F438055
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 413 | 248 | 413 | 107 |
Family's Representative Sequence
| Representative Sequence | 3300009177|Ga0105248_12101790|Ga0105248_121017901 |
| Length | 125 |
| Sequence | MQPRPTGGVFLFMDYSKLDGLIPAVIQDAVTSEVLMVGFMNEEALALTRSTGFATFFSRTRNKLWMKGETSGNRLAVVEMLVDCDDDTVLLKVNRLGDGNVCHTGERTCFYRPLDSREGQKESNR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 67 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 68 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 69 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 70 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 73 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 74 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 167 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 170 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 171 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 172 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 174 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 175 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 176 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 177 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 178 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 179 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 180 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 183 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 184 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 185 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 186 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 187 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 188 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 189 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 190 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 191 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 192 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 193 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 211 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 213 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 214 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 215 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 216 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 217 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 218 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 221 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 222 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 223 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 224 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 225 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 231 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 232 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 233 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 234 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 245 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 246 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 247 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.87 |
| Nodule | 0 |
| Rhizoplane | 8.72 |
| Rhizosphere | 86.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.48 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10002945 | 3300005290 | Bacteria | 5478 |
| 2 | Ga0065712_10339967 | 3300005290 | Unclassified | 795 |
| 3 | Ga0065715_10177905 | 3300005293 | Bacteria | 1497 |
| 4 | Ga0065715_10237691 | 3300005293 | Bacteria | 1210 |
| 5 | Ga0065707_10046912 | 3300005295 | Unclassified | 895 |
| 6 | Ga0065707_10093761 | 3300005295 | Bacteria | 3583 |
| 7 | Ga0065707_10472881 | 3300005295 | Bacteria | 780 |
| 8 | Ga0070676_10282006 | 3300005328 | Bacteria | 1120 |
| 9 | Ga0070683_100002324 | 3300005329 | Bacteria | 15080 |
| 10 | Ga0070683_101413338 | 3300005329 | Bacteria | 669 |
| 11 | Ga0070690_100059469 | 3300005330 | Bacteria | 2457 |
| 12 | Ga0070670_100351010 | 3300005331 | Unclassified | 1296 |
| 13 | Ga0070670_101028744 | 3300005331 | Bacteria | 750 |
| 14 | Ga0070670_102194847 | 3300005331 | Bacteria | 509 |
| 15 | Ga0070677_10699264 | 3300005333 | Bacteria | 571 |
| 16 | Ga0068869_100669468 | 3300005334 | Bacteria | 883 |
| 17 | Ga0068869_100931333 | 3300005334 | Bacteria | 753 |
| 18 | Ga0070666_10112861 | 3300005335 | Bacteria | 1880 |
| 19 | Ga0070666_11153556 | 3300005335 | Bacteria | 577 |
| 20 | Ga0070680_100391513 | 3300005336 | Unclassified | 1184 |
| 21 | Ga0070660_100056571 | 3300005339 | Bacteria | 3035 |
| 22 | Ga0070660_100403082 | 3300005339 | Bacteria | 1131 |
| 23 | Ga0070660_100804230 | 3300005339 | Bacteria | 791 |
| 24 | Ga0070689_100162338 | 3300005340 | Bacteria | 1807 |
| 25 | Ga0070661_100004126 | 3300005344 | Bacteria | 10015 |
| 26 | Ga0070661_100053519 | 3300005344 | Unclassified | 2954 |
| 27 | Ga0070661_100275856 | 3300005344 | Bacteria | 1303 |
| 28 | Ga0070661_100382936 | 3300005344 | Bacteria | 1109 |
| 29 | Ga0070692_10245010 | 3300005345 | Bacteria | 1070 |
| 30 | Ga0070668_100073985 | 3300005347 | Bacteria | 2657 |
| 31 | Ga0070668_100803579 | 3300005347 | Bacteria | 836 |
| 32 | Ga0070669_100549740 | 3300005353 | Bacteria | 962 |
| 33 | Ga0070675_100169106 | 3300005354 | Bacteria | 1884 |
| 34 | Ga0070675_101281535 | 3300005354 | Unclassified | 675 |
| 35 | Ga0070671_100188256 | 3300005355 | Unclassified | 1749 |
| 36 | Ga0070674_100160995 | 3300005356 | Bacteria | 1703 |
| 37 | Ga0070674_100554486 | 3300005356 | Bacteria | 965 |
| 38 | Ga0070673_100579945 | 3300005364 | Bacteria | 1021 |
| 39 | Ga0070688_100010104 | 3300005365 | Bacteria | 5190 |
| 40 | Ga0070659_101301579 | 3300005366 | Unclassified | 644 |
| 41 | Ga0070659_101571617 | 3300005366 | Bacteria | 587 |
| 42 | Ga0070667_100216038 | 3300005367 | Bacteria | 1705 |
| 43 | Ga0070667_100680024 | 3300005367 | Unclassified | 951 |
| 44 | Ga0070703_10032877 | 3300005406 | Bacteria | 1577 |
| 45 | Ga0070709_10119012 | 3300005434 | Bacteria | 1787 |
| 46 | Ga0070714_100079912 | 3300005435 | Bacteria | 2844 |
| 47 | Ga0070713_100347729 | 3300005436 | Bacteria | 1375 |
| 48 | Ga0070713_100506371 | 3300005436 | Bacteria | 1140 |
| 49 | Ga0070701_11115863 | 3300005438 | Bacteria | 556 |
| 50 | Ga0070711_100037865 | 3300005439 | Bacteria | 3238 |
| 51 | Ga0070700_100789521 | 3300005441 | Bacteria | 764 |
| 52 | Ga0070694_100021125 | 3300005444 | Bacteria | 4156 |
| 53 | Ga0070694_100038581 | 3300005444 | Bacteria | 3175 |
| 54 | Ga0070708_100842161 | 3300005445 | Bacteria | 862 |
| 55 | Ga0070663_100270581 | 3300005455 | Bacteria | 1350 |
| 56 | Ga0070678_100127864 | 3300005456 | Bacteria | 2014 |
| 57 | Ga0070678_100839959 | 3300005456 | Unclassified | 836 |
| 58 | Ga0070678_100978185 | 3300005456 | Bacteria | 777 |
| 59 | Ga0070662_100571807 | 3300005457 | Bacteria | 949 |
| 60 | Ga0070662_100881158 | 3300005457 | Bacteria | 763 |
| 61 | Ga0070662_101215548 | 3300005457 | Unclassified | 648 |
| 62 | Ga0070681_10569440 | 3300005458 | Unclassified | 1046 |
| 63 | Ga0068867_100027034 | 3300005459 | Bacteria | 4122 |
| 64 | Ga0070698_100036368 | 3300005471 | Bacteria | 5087 |
| 65 | Ga0070698_100162397 | 3300005471 | Bacteria | 2177 |
| 66 | Ga0070698_101547256 | 3300005471 | Bacteria | 615 |
| 67 | Ga0070699_100953683 | 3300005518 | Unclassified | 786 |
| 68 | Ga0070679_100087753 | 3300005530 | Bacteria | 3098 |
| 69 | Ga0070679_100100591 | 3300005530 | Bacteria | 2877 |
| 70 | Ga0070684_100047572 | 3300005535 | Bacteria | 3717 |
| 71 | Ga0070684_100100644 | 3300005535 | Bacteria | 2581 |
