bacteria 551
136 Ga0111539_10255374 3300009094 Bacteria 2041
137 Ga0105245_10776824 3300009098 Bacteria 995
138 Ga0105245_11250590 3300009098 Unclassified 791
139 Ga0114129_10952855 3300009147 Bacteria 1084
140 Ga0114129_11672355 3300009147 Bacteria 777
141 Ga0105243_10004718 3300009148 Bacteria 10732
142 Ga0105243_10964680 3300009148 Bacteria 853
143 Ga0105243_11963988 3300009148 Bacteria 619
144 Ga0105241_10028556 3300009174 Bacteria 4158
145 Ga0105241_10072756 3300009174 Bacteria 2672
146 Ga0105241_11100498 3300009174 Bacteria 748
147 Ga0105242_10000922 3300009176 Bacteria 22858
148 Ga0105242_10761851 3300009176 Bacteria 954
149 Ga0105242_10991111 3300009176 Bacteria 847
150 Ga0105248_10011078 3300009177 Bacteria 9947
151 Ga0105248_10234767 3300009177 Unclassified 2064
152 Ga0105248_10272964 3300009177 Bacteria 1904
153 Ga0105248_10408034 3300009177 Bacteria 1530
154 Ga0105248_12101790 3300009177 Bacteria 642
155 Ga0105248_12179701 3300009177 Bacteria 630
156 Ga0105237_10121976 3300009545 Unclassified 2601
157 Ga0105237_11536671 3300009545 Bacteria 672
158 Ga0105238_10026889 3300009551 Bacteria 5864
159 Ga0105249_10120916 3300009553 Unclassified 2488
160 Ga0105249_10637369 3300009553 Bacteria 1123
161 Ga0105249_10724247 3300009553 Bacteria 1056
162 Ga0105249_11716779 3300009553 Bacteria 700
163 Ga0105246_10947349 3300011119 Bacteria 776
164 Ga0157373_10054006 3300013100 Unclassified 2855
165 Ga0157370_11054125 3300013104 Unclassified 735
166 Ga0157369_10043001 3300013105 Bacteria 4926
167 Ga0157369_10181588 3300013105 Bacteria 2214
168 Ga0157374_10085501 3300013296 Bacteria 2999
169 Ga0157374_10089014 3300013296 Bacteria 2941
170 Ga0157378_10550250 3300013297 Bacteria 1159
171 Ga0157378_10674023 3300013297 Bacteria 1051
172 Ga0157378_13110010 3300013297 Unclassified 515
173 Ga0163162_10515114 3300013306 Bacteria 1326
174 Ga0157372_10047050 3300013307 Bacteria 4791
175 Ga0157372_10318996 3300013307 Bacteria 1809
176 Ga0157375_10908468 3300013308 Unclassified 1024
177 Ga0157375_12496864 3300013308 Unclassified 617
178 Ga0157375_12739304 3300013308 Bacteria 589
179 Ga0163163_10003462 3300014325 Bacteria 13417
180 Ga0163163_10100882 3300014325 Bacteria 2908
181 Ga0157380_10192712 3300014326 Bacteria 1801
182 Ga0157380_10465209 3300014326 Bacteria 1218
183 Ga0157380_10560613 3300014326 Unclassified 1123
184 Ga0157380_10628697 3300014326 Bacteria 1067
185 Ga0157380_10895215 3300014326 Unclassified 913
186 Ga0182008_10100705 3300014497 Unclassified 1428
187 Ga0157377_10531994 3300014745 Unclassified 827
188 Ga0157379_10568649 3300014968 Bacteria 1056
189 Ga0157379_10818991 3300014968 Unclassified 879
190 Ga0157379_12463761 3300014968 Bacteria 520
191 Ga0157376_10008076 3300014969 Bacteria 7564
192 Ga0182005_1061164 3300015265 Unclassified 1029
193 Ga0163161_11862759 3300017792 Bacteria 535
194 Ga0207697_10017184 3300025315 Bacteria 2973
195 Ga0207697_10100134 3300025315 Bacteria 1234
196 Ga0207656_10088612 3300025321 Unclassified 1401
197 Ga0207680_10194434 3300025903 Bacteria 1379
198 Ga0207680_10518686 3300025903 Bacteria 849
199 Ga0207645_10082985 3300025907 Bacteria 2055
200 Ga0207645_10207663 3300025907 Bacteria 1289
201 Ga0207645_10236645 3300025907 Bacteria 1206
202 Ga0207643_10300445 3300025908 Bacteria 999
203 Ga0207684_10100401 3300025910 Bacteria 2473
204 Ga0207654_10537232 3300025911 Bacteria 829
205 Ga0207654_10620591 3300025911 Unclassified 773
206 Ga0207707_10029311 3300025912 Bacteria 4811
207 Ga0207707_10065192 3300025912 Bacteria 3172
208 Ga0207695_10217317 3300025913 Bacteria 1820
209 Ga0207695_10751222 3300025913 Bacteria 856
210 Ga0207671_10298728 3300025914 Bacteria 1272
211 Ga0207671_10955668 3300025914 Unclassified 676
212 Ga0207693_10390433 3300025915 Bacteria 1088
213 Ga0207663_10002602 3300025916 Bacteria 8685
214 Ga0207660_10395859 3300025917 Bacteria 1112
215 Ga0207657_10002282 3300025919 Bacteria 20782
216 Ga0207657_10074555 3300025919 Bacteria 2865
217 Ga0207649_10035015 3300025920 Bacteria 3014
218 Ga0207649_10099228 3300025920 Unclassified 1923
219 Ga0207649_10301923 3300025920 Bacteria 1171
220 Ga0207681_10366843 3300025923 Bacteria 1156
221 Ga0207694_10970552 3300025924 Bacteria 719
222 Ga0207650_10390843 3300025925 Bacteria 1150
223 Ga0207650_10689879 3300025925 Bacteria 862
224 Ga0207659_10156098 3300025926 Bacteria 1787
225 Ga0207659_10189245 3300025926 Bacteria 1637
226 Ga0207659_10395393 3300025926 Bacteria 1155
227 Ga0207687_10513883 3300025927 Bacteria 1001
228 Ga0207687_10560570 3300025927 Bacteria 959
229 Ga0207700_10427426 3300025928 Unclassified 1164
230 Ga0207644_10028553 3300025931 Bacteria 3864
231 Ga0207644_10113386 3300025931 Unclassified 2053
232 Ga0207690_10131157 3300025932 Unclassified 1834
233 Ga0207690_11225021 3300025932 Unclassified 627
234 Ga0207706_10206853 3300025933 Unclassified 1721
235 Ga0207706_10345363 3300025933 Bacteria 1294
236 Ga0207706_10391146 3300025933 Bacteria 1206
237 Ga0207686_10456035 3300025934 Bacteria 984
238 Ga0207709_10909438 3300025935 Bacteria 716
239 Ga0207670_10230806 3300025936 Bacteria 1421
240 Ga0207669_10034556 3300025937 Bacteria 2866
241 Ga0207669_10140133 3300025937 Bacteria 1677
242 Ga0207669_11102561 3300025937 Bacteria 670
243 Ga0207669_11374537 3300025937 Bacteria 601
244 Ga0207665_10063096 3300025939 Bacteria 2516
245 Ga0207665_10452434 3300025939 Bacteria 986
246 Ga0207691_10084898 3300025940 Bacteria 2842
247 Ga0207691_10392872 3300025940 Bacteria 1183
248 Ga0207711_10160774 3300025941 Bacteria 2033
249 Ga0207711_11237550 3300025941 Bacteria 688
250 Ga0207711_11455883 3300025941 Bacteria 628
251 Ga0207689_10085263 3300025942 Bacteria 2596
252 Ga0207689_10865017 3300025942 Bacteria 763
253 Ga0207689_11527182 3300025942 Unclassified 557
254 Ga0207661_10096441 3300025944 Bacteria 2474
255 Ga0207661_10247130 3300025944 Unclassified 1585
256 Ga0207679_10008321 3300025945 Bacteria 6606
257 Ga0207679_10361758 3300025945 Unclassified 1267
258 Ga0207667_10396656 3300025949 Bacteria 1405
259 Ga0207667_10412757 3300025949 Unclassified 1374
260 Ga0207667_10430511 3300025949 Bacteria 1342
261 Ga0207667_10590408 3300025949 Bacteria 1121
262 Ga0207667_11971270 3300025949 Bacteria 545
263 Ga0207651_11113121 3300025960 Unclassified 708
264 Ga0207712_10482579 3300025961 Bacteria 1057
265 Ga0207668_10431681 3300025972 Bacteria 1120
266 Ga0207668_10792882 3300025972 Bacteria 838
267 Ga0207640_10005463 3300025981 Bacteria 6930
268 Ga0207658_10537794 3300025986 Unclassified 1044
269 Ga0207677_10410056 3300026023 Unclassified 1151
270 Ga0207703_10458005 3300026035 Bacteria 1192
271 Ga0207703_10724794 3300026035 Bacteria 946
272 Ga0207703_11659247 3300026035 Unclassified 615
273 Ga0207639_10796923 3300026041 Unclassified 880
274 Ga0207639_10817030 3300026041 Unclassified 869
275 Ga0207678_10024455 3300026067 Bacteria 5275
276 Ga0207678_11799232 3300026067 Unclassified 536
277 Ga0207708_10153900 3300026075 Bacteria 1812
278 Ga0207708_10669257 3300026075 Bacteria 885
279 Ga0207702_10058993 3300026078 Bacteria 3267
280 Ga0207702_10492016 3300026078 Bacteria 1195
281 Ga0207648_10111478 3300026089 Bacteria 2402
282 Ga0207676_10111492 3300026095 Bacteria 2290
283 Ga0207676_10608027 3300026095 Unclassified 1051
284 Ga0207674_10302378 3300026116 Unclassified 1549
285 Ga0207675_100013818 3300026118 Bacteria 7529
286 Ga0207675_100248308 3300026118 Bacteria 1721
287 Ga0207675_100336659 3300026118 Bacteria 1476
288 Ga0207675_100812268 3300026118 Bacteria 949
289 Ga0207683_11266832 3300026121 Bacteria 683
290 Ga0207683_11674315 3300026121 Unclassified 585
291 Ga0207698_10169275 3300026142 Bacteria 1922
292 Ga0207698_10582230 3300026142 Unclassified 1101
293 Ga0207698_10885702 3300026142 Bacteria 899
294 Ga0209813_10154904 3300027866 Bacteria 823
295 Ga0207428_10459650 3300027907 Bacteria 927
296 Ga0207428_10461082 3300027907 Bacteria 926
297 Ga0268265_10579606 3300028380 Bacteria 1069
298 Ga0268265_12055822 3300028380 Bacteria 578
299 Ga0268264_10072498 3300028381 Bacteria 2921
300 Ga0307413_10705180 3300031824 Bacteria 839
301 Ga0307409_101348297 3300031995 Bacteria 739
302 Ga0307415_101481983 3300032126 Bacteria 649
303 Ga0373932_0026004 3300035112 Bacteria 1589
304 Ga0373936_0551298 3300035113 Bacteria 539
305 Ga0373953_0063309 3300035117 Bacteria 1516
306 Ga0373957_0043454 3300035120 Bacteria 1698
307 Ga0373955_0157385 3300035172 Bacteria 1339
308 Ga0373924_0495739 3300035410 Bacteria 549
309 Ga0373931_0412977 3300035691 Bacteria 857
310 Ga0373933_0073841 3300035724 Bacteria 2079
311 Ga0373937_0026096 3300036401 Bacteria 5279
312 Ga0373937_0366784 3300036401 Bacteria 1365
313 Ga0373937_1516626 3300036401 Bacteria 618
314 Ga0373925_1233214 3300037068 Unclassified 614
315 Ga0395900_1327775 3300037418 Bacteria 633
316 Ga0395905_0705975 3300037471 Bacteria 911
317 Ga0436363_0398386 3300039450 Bacteria 1194
318 Ga0439453_0104101 3300041408 Unclassified 636
319 Ga0451800_0893812 3300041459 Bacteria 616
320 Ga0451802_1027204 3300041460 Bacteria 795
321 Ga0451853_2836263 3300041512 Bacteria 1394
322 Ga0439434_0050175 3300042435 Bacteria 1292
323 Ga0450893_0133324 3300042532 Bacteria 526
324 Ga0451577_1274925 3300042876 Bacteria 654
325 Ga0453684_0512483 3300044712 Bacteria 1326
326 Ga0495629_0080338 3300046459 Bacteria 2277
327 Ga0495651_0130425 3300046462 Bacteria 1836
328 Ga0495664_0605844 3300046477 Bacteria 651
329 Ga0495618_0265159 3300046514 Bacteria 1075
330 Ga0495628_0280992 3300046516 Bacteria 1236
331 Ga0495630_1095631 3300046517 Bacteria 604
332 Ga0495640_0586731 3300046533 Bacteria 674
333 Ga0495586_0120075 3300046535 Bacteria 1468
334 Ga0495586_0669812 3300046535 Unclassified 599
335 Ga0495645_0053842 3300046543 Bacteria 2924
336 Ga0495667_0032114 3300046559 Bacteria 3521
337 Ga0495635_0938876 3300046663 Unclassified 553
338 Ga0495658_0037488 3300046683 Bacteria 2680
339 Ga0495613_0160607 3300046689 Bacteria 1599
340 Ga0495613_0481250 3300046689 Bacteria 838
341 Ga0495600_0140539 3300046809 Bacteria 1567
342 Ga0495674_0181671 3300047319 Bacteria 1751
343 Ga0495672_0298992 3300047320 Bacteria 763
344 Ga0495680_0595479 3300047322 Bacteria 740