| 72 | Ga0070684_100995306 | 3300005535 | Bacteria | 787 |
| 73 | Ga0070697_101961491 | 3300005536 | Bacteria | 524 |
| 74 | Ga0068853_100443103 | 3300005539 | Bacteria | 1221 |
| 75 | Ga0068853_100620154 | 3300005539 | Bacteria | 1028 |
| 76 | Ga0070672_100014651 | 3300005543 | Bacteria | 5561 |
| 77 | Ga0070686_100001728 | 3300005544 | Bacteria | 12204 |
| 78 | Ga0070695_100005860 | 3300005545 | Bacteria | 7250 |
| 79 | Ga0070695_101479791 | 3300005545 | Bacteria | 565 |
| 80 | Ga0070696_100811575 | 3300005546 | Unclassified | 771 |
| 81 | Ga0070693_100023522 | 3300005547 | Bacteria | 3294 |
| 82 | Ga0070693_100381721 | 3300005547 | Bacteria | 972 |
| 83 | Ga0070704_100005836 | 3300005549 | Bacteria | 7209 |
| 84 | Ga0070704_100670962 | 3300005549 | Bacteria | 917 |
| 85 | Ga0068855_100228612 | 3300005563 | Bacteria | 2084 |
| 86 | Ga0068855_100250136 | 3300005563 | Unclassified | 1977 |
| 87 | Ga0068855_101260292 | 3300005563 | Bacteria | 767 |
| 88 | Ga0070664_100002207 | 3300005564 | Bacteria | 15653 |
| 89 | Ga0070664_100038845 | 3300005564 | Unclassified | 4008 |
| 90 | Ga0070664_101179585 | 3300005564 | Bacteria | 722 |
| 91 | Ga0068857_100077800 | 3300005577 | Unclassified | 2960 |
| 92 | Ga0068854_100035591 | 3300005578 | Bacteria | 3486 |
| 93 | Ga0068856_100025435 | 3300005614 | Bacteria | 5774 |
| 94 | Ga0070702_100692356 | 3300005615 | Bacteria | 776 |
| 95 | Ga0068852_100214451 | 3300005616 | Unclassified | 1828 |
| 96 | Ga0068859_100002238 | 3300005617 | Bacteria | 19628 |
| 97 | Ga0068859_100427543 | 3300005617 | Bacteria | 1421 |
| 98 | Ga0068864_100065786 | 3300005618 | Bacteria | 3145 |
| 99 | Ga0068866_10702782 | 3300005718 | Bacteria | 694 |
| 100 | Ga0068861_100219467 | 3300005719 | Bacteria | 1606 |
| 101 | Ga0068861_100817705 | 3300005719 | Bacteria | 876 |
| 102 | Ga0068861_102193526 | 3300005719 | Unclassified | 553 |
| 103 | Ga0068851_10018040 | 3300005834 | Unclassified | 3398 |
| 104 | Ga0068863_100106497 | 3300005841 | Bacteria | 2668 |
| 105 | Ga0068858_100229468 | 3300005842 | Bacteria | 1760 |
| 106 | Ga0068858_100231465 | 3300005842 | Bacteria | 1752 |
| 107 | Ga0068862_100289954 | 3300005844 | Bacteria | 1503 |
| 108 | Ga0081540_1100875 | 3300005983 | Archaea | 1243 |
| 109 | Ga0075368_10050115 | 3300006042 | Bacteria | 1657 |
| 110 | Ga0075364_10357671 | 3300006051 | Bacteria | 995 |
| 111 | Ga0075432_10370028 | 3300006058 | Bacteria | 612 |
| 112 | Ga0070716_100047147 | 3300006173 | Bacteria | 2429 |
| 113 | Ga0070716_100777467 | 3300006173 | Unclassified | 739 |
| 114 | Ga0070712_100001771 | 3300006175 | Bacteria | 13214 |
| 115 | Ga0075362_10044295 | 3300006177 | Bacteria | 1973 |
| 116 | Ga0075367_10035832 | 3300006178 | Bacteria | 2874 |
| 117 | Ga0075367_10062809 | 3300006178 | Bacteria | 2219 |
| 118 | Ga0075366_10027064 | 3300006195 | Bacteria | 3363 |
| 119 | Ga0097621_100140986 | 3300006237 | Bacteria | 2059 |
| 120 | Ga0097621_100447689 | 3300006237 | Bacteria | 1163 |
| 121 | Ga0068871_100002048 | 3300006358 | Bacteria | 13659 |
| 122 | Ga0068871_100868137 | 3300006358 | Bacteria | 835 |
| 123 | Ga0075428_100546919 | 3300006844 | Bacteria | 1238 |
| 124 | Ga0075433_10593438 | 3300006852 | Bacteria | 973 |
| 125 | Ga0075434_101077777 | 3300006871 | Bacteria | 817 |
| 126 | Ga0075429_100613026 | 3300006880 | Bacteria | 954 |
| 127 | Ga0068865_100052056 | 3300006881 | Bacteria | 2836 |
| 128 | Ga0075436_100064493 | 3300006914 | Bacteria | 2532 |
| 129 | Ga0075436_101128635 | 3300006914 | Bacteria | 591 |
| 130 | Ga0097620_100002238 | 3300006931 | Bacteria | 19628 |
| 131 | Ga0097620_100427547 | 3300006931 | Bacteria | 1421 |
| 132 | Ga0075435_100062058 | 3300007076 | Bacteria | 3033 |
| 133 | Ga0105240_10075729 | 3300009093 | Bacteria | 4150 |
| 134 | Ga0105240_10185270 | 3300009093 | Bacteria | 2452 |
| 135 | Ga0105240_12361233 | 3300009093 | Bacteria | 551 |
| 136 | Ga0111539_10255374 | 3300009094 | Bacteria | 2041 |
| 137 | Ga0105245_10776824 | 3300009098 | Bacteria | 995 |
| 138 | Ga0105245_11250590 | 3300009098 | Unclassified | 791 |
| 139 | Ga0114129_10952855 | 3300009147 | Bacteria | 1084 |
| 140 | Ga0114129_11672355 | 3300009147 | Bacteria | 777 |
| 141 | Ga0105243_10004718 | 3300009148 | Bacteria | 10732 |
| 142 | Ga0105243_10964680 | 3300009148 | Bacteria | 853 |
| 143 | Ga0105243_11963988 | 3300009148 | Bacteria | 619 |
| 144 | Ga0105241_10028556 | 3300009174 | Bacteria | 4158 |
| 145 | Ga0105241_10072756 | 3300009174 | Bacteria | 2672 |
| 146 | Ga0105241_11100498 | 3300009174 | Bacteria | 748 |
| 147 | Ga0105242_10000922 | 3300009176 | Bacteria | 22858 |
| 148 | Ga0105242_10761851 | 3300009176 | Bacteria | 954 |
| 149 | Ga0105242_10991111 | 3300009176 | Bacteria | 847 |
| 150 | Ga0105248_10011078 | 3300009177 | Bacteria | 9947 |
| 151 | Ga0105248_10234767 | 3300009177 | Unclassified | 2064 |
| 152 | Ga0105248_10272964 | 3300009177 | Bacteria | 1904 |
| 153 | Ga0105248_10408034 | 3300009177 | Bacteria | 1530 |
| 154 | Ga0105248_12101790 | 3300009177 | Bacteria | 642 |
| 155 | Ga0105248_12179701 | 3300009177 | Bacteria | 630 |
| 156 | Ga0105237_10121976 | 3300009545 | Unclassified | 2601 |
| 157 | Ga0105237_11536671 | 3300009545 | Bacteria | 672 |
| 158 | Ga0105238_10026889 | 3300009551 | Bacteria | 5864 |
| 159 | Ga0105249_10120916 | 3300009553 | Unclassified | 2488 |
| 160 | Ga0105249_10637369 | 3300009553 | Bacteria | 1123 |
| 161 | Ga0105249_10724247 | 3300009553 | Bacteria | 1056 |
| 162 | Ga0105249_11716779 | 3300009553 | Bacteria | 700 |
| 163 | Ga0105246_10947349 | 3300011119 | Bacteria | 776 |
| 164 | Ga0157373_10054006 | 3300013100 | Unclassified | 2855 |
| 165 | Ga0157370_11054125 | 3300013104 | Unclassified | 735 |
| 166 | Ga0157369_10043001 | 3300013105 | Bacteria | 4926 |
| 167 | Ga0157369_10181588 | 3300013105 | Bacteria | 2214 |
| 168 | Ga0157374_10085501 | 3300013296 | Bacteria | 2999 |
| 169 | Ga0157374_10089014 | 3300013296 | Bacteria | 2941 |
| 170 | Ga0157378_10550250 | 3300013297 | Bacteria | 1159 |
| 171 | Ga0157378_10674023 | 3300013297 | Bacteria | 1051 |
| 172 | Ga0157378_13110010 | 3300013297 | Unclassified | 515 |
| 173 | Ga0163162_10515114 | 3300013306 | Bacteria | 1326 |
| 174 | Ga0157372_10047050 | 3300013307 | Bacteria | 4791 |
| 175 | Ga0157372_10318996 | 3300013307 | Bacteria | 1809 |
| 176 | Ga0157375_10908468 | 3300013308 | Unclassified | 1024 |
| 177 | Ga0157375_12496864 | 3300013308 | Unclassified | 617 |
| 178 | Ga0157375_12739304 | 3300013308 | Bacteria | 589 |
| 179 | Ga0163163_10003462 | 3300014325 | Bacteria | 13417 |
| 180 | Ga0163163_10100882 | 3300014325 | Bacteria | 2908 |
| 181 | Ga0157380_10192712 | 3300014326 | Bacteria | 1801 |
| 182 | Ga0157380_10465209 | 3300014326 | Bacteria | 1218 |
| 183 | Ga0157380_10560613 | 3300014326 | Unclassified | 1123 |
| 184 | Ga0157380_10628697 | 3300014326 | Bacteria | 1067 |
| 185 | Ga0157380_10895215 | 3300014326 | Unclassified | 913 |
| 186 | Ga0182008_10100705 | 3300014497 | Unclassified | 1428 |
| 187 | Ga0157377_10531994 | 3300014745 | Unclassified | 827 |
| 188 | Ga0157379_10568649 | 3300014968 | Bacteria | 1056 |
| 189 | Ga0157379_10818991 | 3300014968 | Unclassified | 879 |
| 190 | Ga0157379_12463761 | 3300014968 | Bacteria | 520 |
| 191 | Ga0157376_10008076 | 3300014969 | Bacteria | 7564 |
| 192 | Ga0182005_1061164 | 3300015265 | Unclassified | 1029 |
| 193 | Ga0163161_11862759 | 3300017792 | Bacteria | 535 |
| 194 | Ga0207697_10017184 | 3300025315 | Bacteria | 2973 |
| 195 | Ga0207697_10100134 | 3300025315 | Bacteria | 1234 |
| 196 | Ga0207656_10088612 | 3300025321 | Unclassified | 1401 |
| 197 | Ga0207680_10194434 | 3300025903 | Bacteria | 1379 |
| 198 | Ga0207680_10518686 | 3300025903 | Bacteria | 849 |
| 199 | Ga0207645_10082985 | 3300025907 | Bacteria | 2055 |
| 200 | Ga0207645_10207663 | 3300025907 | Bacteria | 1289 |
| 201 | Ga0207645_10236645 | 3300025907 | Bacteria | 1206 |
| 202 | Ga0207643_10300445 | 3300025908 | Bacteria | 999 |
| 203 | Ga0207684_10100401 | 3300025910 | Bacteria | 2473 |
| 204 | Ga0207654_10537232 | 3300025911 | Bacteria | 829 |
| 205 | Ga0207654_10620591 | 3300025911 | Unclassified | 773 |
| 206 | Ga0207707_10029311 | 3300025912 | Bacteria | 4811 |
| 207 | Ga0207707_10065192 | 3300025912 | Bacteria | 3172 |
| 208 | Ga0207695_10217317 | 3300025913 | Bacteria | 1820 |
| 209 | Ga0207695_10751222 | 3300025913 | Bacteria | 856 |
| 210 | Ga0207671_10298728 | 3300025914 | Bacteria | 1272 |
| 211 | Ga0207671_10955668 | 3300025914 | Unclassified | 676 |
| 212 | Ga0207693_10390433 | 3300025915 | Bacteria | 1088 |
| 213 | Ga0207663_10002602 | 3300025916 | Bacteria | 8685 |
| 214 | Ga0207660_10395859 | 3300025917 | Bacteria | 1112 |
| 215 | Ga0207657_10002282 | 3300025919 | Bacteria | 20782 |
| 216 | Ga0207657_10074555 | 3300025919 | Bacteria | 2865 |
| 217 | Ga0207649_10035015 | 3300025920 | Bacteria | 3014 |
| 218 | Ga0207649_10099228 | 3300025920 | Unclassified | 1923 |
| 219 | Ga0207649_10301923 | 3300025920 | Bacteria | 1171 |
| 220 | Ga0207681_10366843 | 3300025923 | Bacteria | 1156 |
| 221 | Ga0207694_10970552 | 3300025924 | Bacteria | 719 |
| 222 | Ga0207650_10390843 | 3300025925 | Bacteria | 1150 |
| 223 | Ga0207650_10689879 | 3300025925 | Bacteria | 862 |
| 224 | Ga0207659_10156098 | 3300025926 | Bacteria | 1787 |
| 225 | Ga0207659_10189245 | 3300025926 | Bacteria | 1637 |
| 226 | Ga0207659_10395393 | 3300025926 | Bacteria | 1155 |
| 227 | Ga0207687_10513883 | 3300025927 | Bacteria | 1001 |
| 228 | Ga0207687_10560570 | 3300025927 | Bacteria | 959 |
| 229 | Ga0207700_10427426 | 3300025928 | Unclassified | 1164 |
| 230 | Ga0207644_10028553 | 3300025931 | Bacteria | 3864 |
| 231 | Ga0207644_10113386 | 3300025931 | Unclassified | 2053 |
| 232 | Ga0207690_10131157 | 3300025932 | Unclassified | 1834 |
| 233 | Ga0207690_11225021 | 3300025932 | Unclassified | 627 |
| 234 | Ga0207706_10206853 | 3300025933 | Unclassified | 1721 |
| 235 | Ga0207706_10345363 | 3300025933 | Bacteria | 1294 |
| 236 | Ga0207706_10391146 | 3300025933 | Bacteria | 1206 |
| 237 | Ga0207686_10456035 | 3300025934 | Bacteria | 984 |
| 238 | Ga0207709_10909438 | 3300025935 | Bacteria | 716 |
| 239 | Ga0207670_10230806 | 3300025936 | Bacteria | 1421 |
| 240 | Ga0207669_10034556 | 3300025937 | Bacteria | 2866 |
| 241 | Ga0207669_10140133 | 3300025937 | Bacteria | 1677 |
| 242 | Ga0207669_11102561 | 3300025937 | Bacteria | 670 |
| 243 | Ga0207669_11374537 | 3300025937 | Bacteria | 601 |
| 244 | Ga0207665_10063096 | 3300025939 | Bacteria | 2516 |
| 245 | Ga0207665_10452434 | 3300025939 | Bacteria | 986 |
| 246 | Ga0207691_10084898 | 3300025940 | Bacteria | 2842 |
| 247 | Ga0207691_10392872 | 3300025940 | Bacteria | 1183 |
| 248 | Ga0207711_10160774 | 3300025941 | Bacteria | 2033 |
| 249 | Ga0207711_11237550 | 3300025941 | Bacteria | 688 |
| 250 | Ga0207711_11455883 | 3300025941 | Bacteria | 628 |
| 251 | Ga0207689_10085263 | 3300025942 | Bacteria | 2596 |
| 252 | Ga0207689_10865017 | 3300025942 | Bacteria | 763 |
| 253 | Ga0207689_11527182 | 3300025942 | Unclassified | 557 |
| 254 | Ga0207661_10096441 | 3300025944 | Bacteria | 2474 |
| 255 | Ga0207661_10247130 | 3300025944 | Unclassified | 1585 |
| 256 | Ga0207679_10008321 | 3300025945 | Bacteria | 6606 |
| 257 | Ga0207679_10361758 | 3300025945 | Unclassified | 1267 |
| 258 | Ga0207667_10396656 | 3300025949 | Bacteria | 1405 |
| 259 | Ga0207667_10412757 | 3300025949 | Unclassified | 1374 |
| 260 | Ga0207667_10430511 | 3300025949 | Bacteria | 1342 |
| 261 | Ga0207667_10590408 | 3300025949 | Bacteria | 1121 |
| 262 | Ga0207667_11971270 | 3300025949 | Bacteria | 545 |
| 263 | Ga0207651_11113121 | 3300025960 | Unclassified | 708 |
| 264 | Ga0207712_10482579 | 3300025961 | Bacteria | 1057 |
| 265 | Ga0207668_10431681 | 3300025972 | Bacteria | 1120 |
| 266 | Ga0207668_10792882 | 3300025972 | Bacteria | 838 |
| 267 | Ga0207640_10005463 | 3300025981 | Bacteria | 6930 |
| 268 | Ga0207658_10537794 | 3300025986 | Unclassified | 1044 |
| 269 | Ga0207677_10410056 | 3300026023 | Unclassified | 1151 |
| 270 | Ga0207703_10458005 | 3300026035 | Bacteria | 1192 |
| 271 | Ga0207703_10724794 | 3300026035 | Bacteria | 946 |
| 272 | Ga0207703_11659247 | 3300026035 | Unclassified | 615 |
| 273 | Ga0207639_10796923 | 3300026041 | Unclassified | 880 |
| 274 | Ga0207639_10817030 | 3300026041 | Unclassified | 869 |
| 275 | Ga0207678_10024455 | 3300026067 | Bacteria | 5275 |
| 276 | Ga0207678_11799232 | 3300026067 | Unclassified | 536 |
| 277 | Ga0207708_10153900 | 3300026075 | Bacteria | 1812 |
| 278 | Ga0207708_10669257 | 3300026075 | Bacteria | 885 |
| 279 | Ga0207702_10058993 | 3300026078 | Bacteria | 3267 |
| 280 | Ga0207702_10492016 | 3300026078 | Bacteria | 1195 |
| 281 | Ga0207648_10111478 | 3300026089 | Bacteria | 2402 |
| 282 | Ga0207676_10111492 | 3300026095 | Bacteria | 2290 |
| 283 | Ga0207676_10608027 | 3300026095 | Unclassified | 1051 |
| 284 | Ga0207674_10302378 | 3300026116 | Unclassified | 1549 |
| 285 | Ga0207675_100013818 | 3300026118 | Bacteria | 7529 |
| 286 | Ga0207675_100248308 | 3300026118 | Bacteria | 1721 |
| 287 | Ga0207675_100336659 | 3300026118 | Bacteria | 1476 |
| 288 | Ga0207675_100812268 | 3300026118 | Bacteria | 949 |
| 289 | Ga0207683_11266832 | 3300026121 | Bacteria | 683 |
| 290 | Ga0207683_11674315 | 3300026121 | Unclassified | 585 |
| 291 | Ga0207698_10169275 | 3300026142 | Bacteria | 1922 |
| 292 | Ga0207698_10582230 | 3300026142 | Unclassified | 1101 |
| 293 | Ga0207698_10885702 | 3300026142 | Bacteria | 899 |
| 294 | Ga0209813_10154904 | 3300027866 | Bacteria | 823 |
| 295 | Ga0207428_10459650 | 3300027907 | Bacteria | 927 |
| 296 | Ga0207428_10461082 | 3300027907 | Bacteria | 926 |
| 297 | Ga0268265_10579606 | 3300028380 | Bacteria | 1069 |
| 298 | Ga0268265_12055822 | 3300028380 | Bacteria | 578 |
| 299 | Ga0268264_10072498 | 3300028381 | Bacteria | 2921 |
| 300 | Ga0307413_10705180 | 3300031824 | Bacteria | 839 |
| 301 | Ga0307409_101348297 | 3300031995 | Bacteria | 739 |
| 302 | Ga0307415_101481983 | 3300032126 | Bacteria | 649 |
| 303 | Ga0373932_0026004 | 3300035112 | Bacteria | 1589 |
| 304 | Ga0373936_0551298 | 3300035113 | Bacteria | 539 |
| 305 | Ga0373953_0063309 | 3300035117 | Bacteria | 1516 |
| 306 | Ga0373957_0043454 | 3300035120 | Bacteria | 1698 |
| 307 | Ga0373955_0157385 | 3300035172 | Bacteria | 1339 |
| 308 | Ga0373924_0495739 | 3300035410 | Bacteria | 549 |
| 309 | Ga0373931_0412977 | 3300035691 | Bacteria | 857 |
| 310 | Ga0373933_0073841 | 3300035724 | Bacteria | 2079 |
| 311 | Ga0373937_0026096 | 3300036401 | Bacteria | 5279 |
| 312 | Ga0373937_0366784 | 3300036401 | Bacteria | 1365 |
| 313 | Ga0373937_1516626 | 3300036401 | Bacteria | 618 |
| 314 | Ga0373925_1233214 | 3300037068 | Unclassified | 614 |
| 315 | Ga0395900_1327775 | 3300037418 | Bacteria | 633 |
| 316 | Ga0395905_0705975 | 3300037471 | Bacteria | 911 |
| 317 | Ga0436363_0398386 | 3300039450 | Bacteria | 1194 |
| 318 | Ga0439453_0104101 | 3300041408 | Unclassified | 636 |
| 319 | Ga0451800_0893812 | 3300041459 | Bacteria | 616 |
| 320 | Ga0451802_1027204 | 3300041460 | Bacteria | 795 |