345 Ga0496100_0082962 3300048903 Unclassified 2169
346 Ga0496100_0260143 3300048903 Bacteria 1287
347 Ga0496100_0992642 3300048903 Bacteria 661
348 Ga0496101_0064836 3300048904 Bacteria 2662
349 Ga0496102_0773994 3300048905 Bacteria 882
350 Ga0496103_0050145 3300048906 Bacteria 2582
351 Ga0496104_0004383 3300048907 Bacteria 12294
352 Ga0496104_0358068 3300048907 Bacteria 1372
353 Ga0496105_0050509 3300048908 Unclassified 3435
354 Ga0496105_0317336 3300048908 Bacteria 1250
355 Ga0496106_0085056 3300048909 Unclassified 2435
356 Ga0496106_0138830 3300048909 Bacteria 1911
357 Ga0496107_0060392 3300048910 Unclassified 2744
358 Ga0496107_0089418 3300048910 Bacteria 2249
359 Ga0496108_0001111 3300048911 Bacteria 21045
360 Ga0496108_1260529 3300048911 Unclassified 623
361 Ga0496109_0003746 3300048912 Bacteria 12705
362 Ga0496109_0125334 3300048912 Bacteria 2395
363 Ga0496110_0020710 3300048913 Bacteria 5554
364 Ga0496110_0570957 3300048913 Bacteria 1027
365 Ga0496110_1005038 3300048913 Bacteria 741
366 Ga0496110_1257869 3300048913 Bacteria 649
367 Ga0496111_0045504 3300048914 Bacteria 3158
368 Ga0496111_0084990 3300048914 Bacteria 2313
369 Ga0496112_0129377 3300048915 Unclassified 2496
370 Ga0496112_0222010 3300048915 Bacteria 1845
371 Ga0496112_0456994 3300048915 Bacteria 1214
372 Ga0496112_0674393 3300048915 Unclassified 962
373 Ga0496113_0050162 3300048916 Unclassified 3110
374 Ga0496113_0512572 3300048916 Unclassified 963
375 Ga0496114_0049807 3300048917 Bacteria 3486
376 Ga0496114_0068280 3300048917 Bacteria 2984
377 Ga0496114_1162705 3300048917 Bacteria 657
378 Ga0496114_1314263 3300048917 Bacteria 610
379 Ga0501034_0076317 3300049571 Bacteria 3358
380 Ga0501072_0151678 3300049588 Bacteria 1848
381 Ga0501076_0791655 3300049592 Bacteria 782
382 Ga0501080_0157335 3300049742 Bacteria 2099
383 Ga0501080_0517145 3300049742 Bacteria 1065
384 Ga0501081_0790700 3300049743 Bacteria 714
385 nmdc:mga03683_546698_c1 3300050489 Bacteria 564
386 nmdc:mga00v17_306408_c1 3300050491 Bacteria 1032
387 nmdc:mga06z11_106497_c1 3300050494 Bacteria 1546
388 nmdc:mga06z11_136587_c1 3300050494 Bacteria 1382
389 nmdc:mga06z11_843886_c1 3300050494 Bacteria 558
390 nmdc:mga04h51_134074_c1 3300050495 Bacteria 934
391 nmdc:mga05p37_520756_c1 3300050507 Bacteria 1360
392 nmdc:mga05p37_600029_c1 3300050507 Bacteria 1243
393 nmdc:mga09592_702230_c1 3300050508 Bacteria 861
394 nmdc:mga06r32_1394885_c1 3300050510 Bacteria 642
395 nmdc:mga08y16_1028742_c1 3300050511 Bacteria 802
396 nmdc:mga08y16_117986_c1 3300050511 Bacteria 2762
397 nmdc:mga08y16_626592_c1 3300050511 Bacteria 1082
398 nmdc:mga0n895_1356834_c1 3300050512 Bacteria 680
399 nmdc:mga0n895_290935_c1 3300050512 Bacteria 1656
400 nmdc:mga0n895_48166_c1 3300050512 Bacteria 4170
401 nmdc:mga0rr50_44676_c1 3300050513 Bacteria 3251
402 nmdc:mga08x19_4181_c1 3300050514 Bacteria 8555
403 nmdc:mga08x19_517550_c1 3300050514 Bacteria 843
404 nmdc:mga08x19_540571_c1 3300050514 Bacteria 824
405 nmdc:mga0a205_483010_c1 3300050515 Bacteria 1097
406 Ga0495612_0345224 3300053078 Bacteria 672
407 Ga0495619_0156911 3300053085 Bacteria 1571
408 Ga0495619_0213520 3300053085 Bacteria 1336
409 Ga0500556_0194646 3300053104 Bacteria 801
410 Ga0500568_0009853 3300053139 Bacteria 4514
411 Ga0500611_128714 3300053727 Bacteria 681
412 Ga0501084_1161509 3300054114 Bacteria 648
413 Ga0501082_0530973 3300060353 Bacteria 1029

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005331 Ga0070670_101028744 Ga0070670_1010287442 102
2 3300005335 Ga0070666_11153556 Ga0070666_111535561 102
3 3300005339 Ga0070660_100804230 Ga0070660_1008042302 102
4 3300005347 Ga0070668_100803579 Ga0070668_1008035791 102
5 3300005354 Ga0070675_101281535 Ga0070675_1012815351 102
6 3300005459 Ga0068867_100027034 Ga0068867_1000270345 102
7 3300005718 Ga0068866_10702782 Ga0068866_107027822 102
8 3300006042 Ga0075368_10050115 Ga0075368_100501152 102
9 3300006177 Ga0075362_10044295 Ga0075362_100442952 102
10 3300006178 Ga0075367_10035832 Ga0075367_100358324 102
11 3300006195 Ga0075366_10027064 Ga0075366_100270642 102
12 3300006237 Ga0097621_100140986 Ga0097621_1001409862 102
13 3300006358 Ga0068871_100002048 Ga0068871_1000020488 102
14 3300006358 Ga0068871_100868137 Ga0068871_1008681371 102
15 3300006881 Ga0068865_100052056 Ga0068865_1000520562 102
16 3300009093 Ga0105240_12361233 Ga0105240_123612331 102
17 3300009176 Ga0105242_10000922 Ga0105242_1000092219 102
18 3300014326 Ga0157380_10560613 Ga0157380_105606132 102
19 3300014969 Ga0157376_10008076 Ga0157376_100080762 102
20 3300025903 Ga0207680_10518686 Ga0207680_105186862 102
21 3300025925 Ga0207650_10390843 Ga0207650_103908432 102
22 3300025927 Ga0207687_10560570 Ga0207687_105605702 102
23 3300025937 Ga0207669_11102561 Ga0207669_111025611 102
24 3300025941 Ga0207711_11237550 Ga0207711_112375502 102
25 3300025949 Ga0207667_10430511 Ga0207667_104305111 102
26 3300025972 Ga0207668_10792882 Ga0207668_107928822 102
27 3300026089 Ga0207648_10111478 Ga0207648_101114781 102
28 3300026121 Ga0207683_11266832 Ga0207683_112668322 102
29 3300026142 Ga0207698_10885702 Ga0207698_108857022 102
30 3300027866 Ga0209813_10154904 Ga0209813_101549042 102
31 3300031824 Ga0307413_10705180 Ga0307413_107051801 102
32 3300031995 Ga0307409_101348297 Ga0307409_1013482971 102
33 3300032126 Ga0307415_101481983 Ga0307415_1014819832 102
34 3300035113 Ga0373936_0551298 Ga0373936_0551298_153_461 102
35 3300035120 Ga0373957_0043454 Ga0373957_0043454_94_402 102
36 3300035172 Ga0373955_0157385 Ga0373955_0157385_321_629 102
37 3300035410 Ga0373924_0495739 Ga0373924_0495739_20_328 102
38 3300035724 Ga0373933_0073841 Ga0373933_0073841_1118_1426 102
39 3300036401 Ga0373937_0026096 Ga0373937_0026096_3203_3511 102
40 3300041408 Ga0439453_0104101 Ga0439453_0104101_246_554 102
41 3300041460 Ga0451802_1027204 Ga0451802_1027204_328_642 102
42 3300046459 Ga0495629_0080338 Ga0495629_0080338_123_431 102
43 3300046462 Ga0495651_0130425 Ga0495651_0130425_768_1076 102
44 3300046477 Ga0495664_0605844 Ga0495664_0605844_35_343 102
45 3300046514 Ga0495618_0265159 Ga0495618_0265159_355_663 102
46 3300046517 Ga0495630_1095631 Ga0495630_1095631_21_329 102
47 3300046533 Ga0495640_0586731 Ga0495640_0586731_268_576 102
48 3300046535 Ga0495586_0120075 Ga0495586_0120075_650_958 102
49 3300046535 Ga0495586_0669812 Ga0495586_0669812_232_540 102
50 3300046543 Ga0495645_0053842 Ga0495645_0053842_1647_1955 102
51 3300046559 Ga0495667_0032114 Ga0495667_0032114_2128_2436 102
52 3300046663 Ga0495635_0938876 Ga0495635_0938876_171_479 102
53 3300046683 Ga0495658_0037488 Ga0495658_0037488_1564_1872 102
54 3300046689 Ga0495613_0160607 Ga0495613_0160607_989_1297 102
55 3300046809 Ga0495600_0140539 Ga0495600_0140539_1054_1362 102
56 3300047319 Ga0495674_0181671 Ga0495674_0181671_473_781 102
57 3300047322 Ga0495680_0595479 Ga0495680_0595479_256_564 102
58 3300048907 Ga0496104_0358068 Ga0496104_0358068_77_385 102
59 3300048908 Ga0496105_0317336 Ga0496105_0317336_197_505 102
60 3300048917 Ga0496114_0068280 Ga0496114_0068280_434_742 102
61 3300048917 Ga0496114_1314263 Ga0496114_1314263_94_402 102
62 3300049571 Ga0501034_0076317 Ga0501034_0076317_216_524 102
63 3300049588 Ga0501072_0151678 Ga0501072_0151678_926_1234 102
64 3300049742 Ga0501080_0157335 Ga0501080_0157335_1269_1577 102
65 3300050489 nmdc:mga03683_546698_c1 nmdc:mga03683_546698_c1_190_519 102
66 3300050494 nmdc:mga06z11_136587_c1 nmdc:mga06z11_136587_c1_430_759 102
67 3300050495 nmdc:mga04h51_134074_c1 nmdc:mga04h51_134074_c1_162_491 102
68 3300053078 Ga0495612_0345224 Ga0495612_0345224_301_609 102
69 3300053085 Ga0495619_0156911 Ga0495619_0156911_46_354 102
70 3300053085 Ga0495619_0213520 Ga0495619_0213520_426_734 102
71 3300005290 Ga0065712_10002945 Ga0065712_100029453 103
72 3300005290 Ga0065712_10339967 Ga0065712_103399672 103
73 3300005293 Ga0065715_10177905 Ga0065715_101779052 103
74 3300005293 Ga0065715_10237691 Ga0065715_102376912 103
75 3300005295 Ga0065707_10046912 Ga0065707_100469122 103
76 3300005295 Ga0065707_10093761 Ga0065707_100937612 103
77 3300005295 Ga0065707_10472881 Ga0065707_104728812 103
78 3300005328 Ga0070676_10282006 Ga0070676_102820062 103
79 3300005329 Ga0070683_100002324 Ga0070683_1000023243 103
80 3300005329 Ga0070683_101413338 Ga0070683_1014133382 103
81 3300005330 Ga0070690_100059469 Ga0070690_1000594692 103
82 3300005331 Ga0070670_100351010 Ga0070670_1003510102 103
83 3300005331 Ga0070670_102194847 Ga0070670_1021948471 103
84 3300005333 Ga0070677_10699264 Ga0070677_106992641 103
85 3300005334 Ga0068869_100669468 Ga0068869_1006694682 103
86 3300005334 Ga0068869_100931333 Ga0068869_1009313332 103
87 3300005335 Ga0070666_10112861 Ga0070666_101128613 103
88 3300005336 Ga0070680_100391513 Ga0070680_1003915132 103
89 3300005339 Ga0070660_100056571 Ga0070660_1000565712 103
90 3300005339 Ga0070660_100403082 Ga0070660_1004030822 103
91 3300005340 Ga0070689_100162338 Ga0070689_1001623382 103
92 3300005344 Ga0070661_100004126 Ga0070661_1000041266 103
93 3300005344 Ga0070661_100053519 Ga0070661_1000535194 103
94 3300005344 Ga0070661_100275856 Ga0070661_1002758562 103
95 3300005344 Ga0070661_100382936 Ga0070661_1003829361 103
96 3300005345 Ga0070692_10245010 Ga0070692_102450102 103
97 3300005347 Ga0070668_100073985 Ga0070668_1000739851 103
98 3300005353 Ga0070669_100549740 Ga0070669_1005497402 103
99 3300005354 Ga0070675_100169106 Ga0070675_1001691062 103
100 3300005355 Ga0070671_100188256 Ga0070671_1001882562 103
101 3300005356 Ga0070674_100160995 Ga0070674_1001609952 103
102 3300005356 Ga0070674_100554486 Ga0070674_1005544862 103
103 3300005364 Ga0070673_100579945 Ga0070673_1005799451 103
104 3300005365 Ga0070688_100010104 Ga0070688_1000101044 103
105 3300005366 Ga0070659_101301579 Ga0070659_1013015791 103
106 3300005366 Ga0070659_101571617 Ga0070659_1015716171 103
107 3300005367 Ga0070667_100216038 Ga0070667_1002160382 103
108 3300005367 Ga0070667_100680024 Ga0070667_1006800242 103
109 3300005406 Ga0070703_10032877 Ga0070703_100328772 103
110 3300005434 Ga0070709_10119012 Ga0070709_101190122 103
111 3300005435 Ga0070714_100079912 Ga0070714_1000799125 103
112 3300005436 Ga0070713_100347729 Ga0070713_1003477293 103