| 321 | Ga0451853_2836263 | 3300041512 | Bacteria | 1394 |
| 322 | Ga0439434_0050175 | 3300042435 | Bacteria | 1292 |
| 323 | Ga0450893_0133324 | 3300042532 | Bacteria | 526 |
| 324 | Ga0451577_1274925 | 3300042876 | Bacteria | 654 |
| 325 | Ga0453684_0512483 | 3300044712 | Bacteria | 1326 |
| 326 | Ga0495629_0080338 | 3300046459 | Bacteria | 2277 |
| 327 | Ga0495651_0130425 | 3300046462 | Bacteria | 1836 |
| 328 | Ga0495664_0605844 | 3300046477 | Bacteria | 651 |
| 329 | Ga0495618_0265159 | 3300046514 | Bacteria | 1075 |
| 330 | Ga0495628_0280992 | 3300046516 | Bacteria | 1236 |
| 331 | Ga0495630_1095631 | 3300046517 | Bacteria | 604 |
| 332 | Ga0495640_0586731 | 3300046533 | Bacteria | 674 |
| 333 | Ga0495586_0120075 | 3300046535 | Bacteria | 1468 |
| 334 | Ga0495586_0669812 | 3300046535 | Unclassified | 599 |
| 335 | Ga0495645_0053842 | 3300046543 | Bacteria | 2924 |
| 336 | Ga0495667_0032114 | 3300046559 | Bacteria | 3521 |
| 337 | Ga0495635_0938876 | 3300046663 | Unclassified | 553 |
| 338 | Ga0495658_0037488 | 3300046683 | Bacteria | 2680 |
| 339 | Ga0495613_0160607 | 3300046689 | Bacteria | 1599 |
| 340 | Ga0495613_0481250 | 3300046689 | Bacteria | 838 |
| 341 | Ga0495600_0140539 | 3300046809 | Bacteria | 1567 |
| 342 | Ga0495674_0181671 | 3300047319 | Bacteria | 1751 |
| 343 | Ga0495672_0298992 | 3300047320 | Bacteria | 763 |
| 344 | Ga0495680_0595479 | 3300047322 | Bacteria | 740 |
| 345 | Ga0496100_0082962 | 3300048903 | Unclassified | 2169 |
| 346 | Ga0496100_0260143 | 3300048903 | Bacteria | 1287 |
| 347 | Ga0496100_0992642 | 3300048903 | Bacteria | 661 |
| 348 | Ga0496101_0064836 | 3300048904 | Bacteria | 2662 |
| 349 | Ga0496102_0773994 | 3300048905 | Bacteria | 882 |
| 350 | Ga0496103_0050145 | 3300048906 | Bacteria | 2582 |
| 351 | Ga0496104_0004383 | 3300048907 | Bacteria | 12294 |
| 352 | Ga0496104_0358068 | 3300048907 | Bacteria | 1372 |
| 353 | Ga0496105_0050509 | 3300048908 | Unclassified | 3435 |
| 354 | Ga0496105_0317336 | 3300048908 | Bacteria | 1250 |
| 355 | Ga0496106_0085056 | 3300048909 | Unclassified | 2435 |
| 356 | Ga0496106_0138830 | 3300048909 | Bacteria | 1911 |
| 357 | Ga0496107_0060392 | 3300048910 | Unclassified | 2744 |
| 358 | Ga0496107_0089418 | 3300048910 | Bacteria | 2249 |
| 359 | Ga0496108_0001111 | 3300048911 | Bacteria | 21045 |
| 360 | Ga0496108_1260529 | 3300048911 | Unclassified | 623 |
| 361 | Ga0496109_0003746 | 3300048912 | Bacteria | 12705 |
| 362 | Ga0496109_0125334 | 3300048912 | Bacteria | 2395 |
| 363 | Ga0496110_0020710 | 3300048913 | Bacteria | 5554 |
| 364 | Ga0496110_0570957 | 3300048913 | Bacteria | 1027 |
| 365 | Ga0496110_1005038 | 3300048913 | Bacteria | 741 |
| 366 | Ga0496110_1257869 | 3300048913 | Bacteria | 649 |
| 367 | Ga0496111_0045504 | 3300048914 | Bacteria | 3158 |
| 368 | Ga0496111_0084990 | 3300048914 | Bacteria | 2313 |
| 369 | Ga0496112_0129377 | 3300048915 | Unclassified | 2496 |
| 370 | Ga0496112_0222010 | 3300048915 | Bacteria | 1845 |
| 371 | Ga0496112_0456994 | 3300048915 | Bacteria | 1214 |
| 372 | Ga0496112_0674393 | 3300048915 | Unclassified | 962 |
| 373 | Ga0496113_0050162 | 3300048916 | Unclassified | 3110 |
| 374 | Ga0496113_0512572 | 3300048916 | Unclassified | 963 |
| 375 | Ga0496114_0049807 | 3300048917 | Bacteria | 3486 |
| 376 | Ga0496114_0068280 | 3300048917 | Bacteria | 2984 |
| 377 | Ga0496114_1162705 | 3300048917 | Bacteria | 657 |
| 378 | Ga0496114_1314263 | 3300048917 | Bacteria | 610 |
| 379 | Ga0501034_0076317 | 3300049571 | Bacteria | 3358 |
| 380 | Ga0501072_0151678 | 3300049588 | Bacteria | 1848 |
| 381 | Ga0501076_0791655 | 3300049592 | Bacteria | 782 |
| 382 | Ga0501080_0157335 | 3300049742 | Bacteria | 2099 |
| 383 | Ga0501080_0517145 | 3300049742 | Bacteria | 1065 |
| 384 | Ga0501081_0790700 | 3300049743 | Bacteria | 714 |
| 385 | nmdc:mga03683_546698_c1 | 3300050489 | Bacteria | 564 |
| 386 | nmdc:mga00v17_306408_c1 | 3300050491 | Bacteria | 1032 |
| 387 | nmdc:mga06z11_106497_c1 | 3300050494 | Bacteria | 1546 |
| 388 | nmdc:mga06z11_136587_c1 | 3300050494 | Bacteria | 1382 |
| 389 | nmdc:mga06z11_843886_c1 | 3300050494 | Bacteria | 558 |
| 390 | nmdc:mga04h51_134074_c1 | 3300050495 | Bacteria | 934 |
| 391 | nmdc:mga05p37_520756_c1 | 3300050507 | Bacteria | 1360 |
| 392 | nmdc:mga05p37_600029_c1 | 3300050507 | Bacteria | 1243 |
| 393 | nmdc:mga09592_702230_c1 | 3300050508 | Bacteria | 861 |
| 394 | nmdc:mga06r32_1394885_c1 | 3300050510 | Bacteria | 642 |
| 395 | nmdc:mga08y16_1028742_c1 | 3300050511 | Bacteria | 802 |
| 396 | nmdc:mga08y16_117986_c1 | 3300050511 | Bacteria | 2762 |
| 397 | nmdc:mga08y16_626592_c1 | 3300050511 | Bacteria | 1082 |
| 398 | nmdc:mga0n895_1356834_c1 | 3300050512 | Bacteria | 680 |
| 399 | nmdc:mga0n895_290935_c1 | 3300050512 | Bacteria | 1656 |
| 400 | nmdc:mga0n895_48166_c1 | 3300050512 | Bacteria | 4170 |
| 401 | nmdc:mga0rr50_44676_c1 | 3300050513 | Bacteria | 3251 |
| 402 | nmdc:mga08x19_4181_c1 | 3300050514 | Bacteria | 8555 |
| 403 | nmdc:mga08x19_517550_c1 | 3300050514 | Bacteria | 843 |
| 404 | nmdc:mga08x19_540571_c1 | 3300050514 | Bacteria | 824 |
| 405 | nmdc:mga0a205_483010_c1 | 3300050515 | Bacteria | 1097 |
| 406 | Ga0495612_0345224 | 3300053078 | Bacteria | 672 |
| 407 | Ga0495619_0156911 | 3300053085 | Bacteria | 1571 |
| 408 | Ga0495619_0213520 | 3300053085 | Bacteria | 1336 |
| 409 | Ga0500556_0194646 | 3300053104 | Bacteria | 801 |
| 410 | Ga0500568_0009853 | 3300053139 | Bacteria | 4514 |
| 411 | Ga0500611_128714 | 3300053727 | Bacteria | 681 |
| 412 | Ga0501084_1161509 | 3300054114 | Bacteria | 648 |
| 413 | Ga0501082_0530973 | 3300060353 | Bacteria | 1029 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005331 | Ga0070670_101028744 | Ga0070670_1010287442 | 102 |
| 2 | 3300005335 | Ga0070666_11153556 | Ga0070666_111535561 | 102 |
| 3 | 3300005339 | Ga0070660_100804230 | Ga0070660_1008042302 | 102 |
| 4 | 3300005347 | Ga0070668_100803579 | Ga0070668_1008035791 | 102 |
| 5 | 3300005354 | Ga0070675_101281535 | Ga0070675_1012815351 | 102 |
| 6 | 3300005459 | Ga0068867_100027034 | Ga0068867_1000270345 | 102 |
| 7 | 3300005718 | Ga0068866_10702782 | Ga0068866_107027822 | 102 |
| 8 | 3300006042 | Ga0075368_10050115 | Ga0075368_100501152 | 102 |
| 9 | 3300006177 | Ga0075362_10044295 | Ga0075362_100442952 | 102 |
| 10 | 3300006178 | Ga0075367_10035832 | Ga0075367_100358324 | 102 |
| 11 | 3300006195 | Ga0075366_10027064 | Ga0075366_100270642 | 102 |
| 12 | 3300006237 | Ga0097621_100140986 | Ga0097621_1001409862 | 102 |
| 13 | 3300006358 | Ga0068871_100002048 | Ga0068871_1000020488 | 102 |
| 14 | 3300006358 | Ga0068871_100868137 | Ga0068871_1008681371 | 102 |
| 15 | 3300006881 | Ga0068865_100052056 | Ga0068865_1000520562 | 102 |
| 16 | 3300009093 | Ga0105240_12361233 | Ga0105240_123612331 | 102 |
| 17 | 3300009176 | Ga0105242_10000922 | Ga0105242_1000092219 | 102 |
| 18 | 3300014326 | Ga0157380_10560613 | Ga0157380_105606132 | 102 |
| 19 | 3300014969 | Ga0157376_10008076 | Ga0157376_100080762 | 102 |
| 20 | 3300025903 | Ga0207680_10518686 | Ga0207680_105186862 | 102 |
| 21 | 3300025925 | Ga0207650_10390843 | Ga0207650_103908432 | 102 |
| 22 | 3300025927 | Ga0207687_10560570 | Ga0207687_105605702 | 102 |
| 23 | 3300025937 | Ga0207669_11102561 | Ga0207669_111025611 | 102 |
| 24 | 3300025941 | Ga0207711_11237550 | Ga0207711_112375502 | 102 |
| 25 | 3300025949 | Ga0207667_10430511 | Ga0207667_104305111 | 102 |
| 26 | 3300025972 | Ga0207668_10792882 | Ga0207668_107928822 | 102 |
| 27 | 3300026089 | Ga0207648_10111478 | Ga0207648_101114781 | 102 |