113 3300005436 Ga0070713_100506371 Ga0070713_1005063712 103
114 3300005438 Ga0070701_11115863 Ga0070701_111158631 103
115 3300005439 Ga0070711_100037865 Ga0070711_1000378652 103
116 3300005441 Ga0070700_100789521 Ga0070700_1007895211 103
117 3300005444 Ga0070694_100021125 Ga0070694_1000211252 103
118 3300005444 Ga0070694_100038581 Ga0070694_1000385813 103
119 3300005445 Ga0070708_100842161 Ga0070708_1008421611 103
120 3300005455 Ga0070663_100270581 Ga0070663_1002705812 103
121 3300005456 Ga0070678_100127864 Ga0070678_1001278643 103
122 3300005456 Ga0070678_100839959 Ga0070678_1008399592 103
123 3300005456 Ga0070678_100978185 Ga0070678_1009781851 103
124 3300005457 Ga0070662_100571807 Ga0070662_1005718072 103
125 3300005457 Ga0070662_100881158 Ga0070662_1008811582 103
126 3300005457 Ga0070662_101215548 Ga0070662_1012155482 103
127 3300005458 Ga0070681_10569440 Ga0070681_105694402 103
128 3300005471 Ga0070698_100036368 Ga0070698_1000363682 103
129 3300005471 Ga0070698_100162397 Ga0070698_1001623973 103
130 3300005471 Ga0070698_101547256 Ga0070698_1015472561 103
131 3300005518 Ga0070699_100953683 Ga0070699_1009536831 103
132 3300005530 Ga0070679_100087753 Ga0070679_1000877532 103
133 3300005530 Ga0070679_100100591 Ga0070679_1001005912 103
134 3300005535 Ga0070684_100047572 Ga0070684_1000475723 103
135 3300005535 Ga0070684_100100644 Ga0070684_1001006442 103
136 3300005535 Ga0070684_100995306 Ga0070684_1009953062 103
137 3300005536 Ga0070697_101961491 Ga0070697_1019614911 103
138 3300005539 Ga0068853_100443103 Ga0068853_1004431032 103
139 3300005539 Ga0068853_100620154 Ga0068853_1006201542 103
140 3300005543 Ga0070672_100014651 Ga0070672_1000146512 103
141 3300005544 Ga0070686_100001728 Ga0070686_1000017287 103
142 3300005545 Ga0070695_100005860 Ga0070695_1000058608 103
143 3300005545 Ga0070695_101479791 Ga0070695_1014797911 103
144 3300005546 Ga0070696_100811575 Ga0070696_1008115752 103
145 3300005547 Ga0070693_100023522 Ga0070693_1000235223 103
146 3300005547 Ga0070693_100381721 Ga0070693_1003817211 103
147 3300005549 Ga0070704_100005836 Ga0070704_1000058365 103
148 3300005549 Ga0070704_100670962 Ga0070704_1006709622 103
149 3300005563 Ga0068855_100228612 Ga0068855_1002286122 103
150 3300005563 Ga0068855_100250136 Ga0068855_1002501362 103
151 3300005563 Ga0068855_101260292 Ga0068855_1012602922 103
152 3300005564 Ga0070664_100002207 Ga0070664_10000220712 103
153 3300005564 Ga0070664_100038845 Ga0070664_1000388454 103
154 3300005564 Ga0070664_101179585 Ga0070664_1011795851 103
155 3300005577 Ga0068857_100077800 Ga0068857_1000778002 103
156 3300005578 Ga0068854_100035591 Ga0068854_1000355912 103
157 3300005614 Ga0068856_100025435 Ga0068856_1000254354 103
158 3300005615 Ga0070702_100692356 Ga0070702_1006923562 103
159 3300005616 Ga0068852_100214451 Ga0068852_1002144511 103
160 3300005617 Ga0068859_100002238 Ga0068859_10000223820 103
161 3300005617 Ga0068859_100427543 Ga0068859_1004275433 103
162 3300005618 Ga0068864_100065786 Ga0068864_1000657863 103
163 3300005719 Ga0068861_100219467 Ga0068861_1002194672 103
164 3300005719 Ga0068861_100817705 Ga0068861_1008177051 103
165 3300005719 Ga0068861_102193526 Ga0068861_1021935261 103
166 3300005834 Ga0068851_10018040 Ga0068851_100180402 103
167 3300005841 Ga0068863_100106497 Ga0068863_1001064973 103
168 3300005842 Ga0068858_100229468 Ga0068858_1002294682 103
169 3300005842 Ga0068858_100231465 Ga0068858_1002314652 103
170 3300005844 Ga0068862_100289954 Ga0068862_1002899543 103
171 3300005983 Ga0081540_1100875 Ga0081540_11008752 103
172 3300006051 Ga0075364_10357671 Ga0075364_103576712 103
173 3300006058 Ga0075432_10370028 Ga0075432_103700281 103
174 3300006173 Ga0070716_100047147 Ga0070716_1000471473 103
175 3300006173 Ga0070716_100777467 Ga0070716_1007774672 103
176 3300006175 Ga0070712_100001771 Ga0070712_10000177113 103
177 3300006178 Ga0075367_10062809 Ga0075367_100628093 103
178 3300006237 Ga0097621_100447689 Ga0097621_1004476892 103
179 3300006844 Ga0075428_100546919 Ga0075428_1005469192 103
180 3300006852 Ga0075433_10593438 Ga0075433_105934382 103
181 3300006871 Ga0075434_101077777 Ga0075434_1010777772 103
182 3300006880 Ga0075429_100613026 Ga0075429_1006130262 103
183 3300006914 Ga0075436_100064493 Ga0075436_1000644934 103
184 3300006914 Ga0075436_101128635 Ga0075436_1011286351 103
185 3300006931 Ga0097620_100002238 Ga0097620_1000022384 103
186 3300006931 Ga0097620_100427547 Ga0097620_1004275473 103
187 3300007076 Ga0075435_100062058 Ga0075435_1000620582 103
188 3300009093 Ga0105240_10075729 Ga0105240_100757292 103
189 3300009093 Ga0105240_10185270 Ga0105240_101852702 103
190 3300009094 Ga0111539_10255374 Ga0111539_102553741 103
191 3300009098 Ga0105245_10776824 Ga0105245_107768242 103
192 3300009098 Ga0105245_11250590 Ga0105245_112505902 103
193 3300009147 Ga0114129_10952855 Ga0114129_109528552 103
194 3300009147 Ga0114129_11672355 Ga0114129_116723552 103
195 3300009148 Ga0105243_10004718 Ga0105243_1000471810 103
196 3300009148 Ga0105243_10964680 Ga0105243_109646801 103
197 3300009148 Ga0105243_11963988 Ga0105243_119639881 103
198 3300009174 Ga0105241_10028556 Ga0105241_100285565 103
199 3300009174 Ga0105241_10072756 Ga0105241_100727563 103
200 3300009174 Ga0105241_11100498 Ga0105241_111004981 103
201 3300009176 Ga0105242_10761851 Ga0105242_107618512 103
202 3300009176 Ga0105242_10991111 Ga0105242_109911112 103
203 3300009177 Ga0105248_10011078 Ga0105248_1001107810 103
204 3300009177 Ga0105248_10234767 Ga0105248_102347673 103
205 3300009177 Ga0105248_10272964 Ga0105248_102729642 103
206 3300009177 Ga0105248_10408034 Ga0105248_104080342 103
207 3300009177 Ga0105248_12101790 Ga0105248_121017901 103
208 3300009177 Ga0105248_12179701 Ga0105248_121797011 103
209 3300009545 Ga0105237_10121976 Ga0105237_101219763 103
210 3300009545 Ga0105237_11536671 Ga0105237_115366712 103
211 3300009551 Ga0105238_10026889 Ga0105238_100268895 103
212 3300009553 Ga0105249_10120916 Ga0105249_101209163 103
213 3300009553 Ga0105249_10637369 Ga0105249_106373692 103
214 3300009553 Ga0105249_10724247 Ga0105249_107242472 103
215 3300009553 Ga0105249_11716779 Ga0105249_117167791 103
216 3300011119 Ga0105246_10947349 Ga0105246_109473491 103
217 3300013100 Ga0157373_10054006 Ga0157373_100540062 103
218 3300013104 Ga0157370_11054125 Ga0157370_110541251 103
219 3300013105 Ga0157369_10043001 Ga0157369_100430015 103
220 3300013105 Ga0157369_10181588 Ga0157369_101815882 103
221 3300013296 Ga0157374_10085501 Ga0157374_100855012 103
222 3300013296 Ga0157374_10089014 Ga0157374_100890143 103
223 3300013297 Ga0157378_10550250 Ga0157378_105502501 103
224 3300013297 Ga0157378_10674023 Ga0157378_106740232 103
225 3300013297 Ga0157378_13110010 Ga0157378_131100101 103
226 3300013306 Ga0163162_10515114 Ga0163162_105151142 103
227 3300013307 Ga0157372_10047050 Ga0157372_100470505 103
228 3300013307 Ga0157372_10318996 Ga0157372_103189962 103
229 3300013308 Ga0157375_10908468 Ga0157375_109084682 103
230 3300013308 Ga0157375_12496864 Ga0157375_124968642 103
231 3300013308 Ga0157375_12739304 Ga0157375_127393041 103
232 3300014325 Ga0163163_10003462 Ga0163163_100034629 103
233 3300014325 Ga0163163_10100882 Ga0163163_101008824 103
234 3300014326 Ga0157380_10192712 Ga0157380_101927123 103
235 3300014326 Ga0157380_10465209 Ga0157380_104652092 103
236 3300014326 Ga0157380_10628697 Ga0157380_106286972 103
237 3300014326 Ga0157380_10895215 Ga0157380_108952152 103
238 3300014497 Ga0182008_10100705 Ga0182008_101007051 103
239 3300014745 Ga0157377_10531994 Ga0157377_105319941 103
240 3300014968 Ga0157379_10568649 Ga0157379_105686492 103
241 3300014968 Ga0157379_10818991 Ga0157379_108189912 103
242 3300014968 Ga0157379_12463761 Ga0157379_124637612 103
243 3300015265 Ga0182005_1061164 Ga0182005_10611642 103
244 3300017792 Ga0163161_11862759 Ga0163161_118627591 103
245 3300025315 Ga0207697_10017184 Ga0207697_100171842 103
246 3300025315 Ga0207697_10100134 Ga0207697_101001342 103
247 3300025321 Ga0207656_10088612 Ga0207656_100886122 103
248 3300025903 Ga0207680_10194434 Ga0207680_101944341 103
249 3300025907 Ga0207645_10082985 Ga0207645_100829852 103
250 3300025907 Ga0207645_10207663 Ga0207645_102076632 103
251 3300025907 Ga0207645_10236645 Ga0207645_102366452 103
252 3300025908 Ga0207643_10300445 Ga0207643_103004452 103
253 3300025910 Ga0207684_10100401 Ga0207684_101004013 103
254 3300025911 Ga0207654_10537232 Ga0207654_105372321 103
255 3300025911 Ga0207654_10620591 Ga0207654_106205911 103
256 3300025912 Ga0207707_10029311 Ga0207707_100293113 103
257 3300025912 Ga0207707_10065192 Ga0207707_100651923 103
258 3300025913 Ga0207695_10217317 Ga0207695_102173172 103
259 3300025913 Ga0207695_10751222 Ga0207695_107512222 103
260 3300025914 Ga0207671_10298728 Ga0207671_102987282 103
261 3300025914 Ga0207671_10955668 Ga0207671_109556681 103
262 3300025915 Ga0207693_10390433 Ga0207693_103904331 103
263 3300025916 Ga0207663_10002602 Ga0207663_100026028 103
264 3300025917 Ga0207660_10395859 Ga0207660_103958591 103
265 3300025919 Ga0207657_10002282 Ga0207657_100022822 103
266 3300025919 Ga0207657_10074555 Ga0207657_100745553 103
267 3300025920 Ga0207649_10035015 Ga0207649_100350153 103
268 3300025920 Ga0207649_10099228 Ga0207649_100992283 103
269 3300025920 Ga0207649_10301923 Ga0207649_103019232 103
270 3300025923 Ga0207681_10366843 Ga0207681_103668432 103
271 3300025924 Ga0207694_10970552 Ga0207694_109705522 103
272 3300025925 Ga0207650_10689879 Ga0207650_106898792 103
273 3300025926 Ga0207659_10156098 Ga0207659_101560982 103
274 3300025926 Ga0207659_10189245 Ga0207659_101892452 103
275 3300025926 Ga0207659_10395393 Ga0207659_103953932 103
276 3300025927 Ga0207687_10513883 Ga0207687_105138831 103
277 3300025928 Ga0207700_10427426 Ga0207700_104274262 103
278 3300025931 Ga0207644_10028553 Ga0207644_100285532 103
279 3300025931 Ga0207644_10113386 Ga0207644_101133863 103
280 3300025932 Ga0207690_10131157 Ga0207690_101311572 103
281 3300025932 Ga0207690_11225021 Ga0207690_112250211 103
282 3300025933 Ga0207706_10206853 Ga0207706_102068531 103
283 3300025933 Ga0207706_10345363 Ga0207706_103453632 103
284 3300025933 Ga0207706_10391146 Ga0207706_103911462 103
285 3300025934 Ga0207686_10456035 Ga0207686_104560352 103
286 3300025935 Ga0207709_10909438 Ga0207709_109094382 103
287 3300025936 Ga0207670_10230806 Ga0207670_102308062 103
288 3300025937 Ga0207669_10034556 Ga0207669_100345562 103
289 3300025937 Ga0207669_10140133 Ga0207669_101401332 103
290 3300025937 Ga0207669_11374537 Ga0207669_113745372 103
291 3300025939 Ga0207665_10063096 Ga0207665_100630963 103
292 3300025939 Ga0207665_10452434 Ga0207665_104524342 103
293 3300025940 Ga0207691_10084898 Ga0207691_100848983 103
294 3300025940 Ga0207691_10392872 Ga0207691_103928721 103
295 3300025941 Ga0207711_10160774 Ga0207711_101607742 103
296 3300025941 Ga0207711_11455883 Ga0207711_114558831 103
297 3300025942 Ga0207689_10085263 Ga0207689_100852633 103
298 3300025942 Ga0207689_10865017 Ga0207689_108650172 103
299 3300025942 Ga0207689_11527182 Ga0207689_115271821 103
300 3300025944 Ga0207661_10096441 Ga0207661_100964411 103
301 3300025944 Ga0207661_10247130 Ga0207661_102471302 103
302 3300025945 Ga0207679_10008321 Ga0207679_100083213 103
303 3300025945 Ga0207679_10361758 Ga0207679_103617582 103
304 3300025949 Ga0207667_10396656 Ga0207667_103966562 103
305 3300025949 Ga0207667_10412757 Ga0207667_104127572 103
306 3300025949 Ga0207667_10590408 Ga0207667_105904082 103
307 3300025949 Ga0207667_11971270 Ga0207667_119712702 103
308 3300025960 Ga0207651_11113121 Ga0207651_111131212 103
309 3300025961 Ga0207712_10482579 Ga0207712_104825791 103
310 3300025972 Ga0207668_10431681 Ga0207668_104316812 103
311 3300025981 Ga0207640_10005463 Ga0207640_100054633 103
312 3300025986 Ga0207658_10537794 Ga0207658_105377942 103
313 3300026023 Ga0207677_10410056 Ga0207677_104100561 103
314 3300026035 Ga0207703_10458005 Ga0207703_104580052 103
315 3300026035 Ga0207703_10724794 Ga0207703_107247941 103
316 3300026035 Ga0207703_11659247 Ga0207703_116592471 103
317 3300026041 Ga0207639_10796923 Ga0207639_107969232 103
318 3300026041 Ga0207639_10817030 Ga0207639_108170302 103
319 3300026067 Ga0207678_10024455 Ga0207678_100244552 103
320 3300026067 Ga0207678_11799232 Ga0207678_117992322 103
321 3300026075 Ga0207708_10153900 Ga0207708_101539002 103
322 3300026075 Ga0207708_10669257 Ga0207708_106692571 103
323 3300026078 Ga0207702_10058993 Ga0207702_100589932 103
324 3300026078 Ga0207702_10492016 Ga0207702_104920162 103
325 3300026095 Ga0207676_10111492 Ga0207676_101114923 103
326 3300026095 Ga0207676_10608027 Ga0207676_106080271 103
327 3300026116 Ga0207674_10302378 Ga0207674_103023782 103
328 3300026118 Ga0207675_100013818 Ga0207675_1000138189 103
329 3300026118 Ga0207675_100248308 Ga0207675_1002483082 103
330 3300026118 Ga0207675_100336659 Ga0207675_1003366592 103
331 3300026118 Ga0207675_100812268 Ga0207675_1008122682 103
332 3300026121 Ga0207683_11674315 Ga0207683_116743151 103
333 3300026142 Ga0207698_10169275 Ga0207698_101692752 103
334 3300026142 Ga0207698_10582230 Ga0207698_105822302 103
335 3300027907 Ga0207428_10459650 Ga0207428_104596502 103
336 3300027907 Ga0207428_10461082 Ga0207428_104610822 103
337 3300028380 Ga0268265_10579606 Ga0268265_105796062 103
338 3300028380 Ga0268265_12055822 Ga0268265_120558222 103
339 3300028381 Ga0268264_10072498 Ga0268264_100724981 103
340 3300035112 Ga0373932_0026004 Ga0373932_0026004_987_1298 103
341 3300035117 Ga0373953_0063309 Ga0373953_0063309_416_757 103
342 3300035691 Ga0373931_0412977 Ga0373931_0412977_505_825 103
343 3300036401 Ga0373937_0366784 Ga0373937_0366784_942_1253 103
344 3300036401 Ga0373937_1516626 Ga0373937_1516626_135_461 103
345 3300037068 Ga0373925_1233214 Ga0373925_1233214_111_422 103
346 3300037418 Ga0395900_1327775 Ga0395900_1327775_231_542 103
347 3300037471 Ga0395905_0705975 Ga0395905_0705975_191_502 103
348 3300039450 Ga0436363_0398386 Ga0436363_0398386_438_782 103
349 3300041459 Ga0451800_0893812 Ga0451800_0893812_239_565 103
350 3300041512 Ga0451853_2836263 Ga0451853_2836263_935_1252 103
351 3300042435 Ga0439434_0050175 Ga0439434_0050175_472_813 103
352 3300042532 Ga0450893_0133324 Ga0450893_0133324_187_501 103
353 3300042876 Ga0451577_1274925 Ga0451577_1274925_120_434 103
354 3300044712 Ga0453684_0512483 Ga0453684_0512483_38_355 103
355 3300046516 Ga0495628_0280992 Ga0495628_0280992_821_1159 103
356 3300046689 Ga0495613_0481250 Ga0495613_0481250_440_751 103
357 3300047320 Ga0495672_0298992 Ga0495672_0298992_44_388 103
358 3300048903 Ga0496100_0082962 Ga0496100_0082962_1364_1717 103
359 3300048903 Ga0496100_0260143 Ga0496100_0260143_852_1163 103
360 3300048903 Ga0496100_0992642 Ga0496100_0992642_135_446 103
361 3300048904 Ga0496101_0064836 Ga0496101_0064836_1938_2291 103
362 3300048905 Ga0496102_0773994 Ga0496102_0773994_501_812 103
363 3300048906 Ga0496103_0050145 Ga0496103_0050145_1256_1609 103
364 3300048907 Ga0496104_0004383 Ga0496104_0004383_6975_7286 103
365 3300048908 Ga0496105_0050509 Ga0496105_0050509_2827_3180 103
366 3300048909 Ga0496106_0085056 Ga0496106_0085056_1078_1431 103
367 3300048909 Ga0496106_0138830 Ga0496106_0138830_1305_1646 103
368 3300048910 Ga0496107_0060392 Ga0496107_0060392_600_953 103
369 3300048910 Ga0496107_0089418 Ga0496107_0089418_1673_1984 103
370 3300048911 Ga0496108_0001111 Ga0496108_0001111_10493_10804 103
371 3300048911 Ga0496108_1260529 Ga0496108_1260529_49_402 103
372 3300048912 Ga0496109_0003746 Ga0496109_0003746_3471_3782 103
373 3300048912 Ga0496109_0125334 Ga0496109_0125334_258_575 103
374 3300048913 Ga0496110_0020710 Ga0496110_0020710_801_1154 103
375 3300048913 Ga0496110_0570957 Ga0496110_0570957_416_733 103
376 3300048913 Ga0496110_1005038 Ga0496110_1005038_201_512 103
377 3300048913 Ga0496110_1257869 Ga0496110_1257869_125_442 103
378 3300048914 Ga0496111_0045504 Ga0496111_0045504_2424_2777 103
379 3300048914 Ga0496111_0084990 Ga0496111_0084990_1345_1656 103
380 3300048915 Ga0496112_0129377 Ga0496112_0129377_1996_2310 103
381 3300048915 Ga0496112_0222010 Ga0496112_0222010_1153_1464 103
382 3300048915 Ga0496112_0456994 Ga0496112_0456994_673_1026 103
383 3300048915 Ga0496112_0674393 Ga0496112_0674393_197_550 103
384 3300048916 Ga0496113_0050162 Ga0496113_0050162_1743_2096 103
385 3300048916 Ga0496113_0512572 Ga0496113_0512572_439_753 103
386 3300048917 Ga0496114_0049807 Ga0496114_0049807_1279_1614 103
387 3300048917 Ga0496114_1162705 Ga0496114_1162705_193_510 103
388 3300049592 Ga0501076_0791655 Ga0501076_0791655_423_755 103
389 3300049742 Ga0501080_0517145 Ga0501080_0517145_701_1033 103
390 3300049743 Ga0501081_0790700 Ga0501081_0790700_209_523 103
391 3300050491 nmdc:mga00v17_306408_c1 nmdc:mga00v17_306408_c1_221_562 103
392 3300050494 nmdc:mga06z11_106497_c1 nmdc:mga06z11_106497_c1_486_827 103
393 3300050494 nmdc:mga06z11_843886_c1 nmdc:mga06z11_843886_c1_30_347 103
394 3300050507 nmdc:mga05p37_520756_c1 nmdc:mga05p37_520756_c1_552_863 103
395 3300050507 nmdc:mga05p37_600029_c1 nmdc:mga05p37_600029_c1_766_1134 103
396 3300050508 nmdc:mga09592_702230_c1 nmdc:mga09592_702230_c1_516_827 103
397 3300050510 nmdc:mga06r32_1394885_c1 nmdc:mga06r32_1394885_c1_274_588 103
398 3300050511 nmdc:mga08y16_1028742_c1 nmdc:mga08y16_1028742_c1_88_402 103
399 3300050511 nmdc:mga08y16_117986_c1 nmdc:mga08y16_117986_c1_329_640 103
400 3300050511 nmdc:mga08y16_626592_c1 nmdc:mga08y16_626592_c1_136_462 103
401 3300050512 nmdc:mga0n895_1356834_c1 nmdc:mga0n895_1356834_c1_226_540 103
402 3300050512 nmdc:mga0n895_290935_c1 nmdc:mga0n895_290935_c1_1097_1408 103
403 3300050512 nmdc:mga0n895_48166_c1 nmdc:mga0n895_48166_c1_522_857 103
404 3300050513 nmdc:mga0rr50_44676_c1 nmdc:mga0rr50_44676_c1_648_983 103
405 3300050514 nmdc:mga08x19_4181_c1 nmdc:mga08x19_4181_c1_3133_3456 103
406 3300050514 nmdc:mga08x19_517550_c1 nmdc:mga08x19_517550_c1_14_325 103
407 3300050514 nmdc:mga08x19_540571_c1 nmdc:mga08x19_540571_c1_320_655 103
408 3300050515 nmdc:mga0a205_483010_c1 nmdc:mga0a205_483010_c1_138_449 103
409 3300053104 Ga0500556_0194646 Ga0500556_0194646_52_384 103
410 3300053139 Ga0500568_0009853 Ga0500568_0009853_1400_1744 103
411 3300053727 Ga0500611_128714 Ga0500611_128714_125_469 103
412 3300054114 Ga0501084_1161509 Ga0501084_1161509_137_469 103
413 3300060353 Ga0501082_0530973 Ga0501082_0530973_285_602 103

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01502

PRA-CH

Phosphoribosyl-AMP cyclohydrolase

36

111

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bgm-assembly1.cif.gz_A crystal structure of mthisn2, a bifunctional enzyme from the histidine biosynthetic pathway 0.9671 5 102
1zps-assembly1.cif.gz_A crystal structure of methanobacterium thermoautotrophicum phosphoribosyl-amp cyclohydrolase hisi 0.9644 9 103
7bgm-assembly1.cif.gz_B crystal structure of mthisn2, a bifunctional enzyme from the histidine biosynthetic pathway 0.9633 5 97
7bgn-assembly1.cif.gz_B crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway 0.9631 5 102
7bgn-assembly1.cif.gz_A crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway 0.9626 5 102
ID Description Score Start End Superfamily
af_Q2FUU3_250_343_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9715 1 85 3.10.20.810
af_C6TGF5_46_140_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9681 5 90 3.10.20.810
1zpsA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9675 9 90 3.10.20.810
af_P9WMM7_1_97_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9511 5 90 3.10.20.810
af_A0A1D8PKY7_169_272_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.921 5 90 3.10.20.810
ID Description Score Start End GO Terms
AF-A0A382RME8-F1-model_v4 Histidine biosynthesis bifunctional protein HisIE (EC 3.5.4.19) 1 1 103 GO:0000105
GO:0004635
GO:0005737
AF-A0A1Q7JJR9-F1-model_v4 phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) 0.9991 1 102 GO:0000105
GO:0004635
AF-A0A6A7L9V1-F1-model_v4 phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) 0.998 1 103 GO:0000105
GO:0004635
AF-A0A2V8E5X9-F1-model_v4 phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) 0.9978 10 103 GO:0000105
GO:0004635
AF-A0A6B1DL20-F1-model_v4 phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) 0.9971 1 102 GO:0000105
GO:0004635

Feature Viewer

pLDDT pTM Quality
96.01 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map