| 28 | 3300026121 | Ga0207683_11266832 | Ga0207683_112668322 | 102 |
| 29 | 3300026142 | Ga0207698_10885702 | Ga0207698_108857022 | 102 |
| 30 | 3300027866 | Ga0209813_10154904 | Ga0209813_101549042 | 102 |
| 31 | 3300031824 | Ga0307413_10705180 | Ga0307413_107051801 | 102 |
| 32 | 3300031995 | Ga0307409_101348297 | Ga0307409_1013482971 | 102 |
| 33 | 3300032126 | Ga0307415_101481983 | Ga0307415_1014819832 | 102 |
| 34 | 3300035113 | Ga0373936_0551298 | Ga0373936_0551298_153_461 | 102 |
| 35 | 3300035120 | Ga0373957_0043454 | Ga0373957_0043454_94_402 | 102 |
| 36 | 3300035172 | Ga0373955_0157385 | Ga0373955_0157385_321_629 | 102 |
| 37 | 3300035410 | Ga0373924_0495739 | Ga0373924_0495739_20_328 | 102 |
| 38 | 3300035724 | Ga0373933_0073841 | Ga0373933_0073841_1118_1426 | 102 |
| 39 | 3300036401 | Ga0373937_0026096 | Ga0373937_0026096_3203_3511 | 102 |
| 40 | 3300041408 | Ga0439453_0104101 | Ga0439453_0104101_246_554 | 102 |
| 41 | 3300041460 | Ga0451802_1027204 | Ga0451802_1027204_328_642 | 102 |
| 42 | 3300046459 | Ga0495629_0080338 | Ga0495629_0080338_123_431 | 102 |
| 43 | 3300046462 | Ga0495651_0130425 | Ga0495651_0130425_768_1076 | 102 |
| 44 | 3300046477 | Ga0495664_0605844 | Ga0495664_0605844_35_343 | 102 |
| 45 | 3300046514 | Ga0495618_0265159 | Ga0495618_0265159_355_663 | 102 |
| 46 | 3300046517 | Ga0495630_1095631 | Ga0495630_1095631_21_329 | 102 |
| 47 | 3300046533 | Ga0495640_0586731 | Ga0495640_0586731_268_576 | 102 |
| 48 | 3300046535 | Ga0495586_0120075 | Ga0495586_0120075_650_958 | 102 |
| 49 | 3300046535 | Ga0495586_0669812 | Ga0495586_0669812_232_540 | 102 |
| 50 | 3300046543 | Ga0495645_0053842 | Ga0495645_0053842_1647_1955 | 102 |
| 51 | 3300046559 | Ga0495667_0032114 | Ga0495667_0032114_2128_2436 | 102 |
| 52 | 3300046663 | Ga0495635_0938876 | Ga0495635_0938876_171_479 | 102 |
| 53 | 3300046683 | Ga0495658_0037488 | Ga0495658_0037488_1564_1872 | 102 |
| 54 | 3300046689 | Ga0495613_0160607 | Ga0495613_0160607_989_1297 | 102 |
| 55 | 3300046809 | Ga0495600_0140539 | Ga0495600_0140539_1054_1362 | 102 |
| 56 | 3300047319 | Ga0495674_0181671 | Ga0495674_0181671_473_781 | 102 |
| 57 | 3300047322 | Ga0495680_0595479 | Ga0495680_0595479_256_564 | 102 |
| 58 | 3300048907 | Ga0496104_0358068 | Ga0496104_0358068_77_385 | 102 |
| 59 | 3300048908 | Ga0496105_0317336 | Ga0496105_0317336_197_505 | 102 |
| 60 | 3300048917 | Ga0496114_0068280 | Ga0496114_0068280_434_742 | 102 |
| 61 | 3300048917 | Ga0496114_1314263 | Ga0496114_1314263_94_402 | 102 |
| 62 | 3300049571 | Ga0501034_0076317 | Ga0501034_0076317_216_524 | 102 |
| 63 | 3300049588 | Ga0501072_0151678 | Ga0501072_0151678_926_1234 | 102 |
| 64 | 3300049742 | Ga0501080_0157335 | Ga0501080_0157335_1269_1577 | 102 |
| 65 | 3300050489 | nmdc:mga03683_546698_c1 | nmdc:mga03683_546698_c1_190_519 | 102 |
| 66 | 3300050494 | nmdc:mga06z11_136587_c1 | nmdc:mga06z11_136587_c1_430_759 | 102 |
| 67 | 3300050495 | nmdc:mga04h51_134074_c1 | nmdc:mga04h51_134074_c1_162_491 | 102 |
| 68 | 3300053078 | Ga0495612_0345224 | Ga0495612_0345224_301_609 | 102 |
| 69 | 3300053085 | Ga0495619_0156911 | Ga0495619_0156911_46_354 | 102 |
| 70 | 3300053085 | Ga0495619_0213520 | Ga0495619_0213520_426_734 | 102 |
| 71 | 3300005290 | Ga0065712_10002945 | Ga0065712_100029453 | 103 |
| 72 | 3300005290 | Ga0065712_10339967 | Ga0065712_103399672 | 103 |
| 73 | 3300005293 | Ga0065715_10177905 | Ga0065715_101779052 | 103 |
| 74 | 3300005293 | Ga0065715_10237691 | Ga0065715_102376912 | 103 |
| 75 | 3300005295 | Ga0065707_10046912 | Ga0065707_100469122 | 103 |
| 76 | 3300005295 | Ga0065707_10093761 | Ga0065707_100937612 | 103 |
| 77 | 3300005295 | Ga0065707_10472881 | Ga0065707_104728812 | 103 |
| 78 | 3300005328 | Ga0070676_10282006 | Ga0070676_102820062 | 103 |
| 79 | 3300005329 | Ga0070683_100002324 | Ga0070683_1000023243 | 103 |
| 80 | 3300005329 | Ga0070683_101413338 | Ga0070683_1014133382 | 103 |
| 81 | 3300005330 | Ga0070690_100059469 | Ga0070690_1000594692 | 103 |
| 82 | 3300005331 | Ga0070670_100351010 | Ga0070670_1003510102 | 103 |
| 83 | 3300005331 | Ga0070670_102194847 | Ga0070670_1021948471 | 103 |
| 84 | 3300005333 | Ga0070677_10699264 | Ga0070677_106992641 | 103 |
| 85 | 3300005334 | Ga0068869_100669468 | Ga0068869_1006694682 | 103 |
| 86 | 3300005334 | Ga0068869_100931333 | Ga0068869_1009313332 | 103 |
| 87 | 3300005335 | Ga0070666_10112861 | Ga0070666_101128613 | 103 |
| 88 | 3300005336 | Ga0070680_100391513 | Ga0070680_1003915132 | 103 |
| 89 | 3300005339 | Ga0070660_100056571 | Ga0070660_1000565712 | 103 |
| 90 | 3300005339 | Ga0070660_100403082 | Ga0070660_1004030822 | 103 |
| 91 | 3300005340 | Ga0070689_100162338 | Ga0070689_1001623382 | 103 |
| 92 | 3300005344 | Ga0070661_100004126 | Ga0070661_1000041266 | 103 |
| 93 | 3300005344 | Ga0070661_100053519 | Ga0070661_1000535194 | 103 |
| 94 | 3300005344 | Ga0070661_100275856 | Ga0070661_1002758562 | 103 |
| 95 | 3300005344 | Ga0070661_100382936 | Ga0070661_1003829361 | 103 |
| 96 | 3300005345 | Ga0070692_10245010 | Ga0070692_102450102 | 103 |
| 97 | 3300005347 | Ga0070668_100073985 | Ga0070668_1000739851 | 103 |
| 98 | 3300005353 | Ga0070669_100549740 | Ga0070669_1005497402 | 103 |
| 99 | 3300005354 | Ga0070675_100169106 | Ga0070675_1001691062 | 103 |
| 100 | 3300005355 | Ga0070671_100188256 | Ga0070671_1001882562 | 103 |
| 101 | 3300005356 | Ga0070674_100160995 | Ga0070674_1001609952 | 103 |
| 102 | 3300005356 | Ga0070674_100554486 | Ga0070674_1005544862 | 103 |
| 103 | 3300005364 | Ga0070673_100579945 | Ga0070673_1005799451 | 103 |
| 104 | 3300005365 | Ga0070688_100010104 | Ga0070688_1000101044 | 103 |
| 105 | 3300005366 | Ga0070659_101301579 | Ga0070659_1013015791 | 103 |
| 106 | 3300005366 | Ga0070659_101571617 | Ga0070659_1015716171 | 103 |
| 107 | 3300005367 | Ga0070667_100216038 | Ga0070667_1002160382 | 103 |
| 108 | 3300005367 | Ga0070667_100680024 | Ga0070667_1006800242 | 103 |
| 109 | 3300005406 | Ga0070703_10032877 | Ga0070703_100328772 | 103 |
| 110 | 3300005434 | Ga0070709_10119012 | Ga0070709_101190122 | 103 |
| 111 | 3300005435 | Ga0070714_100079912 | Ga0070714_1000799125 | 103 |
| 112 | 3300005436 | Ga0070713_100347729 | Ga0070713_1003477293 | 103 |
| 113 | 3300005436 | Ga0070713_100506371 | Ga0070713_1005063712 | 103 |
| 114 | 3300005438 | Ga0070701_11115863 | Ga0070701_111158631 | 103 |
| 115 | 3300005439 | Ga0070711_100037865 | Ga0070711_1000378652 | 103 |
| 116 | 3300005441 | Ga0070700_100789521 | Ga0070700_1007895211 | 103 |
| 117 | 3300005444 | Ga0070694_100021125 | Ga0070694_1000211252 | 103 |
| 118 | 3300005444 | Ga0070694_100038581 | Ga0070694_1000385813 | 103 |
| 119 | 3300005445 | Ga0070708_100842161 | Ga0070708_1008421611 | 103 |
| 120 | 3300005455 | Ga0070663_100270581 | Ga0070663_1002705812 | 103 |
| 121 | 3300005456 | Ga0070678_100127864 | Ga0070678_1001278643 | 103 |
| 122 | 3300005456 | Ga0070678_100839959 | Ga0070678_1008399592 | 103 |
| 123 | 3300005456 | Ga0070678_100978185 | Ga0070678_1009781851 | 103 |
| 124 | 3300005457 | Ga0070662_100571807 | Ga0070662_1005718072 | 103 |
| 125 | 3300005457 | Ga0070662_100881158 | Ga0070662_1008811582 | 103 |
| 126 | 3300005457 | Ga0070662_101215548 | Ga0070662_1012155482 | 103 |
| 127 | 3300005458 | Ga0070681_10569440 | Ga0070681_105694402 | 103 |
| 128 | 3300005471 | Ga0070698_100036368 | Ga0070698_1000363682 | 103 |
| 129 | 3300005471 | Ga0070698_100162397 | Ga0070698_1001623973 | 103 |
| 130 | 3300005471 | Ga0070698_101547256 | Ga0070698_1015472561 | 103 |
| 131 | 3300005518 | Ga0070699_100953683 | Ga0070699_1009536831 | 103 |
| 132 | 3300005530 | Ga0070679_100087753 | Ga0070679_1000877532 | 103 |
| 133 | 3300005530 | Ga0070679_100100591 | Ga0070679_1001005912 | 103 |
| 134 | 3300005535 | Ga0070684_100047572 | Ga0070684_1000475723 | 103 |
| 135 | 3300005535 | Ga0070684_100100644 | Ga0070684_1001006442 | 103 |
| 136 | 3300005535 | Ga0070684_100995306 | Ga0070684_1009953062 | 103 |
| 137 | 3300005536 | Ga0070697_101961491 | Ga0070697_1019614911 | 103 |
| 138 | 3300005539 | Ga0068853_100443103 | Ga0068853_1004431032 | 103 |
| 139 | 3300005539 | Ga0068853_100620154 | Ga0068853_1006201542 | 103 |
| 140 | 3300005543 | Ga0070672_100014651 | Ga0070672_1000146512 | 103 |
| 141 | 3300005544 | Ga0070686_100001728 | Ga0070686_1000017287 | 103 |
| 142 | 3300005545 | Ga0070695_100005860 | Ga0070695_1000058608 | 103 |
| 143 | 3300005545 | Ga0070695_101479791 | Ga0070695_1014797911 | 103 |
| 144 | 3300005546 | Ga0070696_100811575 | Ga0070696_1008115752 | 103 |
| 145 | 3300005547 | Ga0070693_100023522 | Ga0070693_1000235223 | 103 |
| 146 | 3300005547 | Ga0070693_100381721 | Ga0070693_1003817211 | 103 |
| 147 | 3300005549 | Ga0070704_100005836 | Ga0070704_1000058365 | 103 |
| 148 | 3300005549 | Ga0070704_100670962 | Ga0070704_1006709622 | 103 |
| 149 | 3300005563 | Ga0068855_100228612 | Ga0068855_1002286122 | 103 |
| 150 | 3300005563 | Ga0068855_100250136 | Ga0068855_1002501362 | 103 |
| 151 | 3300005563 | Ga0068855_101260292 | Ga0068855_1012602922 | 103 |
| 152 | 3300005564 | Ga0070664_100002207 | Ga0070664_10000220712 | 103 |
| 153 | 3300005564 | Ga0070664_100038845 | Ga0070664_1000388454 | 103 |
| 154 | 3300005564 | Ga0070664_101179585 | Ga0070664_1011795851 | 103 |
| 155 | 3300005577 | Ga0068857_100077800 | Ga0068857_1000778002 | 103 |
| 156 | 3300005578 | Ga0068854_100035591 | Ga0068854_1000355912 | 103 |
| 157 | 3300005614 | Ga0068856_100025435 | Ga0068856_1000254354 | 103 |
| 158 | 3300005615 | Ga0070702_100692356 | Ga0070702_1006923562 | 103 |
| 159 | 3300005616 | Ga0068852_100214451 | Ga0068852_1002144511 | 103 |
| 160 | 3300005617 | Ga0068859_100002238 | Ga0068859_10000223820 | 103 |
| 161 | 3300005617 | Ga0068859_100427543 | Ga0068859_1004275433 | 103 |
| 162 | 3300005618 | Ga0068864_100065786 | Ga0068864_1000657863 | 103 |
| 163 | 3300005719 | Ga0068861_100219467 | Ga0068861_1002194672 | 103 |
| 164 | 3300005719 | Ga0068861_100817705 | Ga0068861_1008177051 | 103 |
| 165 | 3300005719 | Ga0068861_102193526 | Ga0068861_1021935261 | 103 |
| 166 | 3300005834 | Ga0068851_10018040 | Ga0068851_100180402 | 103 |
| 167 | 3300005841 | Ga0068863_100106497 | Ga0068863_1001064973 | 103 |
| 168 | 3300005842 | Ga0068858_100229468 | Ga0068858_1002294682 | 103 |
| 169 | 3300005842 | Ga0068858_100231465 | Ga0068858_1002314652 | 103 |
| 170 | 3300005844 | Ga0068862_100289954 | Ga0068862_1002899543 | 103 |
| 171 | 3300005983 | Ga0081540_1100875 | Ga0081540_11008752 | 103 |
| 172 | 3300006051 | Ga0075364_10357671 | Ga0075364_103576712 | 103 |
| 173 | 3300006058 | Ga0075432_10370028 | Ga0075432_103700281 | 103 |
| 174 | 3300006173 | Ga0070716_100047147 | Ga0070716_1000471473 | 103 |
| 175 | 3300006173 | Ga0070716_100777467 | Ga0070716_1007774672 | 103 |
| 176 | 3300006175 | Ga0070712_100001771 | Ga0070712_10000177113 | 103 |
| 177 | 3300006178 | Ga0075367_10062809 | Ga0075367_100628093 | 103 |
| 178 | 3300006237 | Ga0097621_100447689 | Ga0097621_1004476892 | 103 |
| 179 | 3300006844 | Ga0075428_100546919 | Ga0075428_1005469192 | 103 |
| 180 | 3300006852 | Ga0075433_10593438 | Ga0075433_105934382 | 103 |
| 181 | 3300006871 | Ga0075434_101077777 | Ga0075434_1010777772 | 103 |
| 182 | 3300006880 | Ga0075429_100613026 | Ga0075429_1006130262 | 103 |
| 183 | 3300006914 | Ga0075436_100064493 | Ga0075436_1000644934 | 103 |
| 184 | 3300006914 | Ga0075436_101128635 | Ga0075436_1011286351 | 103 |
| 185 | 3300006931 | Ga0097620_100002238 | Ga0097620_1000022384 | 103 |
| 186 | 3300006931 | Ga0097620_100427547 | Ga0097620_1004275473 | 103 |
| 187 | 3300007076 | Ga0075435_100062058 | Ga0075435_1000620582 | 103 |
| 188 | 3300009093 | Ga0105240_10075729 | Ga0105240_100757292 | 103 |
| 189 | 3300009093 | Ga0105240_10185270 | Ga0105240_101852702 | 103 |
| 190 | 3300009094 | Ga0111539_10255374 | Ga0111539_102553741 | 103 |
| 191 | 3300009098 | Ga0105245_10776824 | Ga0105245_107768242 | 103 |
| 192 | 3300009098 | Ga0105245_11250590 | Ga0105245_112505902 | 103 |
| 193 | 3300009147 | Ga0114129_10952855 | Ga0114129_109528552 | 103 |
| 194 | 3300009147 | Ga0114129_11672355 | Ga0114129_116723552 | 103 |
| 195 | 3300009148 | Ga0105243_10004718 | Ga0105243_1000471810 | 103 |
| 196 | 3300009148 | Ga0105243_10964680 | Ga0105243_109646801 | 103 |
| 197 | 3300009148 | Ga0105243_11963988 | Ga0105243_119639881 | 103 |
| 198 | 3300009174 | Ga0105241_10028556 | Ga0105241_100285565 | 103 |
| 199 | 3300009174 | Ga0105241_10072756 | Ga0105241_100727563 | 103 |
| 200 | 3300009174 | Ga0105241_11100498 | Ga0105241_111004981 | 103 |
| 201 | 3300009176 | Ga0105242_10761851 | Ga0105242_107618512 | 103 |
| 202 | 3300009176 | Ga0105242_10991111 | Ga0105242_109911112 | 103 |
| 203 | 3300009177 | Ga0105248_10011078 | Ga0105248_1001107810 | 103 |
| 204 | 3300009177 | Ga0105248_10234767 | Ga0105248_102347673 | 103 |
| 205 | 3300009177 | Ga0105248_10272964 | Ga0105248_102729642 | 103 |
| 206 | 3300009177 | Ga0105248_10408034 | Ga0105248_104080342 | 103 |
| 207 | 3300009177 | Ga0105248_12101790 | Ga0105248_121017901 | 103 |
| 208 | 3300009177 | Ga0105248_12179701 | Ga0105248_121797011 | 103 |
| 209 | 3300009545 | Ga0105237_10121976 | Ga0105237_101219763 | 103 |
| 210 | 3300009545 | Ga0105237_11536671 | Ga0105237_115366712 | 103 |
| 211 | 3300009551 | Ga0105238_10026889 | Ga0105238_100268895 | 103 |
| 212 | 3300009553 | Ga0105249_10120916 | Ga0105249_101209163 | 103 |
| 213 | 3300009553 | Ga0105249_10637369 | Ga0105249_106373692 | 103 |
| 214 | 3300009553 | Ga0105249_10724247 | Ga0105249_107242472 | 103 |
| 215 | 3300009553 | Ga0105249_11716779 | Ga0105249_117167791 | 103 |
| 216 | 3300011119 | Ga0105246_10947349 | Ga0105246_109473491 | 103 |
| 217 | 3300013100 | Ga0157373_10054006 | Ga0157373_100540062 | 103 |
| 218 | 3300013104 | Ga0157370_11054125 | Ga0157370_110541251 | 103 |
| 219 | 3300013105 | Ga0157369_10043001 | Ga0157369_100430015 | 103 |
| 220 | 3300013105 | Ga0157369_10181588 | Ga0157369_101815882 | 103 |
| 221 | 3300013296 | Ga0157374_10085501 | Ga0157374_100855012 | 103 |
| 222 | 3300013296 | Ga0157374_10089014 | Ga0157374_100890143 | 103 |
| 223 | 3300013297 | Ga0157378_10550250 | Ga0157378_105502501 | 103 |
| 224 | 3300013297 | Ga0157378_10674023 | Ga0157378_106740232 | 103 |
| 225 | 3300013297 | Ga0157378_13110010 | Ga0157378_131100101 | 103 |
| 226 | 3300013306 | Ga0163162_10515114 | Ga0163162_105151142 | 103 |
| 227 | 3300013307 | Ga0157372_10047050 | Ga0157372_100470505 | 103 |
| 228 | 3300013307 | Ga0157372_10318996 | Ga0157372_103189962 | 103 |
| 229 | 3300013308 | Ga0157375_10908468 | Ga0157375_109084682 | 103 |
| 230 | 3300013308 | Ga0157375_12496864 | Ga0157375_124968642 | 103 |
| 231 | 3300013308 | Ga0157375_12739304 | Ga0157375_127393041 | 103 |
| 232 | 3300014325 | Ga0163163_10003462 | Ga0163163_100034629 | 103 |
| 233 | 3300014325 | Ga0163163_10100882 | Ga0163163_101008824 | 103 |
| 234 | 3300014326 | Ga0157380_10192712 | Ga0157380_101927123 | 103 |
| 235 | 3300014326 | Ga0157380_10465209 | Ga0157380_104652092 | 103 |
| 236 | 3300014326 | Ga0157380_10628697 | Ga0157380_106286972 | 103 |
| 237 | 3300014326 | Ga0157380_10895215 | Ga0157380_108952152 | 103 |
| 238 | 3300014497 | Ga0182008_10100705 | Ga0182008_101007051 | 103 |
| 239 | 3300014745 | Ga0157377_10531994 | Ga0157377_105319941 | 103 |
| 240 | 3300014968 | Ga0157379_10568649 | Ga0157379_105686492 | 103 |
| 241 | 3300014968 | Ga0157379_10818991 | Ga0157379_108189912 | 103 |
| 242 | 3300014968 | Ga0157379_12463761 | Ga0157379_124637612 | 103 |
| 243 | 3300015265 | Ga0182005_1061164 | Ga0182005_10611642 | 103 |
| 244 | 3300017792 | Ga0163161_11862759 | Ga0163161_118627591 | 103 |
| 245 | 3300025315 | Ga0207697_10017184 | Ga0207697_100171842 | 103 |
| 246 | 3300025315 | Ga0207697_10100134 | Ga0207697_101001342 | 103 |
| 247 | 3300025321 | Ga0207656_10088612 | Ga0207656_100886122 | 103 |
| 248 | 3300025903 | Ga0207680_10194434 | Ga0207680_101944341 | 103 |
| 249 | 3300025907 | Ga0207645_10082985 | Ga0207645_100829852 | 103 |
| 250 | 3300025907 | Ga0207645_10207663 | Ga0207645_102076632 | 103 |
| 251 | 3300025907 | Ga0207645_10236645 | Ga0207645_102366452 | 103 |
| 252 | 3300025908 | Ga0207643_10300445 | Ga0207643_103004452 | 103 |
| 253 | 3300025910 | Ga0207684_10100401 | Ga0207684_101004013 | 103 |
| 254 | 3300025911 | Ga0207654_10537232 | Ga0207654_105372321 | 103 |
| 255 | 3300025911 | Ga0207654_10620591 | Ga0207654_106205911 | 103 |
| 256 | 3300025912 | Ga0207707_10029311 | Ga0207707_100293113 | 103 |
| 257 | 3300025912 | Ga0207707_10065192 | Ga0207707_100651923 | 103 |
| 258 | 3300025913 | Ga0207695_10217317 | Ga0207695_102173172 | 103 |
| 259 | 3300025913 | Ga0207695_10751222 | Ga0207695_107512222 | 103 |
| 260 | 3300025914 | Ga0207671_10298728 | Ga0207671_102987282 | 103 |
| 261 | 3300025914 | Ga0207671_10955668 | Ga0207671_109556681 | 103 |
| 262 | 3300025915 | Ga0207693_10390433 | Ga0207693_103904331 | 103 |
| 263 | 3300025916 | Ga0207663_10002602 | Ga0207663_100026028 | 103 |
| 264 | 3300025917 | Ga0207660_10395859 | Ga0207660_103958591 | 103 |
| 265 | 3300025919 | Ga0207657_10002282 | Ga0207657_100022822 | 103 |
| 266 | 3300025919 | Ga0207657_10074555 | Ga0207657_100745553 | 103 |
| 267 | 3300025920 | Ga0207649_10035015 | Ga0207649_100350153 | 103 |
| 268 | 3300025920 | Ga0207649_10099228 | Ga0207649_100992283 | 103 |
| 269 | 3300025920 | Ga0207649_10301923 | Ga0207649_103019232 | 103 |
| 270 | 3300025923 | Ga0207681_10366843 | Ga0207681_103668432 | 103 |
| 271 | 3300025924 | Ga0207694_10970552 | Ga0207694_109705522 | 103 |
| 272 | 3300025925 | Ga0207650_10689879 | Ga0207650_106898792 | 103 |
| 273 | 3300025926 | Ga0207659_10156098 | Ga0207659_101560982 | 103 |
| 274 | 3300025926 | Ga0207659_10189245 | Ga0207659_101892452 | 103 |
| 275 | 3300025926 | Ga0207659_10395393 | Ga0207659_103953932 | 103 |
| 276 | 3300025927 | Ga0207687_10513883 | Ga0207687_105138831 | 103 |
| 277 | 3300025928 | Ga0207700_10427426 | Ga0207700_104274262 | 103 |
| 278 | 3300025931 | Ga0207644_10028553 | Ga0207644_100285532 | 103 |
| 279 | 3300025931 | Ga0207644_10113386 | Ga0207644_101133863 | 103 |
| 280 | 3300025932 | Ga0207690_10131157 | Ga0207690_101311572 | 103 |
| 281 | 3300025932 | Ga0207690_11225021 | Ga0207690_112250211 | 103 |
| 282 | 3300025933 | Ga0207706_10206853 | Ga0207706_102068531 | 103 |
| 283 | 3300025933 | Ga0207706_10345363 | Ga0207706_103453632 | 103 |
| 284 | 3300025933 | Ga0207706_10391146 | Ga0207706_103911462 | 103 |
| 285 | 3300025934 | Ga0207686_10456035 | Ga0207686_104560352 | 103 |
| 286 | 3300025935 | Ga0207709_10909438 | Ga0207709_109094382 | 103 |
| 287 | 3300025936 | Ga0207670_10230806 | Ga0207670_102308062 | 103 |
| 288 | 3300025937 | Ga0207669_10034556 | Ga0207669_100345562 | 103 |
| 289 | 3300025937 | Ga0207669_10140133 | Ga0207669_101401332 | 103 |
| 290 | 3300025937 | Ga0207669_11374537 | Ga0207669_113745372 | 103 |
| 291 | 3300025939 | Ga0207665_10063096 | Ga0207665_100630963 | 103 |
| 292 | 3300025939 | Ga0207665_10452434 | Ga0207665_104524342 | 103 |
| 293 | 3300025940 | Ga0207691_10084898 | Ga0207691_100848983 | 103 |
| 294 | 3300025940 | Ga0207691_10392872 | Ga0207691_103928721 | 103 |
| 295 | 3300025941 | Ga0207711_10160774 | Ga0207711_101607742 | 103 |
| 296 | 3300025941 | Ga0207711_11455883 | Ga0207711_114558831 | 103 |
| 297 | 3300025942 | Ga0207689_10085263 | Ga0207689_100852633 | 103 |
| 298 | 3300025942 | Ga0207689_10865017 | Ga0207689_108650172 | 103 |
| 299 | 3300025942 | Ga0207689_11527182 | Ga0207689_115271821 | 103 |
| 300 | 3300025944 | Ga0207661_10096441 | Ga0207661_100964411 | 103 |
| 301 | 3300025944 | Ga0207661_10247130 | Ga0207661_102471302 | 103 |
| 302 | 3300025945 | Ga0207679_10008321 | Ga0207679_100083213 | 103 |
| 303 | 3300025945 | Ga0207679_10361758 | Ga0207679_103617582 | 103 |
| 304 | 3300025949 | Ga0207667_10396656 | Ga0207667_103966562 | 103 |
| 305 | 3300025949 | Ga0207667_10412757 | Ga0207667_104127572 | 103 |
| 306 | 3300025949 | Ga0207667_10590408 | Ga0207667_105904082 | 103 |
| 307 | 3300025949 | Ga0207667_11971270 | Ga0207667_119712702 | 103 |
| 308 | 3300025960 | Ga0207651_11113121 | Ga0207651_111131212 | 103 |
| 309 | 3300025961 | Ga0207712_10482579 | Ga0207712_104825791 | 103 |
| 310 | 3300025972 | Ga0207668_10431681 | Ga0207668_104316812 | 103 |
| 311 | 3300025981 | Ga0207640_10005463 | Ga0207640_100054633 | 103 |
| 312 | 3300025986 | Ga0207658_10537794 | Ga0207658_105377942 | 103 |
| 313 | 3300026023 | Ga0207677_10410056 | Ga0207677_104100561 | 103 |
| 314 | 3300026035 | Ga0207703_10458005 | Ga0207703_104580052 | 103 |
| 315 | 3300026035 | Ga0207703_10724794 | Ga0207703_107247941 | 103 |
| 316 | 3300026035 | Ga0207703_11659247 | Ga0207703_116592471 | 103 |
| 317 | 3300026041 | Ga0207639_10796923 | Ga0207639_107969232 | 103 |
| 318 | 3300026041 | Ga0207639_10817030 | Ga0207639_108170302 | 103 |
| 319 | 3300026067 | Ga0207678_10024455 | Ga0207678_100244552 | 103 |
| 320 | 3300026067 | Ga0207678_11799232 | Ga0207678_117992322 | 103 |
| 321 | 3300026075 | Ga0207708_10153900 | Ga0207708_101539002 | 103 |
| 322 | 3300026075 | Ga0207708_10669257 | Ga0207708_106692571 | 103 |
| 323 | 3300026078 | Ga0207702_10058993 | Ga0207702_100589932 | 103 |
| 324 | 3300026078 | Ga0207702_10492016 | Ga0207702_104920162 | 103 |
| 325 | 3300026095 | Ga0207676_10111492 | Ga0207676_101114923 | 103 |
| 326 | 3300026095 | Ga0207676_10608027 | Ga0207676_106080271 | 103 |
| 327 | 3300026116 | Ga0207674_10302378 | Ga0207674_103023782 | 103 |
| 328 | 3300026118 | Ga0207675_100013818 | Ga0207675_1000138189 | 103 |
| 329 | 3300026118 | Ga0207675_100248308 | Ga0207675_1002483082 | 103 |
| 330 | 3300026118 | Ga0207675_100336659 | Ga0207675_1003366592 | 103 |
| 331 | 3300026118 | Ga0207675_100812268 | Ga0207675_1008122682 | 103 |
| 332 | 3300026121 | Ga0207683_11674315 | Ga0207683_116743151 | 103 |
| 333 | 3300026142 | Ga0207698_10169275 | Ga0207698_101692752 | 103 |
| 334 | 3300026142 | Ga0207698_10582230 | Ga0207698_105822302 | 103 |
| 335 | 3300027907 | Ga0207428_10459650 | Ga0207428_104596502 | 103 |
| 336 | 3300027907 | Ga0207428_10461082 | Ga0207428_104610822 | 103 |
| 337 | 3300028380 | Ga0268265_10579606 | Ga0268265_105796062 | 103 |
| 338 | 3300028380 | Ga0268265_12055822 | Ga0268265_120558222 | 103 |
| 339 | 3300028381 | Ga0268264_10072498 | Ga0268264_100724981 | 103 |
| 340 | 3300035112 | Ga0373932_0026004 | Ga0373932_0026004_987_1298 | 103 |
| 341 | 3300035117 | Ga0373953_0063309 | Ga0373953_0063309_416_757 | 103 |
| 342 | 3300035691 | Ga0373931_0412977 | Ga0373931_0412977_505_825 | 103 |
| 343 | 3300036401 | Ga0373937_0366784 | Ga0373937_0366784_942_1253 | 103 |
| 344 | 3300036401 | Ga0373937_1516626 | Ga0373937_1516626_135_461 | 103 |
| 345 | 3300037068 | Ga0373925_1233214 | Ga0373925_1233214_111_422 | 103 |
| 346 | 3300037418 | Ga0395900_1327775 | Ga0395900_1327775_231_542 | 103 |
| 347 | 3300037471 | Ga0395905_0705975 | Ga0395905_0705975_191_502 | 103 |
| 348 | 3300039450 | Ga0436363_0398386 | Ga0436363_0398386_438_782 | 103 |
| 349 | 3300041459 | Ga0451800_0893812 | Ga0451800_0893812_239_565 | 103 |
| 350 | 3300041512 | Ga0451853_2836263 | Ga0451853_2836263_935_1252 | 103 |
| 351 | 3300042435 | Ga0439434_0050175 | Ga0439434_0050175_472_813 | 103 |
| 352 | 3300042532 | Ga0450893_0133324 | Ga0450893_0133324_187_501 | 103 |
| 353 | 3300042876 | Ga0451577_1274925 | Ga0451577_1274925_120_434 | 103 |
| 354 | 3300044712 | Ga0453684_0512483 | Ga0453684_0512483_38_355 | 103 |
| 355 | 3300046516 | Ga0495628_0280992 | Ga0495628_0280992_821_1159 | 103 |
| 356 | 3300046689 | Ga0495613_0481250 | Ga0495613_0481250_440_751 | 103 |
| 357 | 3300047320 | Ga0495672_0298992 | Ga0495672_0298992_44_388 | 103 |
| 358 | 3300048903 | Ga0496100_0082962 | Ga0496100_0082962_1364_1717 | 103 |
| 359 | 3300048903 | Ga0496100_0260143 | Ga0496100_0260143_852_1163 | 103 |
| 360 | 3300048903 | Ga0496100_0992642 | Ga0496100_0992642_135_446 | 103 |
| 361 | 3300048904 | Ga0496101_0064836 | Ga0496101_0064836_1938_2291 | 103 |
| 362 | 3300048905 | Ga0496102_0773994 | Ga0496102_0773994_501_812 | 103 |
| 363 | 3300048906 | Ga0496103_0050145 | Ga0496103_0050145_1256_1609 | 103 |
| 364 | 3300048907 | Ga0496104_0004383 | Ga0496104_0004383_6975_7286 | 103 |
| 365 | 3300048908 | Ga0496105_0050509 | Ga0496105_0050509_2827_3180 | 103 |
| 366 | 3300048909 | Ga0496106_0085056 | Ga0496106_0085056_1078_1431 | 103 |
| 367 | 3300048909 | Ga0496106_0138830 | Ga0496106_0138830_1305_1646 | 103 |
| 368 | 3300048910 | Ga0496107_0060392 | Ga0496107_0060392_600_953 | 103 |
| 369 | 3300048910 | Ga0496107_0089418 | Ga0496107_0089418_1673_1984 | 103 |
| 370 | 3300048911 | Ga0496108_0001111 | Ga0496108_0001111_10493_10804 | 103 |
| 371 | 3300048911 | Ga0496108_1260529 | Ga0496108_1260529_49_402 | 103 |
| 372 | 3300048912 | Ga0496109_0003746 | Ga0496109_0003746_3471_3782 | 103 |
| 373 | 3300048912 | Ga0496109_0125334 | Ga0496109_0125334_258_575 | 103 |
| 374 | 3300048913 | Ga0496110_0020710 | Ga0496110_0020710_801_1154 | 103 |
| 375 | 3300048913 | Ga0496110_0570957 | Ga0496110_0570957_416_733 | 103 |
| 376 | 3300048913 | Ga0496110_1005038 | Ga0496110_1005038_201_512 | 103 |
| 377 | 3300048913 | Ga0496110_1257869 | Ga0496110_1257869_125_442 | 103 |
| 378 | 3300048914 | Ga0496111_0045504 | Ga0496111_0045504_2424_2777 | 103 |
| 379 | 3300048914 | Ga0496111_0084990 | Ga0496111_0084990_1345_1656 | 103 |
| 380 | 3300048915 | Ga0496112_0129377 | Ga0496112_0129377_1996_2310 | 103 |
| 381 | 3300048915 | Ga0496112_0222010 | Ga0496112_0222010_1153_1464 | 103 |
| 382 | 3300048915 | Ga0496112_0456994 | Ga0496112_0456994_673_1026 | 103 |
| 383 | 3300048915 | Ga0496112_0674393 | Ga0496112_0674393_197_550 | 103 |
| 384 | 3300048916 | Ga0496113_0050162 | Ga0496113_0050162_1743_2096 | 103 |
| 385 | 3300048916 | Ga0496113_0512572 | Ga0496113_0512572_439_753 | 103 |
| 386 | 3300048917 | Ga0496114_0049807 | Ga0496114_0049807_1279_1614 | 103 |
| 387 | 3300048917 | Ga0496114_1162705 | Ga0496114_1162705_193_510 | 103 |
| 388 | 3300049592 | Ga0501076_0791655 | Ga0501076_0791655_423_755 | 103 |
| 389 | 3300049742 | Ga0501080_0517145 | Ga0501080_0517145_701_1033 | 103 |
| 390 | 3300049743 | Ga0501081_0790700 | Ga0501081_0790700_209_523 | 103 |
| 391 | 3300050491 | nmdc:mga00v17_306408_c1 | nmdc:mga00v17_306408_c1_221_562 | 103 |
| 392 | 3300050494 | nmdc:mga06z11_106497_c1 | nmdc:mga06z11_106497_c1_486_827 | 103 |
| 393 | 3300050494 | nmdc:mga06z11_843886_c1 | nmdc:mga06z11_843886_c1_30_347 | 103 |
| 394 | 3300050507 | nmdc:mga05p37_520756_c1 | nmdc:mga05p37_520756_c1_552_863 | 103 |
| 395 | 3300050507 | nmdc:mga05p37_600029_c1 | nmdc:mga05p37_600029_c1_766_1134 | 103 |
| 396 | 3300050508 | nmdc:mga09592_702230_c1 | nmdc:mga09592_702230_c1_516_827 | 103 |
| 397 | 3300050510 | nmdc:mga06r32_1394885_c1 | nmdc:mga06r32_1394885_c1_274_588 | 103 |
| 398 | 3300050511 | nmdc:mga08y16_1028742_c1 | nmdc:mga08y16_1028742_c1_88_402 | 103 |
| 399 | 3300050511 | nmdc:mga08y16_117986_c1 | nmdc:mga08y16_117986_c1_329_640 | 103 |
| 400 | 3300050511 | nmdc:mga08y16_626592_c1 | nmdc:mga08y16_626592_c1_136_462 | 103 |
| 401 | 3300050512 | nmdc:mga0n895_1356834_c1 | nmdc:mga0n895_1356834_c1_226_540 | 103 |
| 402 | 3300050512 | nmdc:mga0n895_290935_c1 | nmdc:mga0n895_290935_c1_1097_1408 | 103 |
| 403 | 3300050512 | nmdc:mga0n895_48166_c1 | nmdc:mga0n895_48166_c1_522_857 | 103 |
| 404 | 3300050513 | nmdc:mga0rr50_44676_c1 | nmdc:mga0rr50_44676_c1_648_983 | 103 |
| 405 | 3300050514 | nmdc:mga08x19_4181_c1 | nmdc:mga08x19_4181_c1_3133_3456 | 103 |
| 406 | 3300050514 | nmdc:mga08x19_517550_c1 | nmdc:mga08x19_517550_c1_14_325 | 103 |
| 407 | 3300050514 | nmdc:mga08x19_540571_c1 | nmdc:mga08x19_540571_c1_320_655 | 103 |
| 408 | 3300050515 | nmdc:mga0a205_483010_c1 | nmdc:mga0a205_483010_c1_138_449 | 103 |
| 409 | 3300053104 | Ga0500556_0194646 | Ga0500556_0194646_52_384 | 103 |
| 410 | 3300053139 | Ga0500568_0009853 | Ga0500568_0009853_1400_1744 | 103 |
| 411 | 3300053727 | Ga0500611_128714 | Ga0500611_128714_125_469 | 103 |
| 412 | 3300054114 | Ga0501084_1161509 | Ga0501084_1161509_137_469 | 103 |
| 413 | 3300060353 | Ga0501082_0530973 | Ga0501082_0530973_285_602 | 103 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7bgm-assembly1.cif.gz_A | crystal structure of mthisn2, a bifunctional enzyme from the histidine biosynthetic pathway | 0.9671 | 5 | 102 |
| 1zps-assembly1.cif.gz_A | crystal structure of methanobacterium thermoautotrophicum phosphoribosyl-amp cyclohydrolase hisi | 0.9644 | 9 | 103 |
| 7bgm-assembly1.cif.gz_B | crystal structure of mthisn2, a bifunctional enzyme from the histidine biosynthetic pathway | 0.9633 | 5 | 97 |
| 7bgn-assembly1.cif.gz_B | crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway | 0.9631 | 5 | 102 |
| 7bgn-assembly1.cif.gz_A | crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway | 0.9626 | 5 | 102 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FUU3_250_343_3.10.20.810 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase | 0.9715 | 1 | 85 | 3.10.20.810 |
| af_C6TGF5_46_140_3.10.20.810 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase | 0.9681 | 5 | 90 | 3.10.20.810 |
| 1zpsA01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase | 0.9675 | 9 | 90 | 3.10.20.810 |
| af_P9WMM7_1_97_3.10.20.810 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase | 0.9511 | 5 | 90 | 3.10.20.810 |
| af_A0A1D8PKY7_169_272_3.10.20.810 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase | 0.921 | 5 | 90 | 3.10.20.810 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A382RME8-F1-model_v4 | Histidine biosynthesis bifunctional protein HisIE (EC 3.5.4.19) | 1 | 1 | 103 |
GO:0000105
GO:0004635 GO:0005737 |
| AF-A0A1Q7JJR9-F1-model_v4 | phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) | 0.9991 | 1 | 102 |
GO:0000105
GO:0004635 |
| AF-A0A6A7L9V1-F1-model_v4 | phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) | 0.998 | 1 | 103 |
GO:0000105
GO:0004635 |
| AF-A0A2V8E5X9-F1-model_v4 | phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) | 0.9978 | 10 | 103 |
GO:0000105
GO:0004635 |
| AF-A0A6B1DL20-F1-model_v4 | phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) | 0.9971 | 1 | 102 |
GO:0000105
GO:0004635 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar