F437991

General Info

Members Datasets Scaffolds Average Seq Length
413 217 826 243

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100186978|Ga0070659_1001869782
Length 283
Sequence MGLAALAFAPGLAFGSFLNVVAARVPLKRSLVSPASACMACGHEIAWYDNVPLVSYAALRGRCRACGVHIPIRYPAVELVAGLLFAACFWKFGLSGSALVGAFFCLTLVTVSATDLEHRIIPNRIVVPAGLIVLLANTALHPSPRYAIAAVGASGFLLAAALAYPSGMGMGDVKLAFLMGAALATSVTVALFVGMIAALVPSVVLIARHGKAARKMGIPFGPFLALGSVVALFAGPWLLHAYMSLSGSWPPGSRDSCRPRTGAPEWSRSLRSRQPHADTSFEG

Samples

Sample ID Description Type Environment
1 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
103 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
104 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
105 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
108 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
109 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
110 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
111 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
112 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
113 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
114 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
115 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
116 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
117 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
118 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
119 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
120 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
132 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
141 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
142 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
143 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
144 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
145 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
146 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
147 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
148 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
151 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
152 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
153 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
154 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
155 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
156 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
157 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
161 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
162 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
163 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
164 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
165 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
166 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
169 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
170 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
171 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
172 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
196 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
197 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
198 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
199 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
200 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
201 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
202 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
215 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
217 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.03
Metatranscriptomes 0.97
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.48
Nodule 0
Rhizoplane 7.51
Rhizosphere 91.77
Stem 0
Stem Tuber 0
Unclassified 7.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070659_100186978 3300005366 Bacteria 1702
2 Ga0070658_10012968 3300005327 Bacteria 6689
3 Ga0070658_10021751 3300005327 Bacteria 5141
4 Ga0070658_10054881 3300005327 Bacteria 3236
5 Ga0070658_10287309 3300005327 Unclassified 1401
6 Ga0070683_100010753 3300005329 Bacteria 7873
7 Ga0070683_100020179 3300005329 Bacteria 5928
8 Ga0070683_100025700 3300005329 Bacteria 5293
9 Ga0070683_100103470 3300005329 Bacteria 2683
10 Ga0070683_100383671 3300005329 Bacteria 1339
11 Ga0070680_100022523 3300005336 Bacteria 5019
12 Ga0070680_100108722 3300005336 Unclassified 2307
13 Ga0070682_100018951 3300005337 Bacteria 4031
14 Ga0070660_100002450 3300005339 Bacteria 12727
15 Ga0070660_100019024 3300005339 Bacteria 5028
16 Ga0070691_10080196 3300005341 Unclassified 1597
17 Ga0070661_100074208 3300005344 Bacteria 2504
18 Ga0070661_100114026 3300005344 Bacteria 2020
19 Ga0070668_100051781 3300005347 Bacteria 3164
20 Ga0070671_100232324 3300005355 Bacteria 1565
21 Ga0070674_100095857 3300005356 Bacteria 2151
22 Ga0070659_100016925 3300005366 Bacteria 5480
23 Ga0070659_100201150 3300005366 Bacteria 1640
24 Ga0070714_100010906 3300005435 Bacteria 7195
25 Ga0070714_100115479 3300005435 Bacteria 2382
26 Ga0070711_100038906 3300005439 Bacteria 3201
27 Ga0070711_100182198 3300005439 Bacteria 1608
28 Ga0070705_100297141 3300005440 Unclassified 1155
29 Ga0070708_100481402 3300005445 Unclassified 1171
30 Ga0070708_100619372 3300005445 Bacteria 1020
31 Ga0070662_100034908 3300005457 Bacteria 3548
32 Ga0070681_10061679 3300005458 Bacteria 3723
33 Ga0070681_10083776 3300005458 Bacteria 3141
34 Ga0070681_10098461 3300005458 Unclassified 2870
35 Ga0070706_100016783 3300005467 Bacteria 6763
36 Ga0070707_100002410 3300005468 Bacteria 17835
37 Ga0070698_100054179 3300005471 Bacteria 4074
38 Ga0070698_100089018 3300005471 Bacteria 3071
39 Ga0070679_100038779 3300005530 Bacteria 4736
40 Ga0070679_100054273 3300005530 Bacteria 3989
41 Ga0070679_100174546 3300005530 Unclassified 2122
42 Ga0070679_100278403 3300005530 Bacteria 1626
43 Ga0070679_100424660 3300005530 Bacteria 1274
44 Ga0070684_100005906 3300005535 Bacteria 9427
45 Ga0070684_100019102 3300005535 Bacteria 5665
46 Ga0070684_100040785 3300005535 Bacteria 3999
47 Ga0070684_100048640 3300005535 Unclassified 3678
48 Ga0070684_100087095 3300005535 Bacteria 2773
49 Ga0070684_100568618 3300005535 Unclassified 1053
50 Ga0070697_100126802 3300005536 Unclassified 2138
51 Ga0068853_100047457 3300005539 Bacteria 3685
52 Ga0070686_100054646 3300005544 Bacteria 2555
53 Ga0070686_100383516 3300005544 Bacteria 1064
54 Ga0070696_100007461 3300005546 Bacteria 7316
55 Ga0070696_100102746 3300005546 Bacteria 2050
56 Ga0070696_100289549 3300005546 Bacteria 1251
57 Ga0070696_100500855 3300005546 Bacteria 966
58 Ga0070704_100300324 3300005549 Bacteria 1337
59 Ga0068855_100045888 3300005563 Bacteria 5166
60 Ga0068855_100065474 3300005563 Bacteria 4237
61 Ga0068855_100099076 3300005563 Bacteria 3357
62 Ga0068855_100302836 3300005563 Bacteria 1770
63 Ga0070664_100050633 3300005564 Bacteria 3516
64 Ga0070664_100071464 3300005564 Bacteria 2974
65 Ga0068857_100005362 3300005577 Bacteria 10933
66 Ga0068854_100024058 3300005578 Bacteria 4166
67 Ga0068852_100081832 3300005616 Bacteria 2867
68 Ga0068861_100041582 3300005719 Bacteria 3443
69 Ga0068860_100059937 3300005843 Bacteria 3617
70 Ga0068862_100078144 3300005844 Bacteria 2867
71 Ga0075365_10064101 3300006038 Bacteria 2461
72 Ga0070716_100303568 3300006173 Bacteria 1111
73 Ga0070712_100015703 3300006175 Bacteria 4881
74 Ga0070712_100171713 3300006175 Bacteria 1683
75 Ga0075428_100012921 3300006844 Bacteria 9288
76 Ga0075431_100032936 3300006847 Bacteria 5341
77 Ga0075431_100178389 3300006847 Bacteria 2180
78 Ga0075433_10010262 3300006852 Bacteria 7512
79 Ga0075433_10433775 3300006852 Bacteria 1158
80 Ga0075434_100152010 3300006871 Bacteria 2335
81 Ga0068865_100071230 3300006881 Bacteria 2465
82 Ga0075436_100003793 3300006914 Bacteria 10366
83 Ga0075436_100379157 3300006914 Bacteria 1022
84 Ga0075435_100407762 3300007076 Bacteria 1169
85 Ga0105240_10163303 3300009093 Bacteria 2643
86 Ga0111539_10009791 3300009094 Bacteria 12099
87 Ga0111539_10205697 3300009094 Bacteria 2294
88 Ga0105245_10082589 3300009098 Bacteria 2939
89 Ga0105245_10677265 3300009098 Bacteria 1063
90 Ga0114129_10009631 3300009147 Bacteria 13785
91 Ga0114129_10149038 3300009147 Bacteria 3202
92 Ga0114129_10205416 3300009147 Bacteria 2666
93 Ga0105242_10061909 3300009176 Bacteria 3078
94 Ga0105248_10037582 3300009177 Bacteria 5417
95 Ga0105248_10089846 3300009177 Bacteria 3458
96 Ga0105237_10097822 3300009545 Bacteria 2925
97 Ga0105237_10178555 3300009545 Bacteria 2123
98 Ga0105249_10315755 3300009553 Bacteria 1572
99 Ga0105249_10398968 3300009553 Bacteria 1405
100 Ga0105239_10486687 3300010375 Bacteria 1402
101 Ga0105239_10570805 3300010375 Bacteria 1289
102 Ga0157373_10115483 3300013100 Bacteria 1887
103 Ga0157370_10037383 3300013104 Bacteria 4706
104 Ga0157370_10158995 3300013104 Unclassified 2103
105 Ga0157369_10027565 3300013105 Bacteria 6295
106 Ga0157369_10132964 3300013105 Unclassified 2635
107 Ga0157369_10323595 3300013105 Bacteria 1603
108 Ga0157374_10118860 3300013296 Bacteria 2549
109 Ga0157378_10045814 3300013297 Bacteria 3887
110 Ga0163162_10414087 3300013306 Bacteria 1480
111 Ga0157372_10047040 3300013307 Bacteria 4792
112 Ga0157372_10114016 3300013307 Bacteria 3098
113 Ga0157372_10486060 3300013307 Bacteria 1439
114 Ga0157372_11343335 3300013307 Bacteria 824
115 Ga0157375_10009947 3300013308 Bacteria 8364
116 Ga0157375_10058740 3300013308 Bacteria 3807
117 Ga0157375_10349402 3300013308 Bacteria 1645
118 Ga0157380_10056962 3300014326 Bacteria 3110
119 Ga0182008_10146125 3300014497 Bacteria 1185
120 Ga0182008_10160918 3300014497 Bacteria 1130
121 Ga0157376_10336667 3300014969 Bacteria 1440
122 Ga0206356_10714221 3300020070 Bacteria 1034
123 Ga0206353_10283341 3300020082 Unclassified 1566
124 Ga0206353_11003882 3300020082 Bacteria 2935
125 Ga0206353_11274668 3300020082 Bacteria 1676
126 Ga0207653_10013742 3300025885 Bacteria 2537
127 Ga0207653_10018618 3300025885 Bacteria 2186
128 Ga0207642_10013238 3300025899 Bacteria 3005
129 Ga0207688_10050626 3300025901 Bacteria 2326
130 Ga0207699_10044780 3300025906 Bacteria 2578
131 Ga0207705_10093970 3300025909 Bacteria 2199
132 Ga0207705_10095009 3300025909 Bacteria 2187
133 Ga0207705_10364068 3300025909 Bacteria 1115
134 Ga0207707_10004123 3300025912 Bacteria 12876
135 Ga0207707_10022075 3300025912 Bacteria 5563
136 Ga0207707_10080768 3300025912 Bacteria 2839
137 Ga0207707_10409918 3300025912 Bacteria 1163
138 Ga0207671_10068997 3300025914 Unclassified 2635
139 Ga0207693_10021875 3300025915 Bacteria 5086
140 Ga0207693_10026235 3300025915 Bacteria 4612
141 Ga0207693_10124678 3300025915 Bacteria 2024
142 Ga0207663_10141486 3300025916 Bacteria 1677
143 Ga0207663_10246144 3300025916 Bacteria 1314
144 Ga0207660_10006660 3300025917 Bacteria 7492
145 Ga0207660_10365725 3300025917 Bacteria 1158
146 Ga0207657_10004699 3300025919 Bacteria 14417
147 Ga0207657_10009238 3300025919 Bacteria 9937
148 Ga0207657_10034927 3300025919 Bacteria 4513
149 Ga0207657_10094551 3300025919 Bacteria 2488
150 Ga0207649_10095320 3300025920 Bacteria 1958
151 Ga0207649_10289485 3300025920 Archaea 1194
152 Ga0207652_10006504 3300025921 Bacteria 9417
153 Ga0207652_10076741 3300025921 Unclassified 2914
154 Ga0207652_10180726 3300025921 Bacteria 1896
155 Ga0207652_10284199 3300025921 Bacteria 1493
156 Ga0207652_10545534 3300025921 Bacteria 1042
157 Ga0207646_10004016 3300025922 Bacteria 16282
158 Ga0207687_10323941 3300025927 Bacteria 1248
159 Ga0207664_10065542 3300025929 Bacteria 2908
160 Ga0207690_10003169 3300025932 Bacteria 9885
161 Ga0207690_10082453 3300025932 Bacteria 2249
162 Ga0207690_10267309 3300025932 Bacteria 1327
163 Ga0207690_10324955 3300025932 Unclassified 1210
164 Ga0207706_10022746 3300025933 Bacteria 5627
165 Ga0207706_10081152 3300025933 Bacteria 2850
166 Ga0207665_10030111 3300025939 Bacteria 3587
167 Ga0207691_10649687 3300025940 Bacteria 891
168 Ga0207711_10193962 3300025941 Bacteria 1852
169 Ga0207661_10005618 3300025944 Bacteria 8841
170 Ga0207661_10059216 3300025944 Unclassified 3085
171 Ga0207661_10497670 3300025944 Bacteria 1113
172 Ga0207667_10107102 3300025949 Bacteria 2883
173 Ga0207667_10234306 3300025949 Bacteria 1879
174 Ga0207667_10321932 3300025949 Bacteria 1579
175 Ga0207712_10670753 3300025961 Unclassified 903
176 Ga0207640_10039503 3300025981 Bacteria 2987
177 Ga0207640_10244743 3300025981 Bacteria 1388
178 Ga0207639_10055926 3300026041 Bacteria 3022
179 Ga0207639_10182035 3300026041 Bacteria 1788
180 Ga0207639_10212596 3300026041 Unclassified 1666
181 Ga0207678_10129756 3300026067 Bacteria 2150
182 Ga0207708_10022261 3300026075 Bacteria 4785
183 Ga0207648_10020083 3300026089 Bacteria 6025
184 Ga0207648_10735224 3300026089 Bacteria 916
185 Ga0207674_10003025 3300026116 Bacteria 20840
186 Ga0207675_100039920 3300026118 Bacteria 4380
187 Ga0207698_10032352 3300026142 Bacteria 3788
188 Ga0207698_10195026 3300026142 Bacteria 1808
189 Ga0207428_10002701 3300027907 Bacteria 17685
190 Ga0207428_10048730 3300027907 Bacteria 3397
191 Ga0207428_10148442 3300027907 Bacteria 1786
192 Ga0268265_10063377 3300028380 Bacteria 2844
193 Ga0265319_1004518 3300028563 Bacteria 6869
194 Ga0265334_10008825 3300028573 Bacteria 4280
195 Ga0265318_10001542 3300028577 Bacteria 13409
196 Ga0265318_10056714 3300028577 Bacteria 1464
197 Ga0265336_10032212 3300028666 Bacteria 1627
198 Ga0265338_10014073 3300028800 Bacteria 8956
199 Ga0265338_10020451 3300028800 Bacteria 6960
200 Ga0265330_10005926 3300031235 Bacteria 6052
201 Ga0265332_10002445 3300031238 Bacteria 9469
202 Ga0265332_10057126 3300031238 Bacteria 1672
203 Ga0265328_10000741 3300031239 Bacteria 15146
204 Ga0265320_10002918 3300031240 Bacteria 11712
205 Ga0265325_10009239 3300031241 Bacteria 5763
206 Ga0265329_10001841 3300031242 Bacteria 10046
207 Ga0265340_10002131 3300031247 Bacteria 11346
208 Ga0265339_10003067 3300031249 Bacteria 11757
209 Ga0265339_10003685 3300031249 Bacteria 10688
210 Ga0265331_10002149 3300031250 Bacteria 13550
211 Ga0265327_10005281 3300031251 Bacteria 10865
212 Ga0265327_10035474 3300031251 Bacteria 2756
213 Ga0265327_10084864 3300031251 Bacteria 1556
214 Ga0265316_10002974 3300031344 Bacteria 17326
215 Ga0265316_10032996 3300031344 Bacteria 4220
216 Ga0265316_10240261 3300031344 Bacteria 1332
217 Ga0265313_10002612 3300031595 Bacteria 15342
218 Ga0265313_10025040 3300031595 Bacteria 3173
219 Ga0265313_10077886 3300031595 Bacteria 1512
220 Ga0265314_10006684 3300031711 Bacteria 10133
221 Ga0265314_10012907 3300031711 Bacteria 6785
222 Ga0265342_10004404 3300031712 Bacteria 11112
223 Ga0265342_10033366 3300031712 Bacteria 3166
224 Ga0307413_10008061 3300031824 Bacteria 4944
225 Ga0307413_10227354 3300031824 Bacteria 1367
226 Ga0307410_10023547 3300031852 Bacteria 3831
227 Ga0307410_10034405 3300031852 Bacteria 3281
228 Ga0307406_10072800 3300031901 Bacteria 2257
229 Ga0307406_10225957 3300031901 Bacteria 1394
230 Ga0307407_10123317 3300031903 Bacteria 1646
231 Ga0307412_10030849 3300031911 Bacteria 3380
232 Ga0307412_10123816 3300031911 Bacteria 1866
233 Ga0307409_100026387 3300031995 Bacteria 4095
234 Ga0307416_100006707 3300032002 Bacteria 7231
235 Ga0307416_100042444 3300032002 Bacteria 3551
236 Ga0307416_100356067 3300032002 Bacteria 1483
237 Ga0307414_10034616 3300032004 Bacteria 3352
238 Ga0307411_10334427 3300032005 Bacteria 1228
239 Ga0307415_100024746 3300032126 Bacteria 3755
240 Ga0307415_100224150 3300032126 Bacteria 1509
241 Ga0307415_100341701 3300032126 Bacteria 1256
242 Ga0373933_0265140 3300035724 Bacteria 1108
243 Ga0373947_0003243 3300035725 Bacteria 9654
244 Ga0373937_0051802 3300036401 Bacteria 3762
245 Ga0373925_0050568 3300037068 Bacteria 3100
246 Ga0395899_0007958 3300037312 Bacteria 8164
247 Ga0395899_0010422 3300037312 Bacteria 7122
248 Ga0395900_0004262 3300037418 Bacteria 15178
249 Ga0395900_0008213 3300037418 Bacteria 10746
250 Ga0395900_0028116 3300037418 Bacteria 5757
251 Ga0395900_0043367 3300037418 Bacteria 4637
252 Ga0395900_0060593 3300037418 Bacteria 3894
253 Ga0395900_0064504 3300037418 Bacteria 3764
254 Ga0395900_0302257 3300037418 Unclassified 1586
255 Ga0395900_0844940 3300037418 Bacteria 841
256 Ga0395900_0867201 3300037418 Bacteria 828
257 Ga0395898_0000836 3300037466 Bacteria 50987
258 Ga0395898_0010958 3300037466 Bacteria 9454
259 Ga0395898_0047879 3300037466 Bacteria 4193
260 Ga0395898_0057997 3300037466 Bacteria 3770
261 Ga0395898_0063089 3300037466 Bacteria 3596
262 Ga0395898_0100699 3300037466 Bacteria 2775
263 Ga0395898_0218177 3300037466 Unclassified 1819
264 Ga0395898_0430994 3300037466 Bacteria 1256
265 Ga0395905_0015297 3300037471 Bacteria 7295
266 Ga0395905_0020406 3300037471 Bacteria 6278
267 Ga0395905_0061922 3300037471 Bacteria 3500
268 Ga0395905_0067511 3300037471 Bacteria 3350
269 Ga0395901_0001336 3300038443 Bacteria 25883
270 Ga0395901_0003948 3300038443 Bacteria 14921
271 Ga0395901_0008719 3300038443 Bacteria 10249
272 Ga0395901_0014925 3300038443 Bacteria 7894
273 Ga0395901_0020047 3300038443 Bacteria 6842
274 Ga0395901_0026545 3300038443 Bacteria 5948
275 Ga0395901_0097111 3300038443 Bacteria 3088
276 Ga0395901_0103168 3300038443 Bacteria 2992
277 Ga0395901_0126872 3300038443 Bacteria 2681
278 Ga0395901_0166762 3300038443 Bacteria 2312
279 Ga0395901_0350939 3300038443 Bacteria 1522
280 Ga0395901_0365455 3300038443 Unclassified 1487
281 Ga0395901_0416109 3300038443 Bacteria 1379
282 Ga0451839_0296119 3300041496 Bacteria 971
283 Ga0439451_005567 3300042009 Bacteria 2572
284 Ga0450910_020861 3300042147 Bacteria 990
285 Ga0466963_0018680 3300044694 Bacteria 4339
286 Ga0466963_0174156 3300044694 Bacteria 1501
287 Ga0466964_0034583 3300044706 Bacteria 2017
288 Ga0466964_0046288 3300044706 Bacteria 1773
289 Ga0466968_0010377 3300044735 Bacteria 3609
290 Ga0466957_0031830 3300044842 Bacteria 3155
291 Ga0466960_0038849 3300044901 Bacteria 2241
292 Ga0466960_0262847 3300044901 Bacteria 962
293 Ga0466958_0122750 3300045836 Bacteria 1627
294 Ga0466958_0203808 3300045836 Bacteria 1259
295 Ga0466967_0013620 3300045976 Bacteria 6293
296 Ga0466967_0072114 3300045976 Bacteria 3094
297 Ga0466967_0123754 3300045976 Bacteria 2393
298 Ga0466967_0137469 3300045976 Bacteria 2273
299 Ga0495603_0010348 3300046455 Bacteria 5647
300 Ga0495629_0017577 3300046459 Bacteria 5126
301 Ga0495641_0023604 3300046461 Bacteria 3051
302 Ga0495653_0263681 3300046463 Unclassified 1138
303 Ga0495653_0310434 3300046463 Bacteria 1026
304 Ga0495582_0073387 3300046473 Bacteria 1894
305 Ga0495662_0048424 3300046476 Bacteria 2052
306 Ga0495664_0000012 3300046477 Bacteria 226118
307 Ga0495664_0034346 3300046477 Bacteria 2983
308 Ga0495584_0331195 3300046491 Bacteria 773
309 Ga0495630_0072094 3300046517 Bacteria 2600
310 Ga0495630_0131473 3300046517 Bacteria 1901
311 Ga0495652_0202403 3300046529 Bacteria 1506
312 Ga0495587_0227001 3300046536 Unclassified 1053
313 Ga0495609_0112447 3300046538 Unclassified 1175
314 Ga0495667_0155323 3300046559 Unclassified 1473
315 Ga0495667_0202523 3300046559 Bacteria 1270
316 Ga0495588_0038202 3300046674 Bacteria 2442
317 Ga0495657_0290529 3300046675 Bacteria 976
318 Ga0495599_0215283 3300046678 Bacteria 1177
319 Ga0495623_0108355 3300046679 Bacteria 1686
320 Ga0495613_0144372 3300046689 Bacteria 1699
321 Ga0495600_0104293 3300046809 Bacteria 1848
322 Ga0495600_0219440 3300046809 Bacteria 1216
323 Ga0495581_0051568 3300047315 Bacteria 2376
324 Ga0495676_0024695 3300047321 Bacteria 5197
325 Ga0495676_0126441 3300047321 Unclassified 1852
326 Ga0495680_0025400 3300047322 Bacteria 4904
327 Ga0495680_0116609 3300047322 Bacteria 1974
328 Ga0496101_0201194 3300048904 Bacteria 1540
329 Ga0496101_0367715 3300048904 Unclassified 1131
330 Ga0496102_0000027 3300048905 Bacteria 225466
331 Ga0496102_0051495 3300048905 Bacteria 3751
332 Ga0496102_0179711 3300048905 Bacteria 1993
333 Ga0496103_0000047 3300048906 Bacteria 161130
334 Ga0496104_0042664 3300048907 Bacteria 4258
335 Ga0496105_0043750 3300048908 Bacteria 3693
336 Ga0496105_0046043 3300048908 Bacteria 3601
337 Ga0496106_0016447 3300048909 Bacteria 5472
338 Ga0496106_0096202 3300048909 Bacteria 2291
339 Ga0496107_0008738 3300048910 Bacteria 7018
340 Ga0496107_0086883 3300048910 Bacteria 2283
341 Ga0496108_0009490 3300048911 Bacteria 7879
342 Ga0496109_0000950 3300048912 Bacteria 23960
343 Ga0496109_0031913 3300048912 Bacteria 4731
344 Ga0496109_0247708 3300048912 Bacteria 1678
345 Ga0496110_0006177 3300048913 Bacteria 9453
346 Ga0496110_0008718 3300048913 Bacteria 8167
347 Ga0496111_0000705 3300048914 Bacteria 17698
348 Ga0496111_0000842 3300048914 Bacteria 16554
349 Ga0496112_0008005 3300048915 Bacteria 9430
350 Ga0496112_0031734 3300048915 Bacteria 5125
351 Ga0496112_0065641 3300048915 Bacteria 3582
352 Ga0496112_0319954 3300048915 Bacteria 1496
353 Ga0496112_0731120 3300048915 Bacteria 917
354 Ga0496113_0012282 3300048916 Bacteria 5751
355 Ga0496113_0231346 3300048916 Unclassified 1474
356 Ga0496114_0051163 3300048917 Bacteria 3439
357 Ga0496114_0069730 3300048917 Bacteria 2952
358 Ga0496115_0013654 3300048918 Bacteria 6147
359 Ga0501031_0111723 3300049568 Bacteria 1784
360 Ga0501034_0014643 3300049571 Bacteria 8077
361 Ga0501036_0565816 3300049572 Bacteria 944
362 Ga0501039_0029017 3300049575 Bacteria 4260
363 Ga0501039_0185266 3300049575 Bacteria 1637
364 Ga0501040_0040197 3300049576 Bacteria 3182
365 Ga0501040_0366550 3300049576 Bacteria 1033
366 Ga0501041_0010996 3300049577 Bacteria 5344
367 Ga0501041_0080242 3300049577 Bacteria 2009
368 Ga0501042_0015274 3300049578 Bacteria 5256
369 Ga0501048_0015356 3300049582 Bacteria 5655
370 Ga0501070_0001690 3300049586 Bacteria 19562
371 Ga0501070_0005351 3300049586 Bacteria 10950
372 Ga0501071_0041446 3300049587 Bacteria 3298
373 Ga0501071_0173224 3300049587 Bacteria 1616
374 Ga0501072_0013400 3300049588 Bacteria 6274
375 Ga0501072_0018369 3300049588 Bacteria 5383
376 Ga0501072_0163147 3300049588 Bacteria 1778
377 Ga0501073_0030075 3300049589 Bacteria 3879
378 Ga0501073_0036562 3300049589 Bacteria 3489
379 Ga0501074_0022845 3300049590 Bacteria 4548
380 Ga0501074_0039312 3300049590 Bacteria 3426
381 Ga0501075_0111972 3300049591 Bacteria 2075
382 Ga0501077_0149683 3300049593 Bacteria 1481
383 Ga0501079_0322254 3300049741 Bacteria 1210
384 Ga0501080_0000790 3300049742 Bacteria 25827
385 Ga0501080_0163182 3300049742 Bacteria 2057
386 Ga0501081_0053204 3300049743 Bacteria 2795
387 Ga0501083_0001358 3300049744 Bacteria 16628
388 nmdc:mga0yw44_115884_c1 3300050492 Bacteria 1721
389 nmdc:mga05p37_189384_c1 3300050507 Bacteria 2499
390 nmdc:mga05p37_18939_c1 3300050507 Bacteria 8324
391 nmdc:mga05p37_7752_c1 3300050507 Bacteria 12672
392 nmdc:mga06r32_27376_c1 3300050510 Bacteria 5325
393 nmdc:mga06r32_86978_c1 3300050510 Bacteria 3049
394 nmdc:mga08y16_67633_c1 3300050511 Bacteria 3727
395 nmdc:mga08y16_7333_c1 3300050511 Bacteria 11568
396 nmdc:mga08y16_7674_c1 3300050511 Bacteria 11291
397 nmdc:mga0n895_128207_c1 3300050512 Bacteria 2562
398 nmdc:mga0n895_685958_c1 3300050512 Unclassified 1021
399 nmdc:mga0n895_7844_c1 3300050512 Bacteria 9205
400 nmdc:mga0rr50_40726_c1 3300050513 Bacteria 3380
401 nmdc:mga08x19_34700_c1 3300050514 Bacteria 3190
402 nmdc:mga08x19_45778_c1 3300050514 Bacteria 2796
403 nmdc:mga0a205_130130_c1 3300050515 Bacteria 2417
404 nmdc:mga0a205_344855_c1 3300050515 Bacteria 1358
405 nmdc:mga0a205_52698_c1 3300050515 Bacteria 3927
406 Ga0495601_0091154 3300053077 Bacteria 1962
407 Ga0495619_0011696 3300053085 Bacteria 5529
408 Ga0495619_0155651 3300053085 Bacteria 1577
409 Ga0501084_0004087 3300054114 Bacteria 11885
410 Ga0501084_0083826 3300054114 Bacteria 2676
411 Ga0501084_0287055 3300054114 Bacteria 1390
412 Ga0501082_0078899 3300060353 Bacteria 2840
413 Ga0501082_0130756 3300060353 Bacteria 2178
414 Ga0070659_100186978
415 Ga0070658_10012968
416 Ga0070658_10021751
417 Ga0070658_10054881
418 Ga0070658_10287309
419 Ga0070683_100010753
420 Ga0070683_100020179
421 Ga0070683_100025700
422 Ga0070683_100103470
423 Ga0070683_100383671
424 Ga0070680_100022523
425 Ga0070680_100108722
426 Ga0070682_100018951
427 Ga0070660_100002450
428 Ga0070660_100019024
429 Ga0070691_10080196
430 Ga0070661_100074208
431 Ga0070661_100114026
432 Ga0070668_100051781
433 Ga0070671_100232324
434 Ga0070674_100095857
435 Ga0070659_100016925
436 Ga0070659_100201150
437 Ga0070714_100010906
438 Ga0070714_100115479
439 Ga0070711_100038906
440 Ga0070711_100182198
441 Ga0070705_100297141
442 Ga0070708_100481402
443 Ga0070708_100619372
444 Ga0070662_100034908
445 Ga0070681_10061679
446 Ga0070681_10083776
447 Ga0070681_10098461
448 Ga0070706_100016783
449 Ga0070707_100002410
450 Ga0070698_100054179
451 Ga0070698_100089018
452 Ga0070679_100038779
453 Ga0070679_100054273
454 Ga0070679_100174546
455 Ga0070679_100278403
456 Ga0070679_100424660
457 Ga0070684_100005906
458 Ga0070684_100019102
459 Ga0070684_100040785
460 Ga0070684_100048640
461 Ga0070684_100087095
462 Ga0070684_100568618
463 Ga0070697_100126802
464 Ga0068853_100047457
465 Ga0070686_100054646
466 Ga0070686_100383516
467 Ga0070696_100007461
468 Ga0070696_100102746
469 Ga0070696_100289549
470 Ga0070696_100500855
471 Ga0070704_100300324
472 Ga0068855_100045888
473 Ga0068855_100065474
474 Ga0068855_100099076
475 Ga0068855_100302836
476 Ga0070664_100050633
477 Ga0070664_100071464
478 Ga0068857_100005362
479 Ga0068854_100024058
480 Ga0068852_100081832
481 Ga0068861_100041582
482 Ga0068860_100059937
483 Ga0068862_100078144
484 Ga0075365_10064101
485 Ga0070716_100303568
486 Ga0070712_100015703
487 Ga0070712_100171713
488 Ga0075428_100012921
489 Ga0075431_100032936
490 Ga0075431_100178389
491 Ga0075433_10010262
492 Ga0075433_10433775
493 Ga0075434_100152010
494 Ga0068865_100071230
495 Ga0075436_100003793
496 Ga0075436_100379157
497 Ga0075435_100407762
498 Ga0105240_10163303
499 Ga0111539_10009791
500 Ga0111539_10205697
501 Ga0105245_10082589
502 Ga0105245_10677265
503 Ga0114129_10009631
504 Ga0114129_10149038
505 Ga0114129_10205416
506 Ga0105242_10061909
507 Ga0105248_10037582
508 Ga0105248_10089846
509 Ga0105237_10097822
510 Ga0105237_10178555
511 Ga0105249_10315755
512 Ga0105249_10398968
513 Ga0105239_10486687
514 Ga0105239_10570805
515 Ga0157373_10115483
516 Ga0157370_10037383
517 Ga0157370_10158995
518 Ga0157369_10027565
519 Ga0157369_10132964
520 Ga0157369_10323595
521 Ga0157374_10118860
522 Ga0157378_10045814
523 Ga0163162_10414087
524 Ga0157372_10047040
525 Ga0157372_10114016
526 Ga0157372_10486060
527 Ga0157372_11343335
528 Ga0157375_10009947
529 Ga0157375_10058740
530 Ga0157375_10349402
531 Ga0157380_10056962
532 Ga0182008_10146125
533 Ga0182008_10160918
534 Ga0157376_10336667
535 Ga0206356_10714221
536 Ga0206353_10283341
537 Ga0206353_11003882
538 Ga0206353_11274668
539 Ga0207653_10013742
540 Ga0207653_10018618
541 Ga0207642_10013238
542 Ga0207688_10050626
543 Ga0207699_10044780
544 Ga0207705_10093970
545 Ga0207705_10095009
546 Ga0207705_10364068
547 Ga0207707_10004123
548 Ga0207707_10022075
549 Ga0207707_10080768
550 Ga0207707_10409918
551 Ga0207671_10068997
552 Ga0207693_10021875
553 Ga0207693_10026235
554 Ga0207693_10124678
555 Ga0207663_10141486
556 Ga0207663_10246144
557 Ga0207660_10006660
558 Ga0207660_10365725
559 Ga0207657_10004699
560 Ga0207657_10009238
561 Ga0207657_10034927
562 Ga0207657_10094551
563 Ga0207649_10095320
564 Ga0207649_10289485
565 Ga0207652_10006504
566 Ga0207652_10076741
567 Ga0207652_10180726
568 Ga0207652_10284199
569 Ga0207652_10545534
570 Ga0207646_10004016
571 Ga0207687_10323941
572 Ga0207664_10065542
573 Ga0207690_10003169
574 Ga0207690_10082453
575 Ga0207690_10267309
576 Ga0207690_10324955
577 Ga0207706_10022746
578 Ga0207706_10081152
579 Ga0207665_10030111
580 Ga0207691_10649687
581 Ga0207711_10193962
582 Ga0207661_10005618
583 Ga0207661_10059216
584 Ga0207661_10497670
585 Ga0207667_10107102
586 Ga0207667_10234306
587 Ga0207667_10321932
588 Ga0207712_10670753
589 Ga0207640_10039503
590 Ga0207640_10244743
591 Ga0207639_10055926
592 Ga0207639_10182035
593 Ga0207639_10212596
594 Ga0207678_10129756
595 Ga0207708_10022261
596 Ga0207648_10020083
597 Ga0207648_10735224
598 Ga0207674_10003025
599 Ga0207675_100039920
600 Ga0207698_10032352
601 Ga0207698_10195026
602 Ga0207428_10002701
603 Ga0207428_10048730
604 Ga0207428_10148442
605 Ga0268265_10063377
606 Ga0265319_1004518
607 Ga0265334_10008825
608 Ga0265318_10001542
609 Ga0265318_10056714
610 Ga0265336_10032212
611 Ga0265338_10014073
612 Ga0265338_10020451
613 Ga0265330_10005926
614 Ga0265332_10002445
615 Ga0265332_10057126
616 Ga0265328_10000741
617 Ga0265320_10002918
618 Ga0265325_10009239
619 Ga0265329_10001841
620 Ga0265340_10002131
621 Ga0265339_10003067
622 Ga0265339_10003685
623 Ga0265331_10002149
624 Ga0265327_10005281
625 Ga0265327_10035474
626 Ga0265327_10084864
627 Ga0265316_10002974
628 Ga0265316_10032996
629 Ga0265316_10240261
630 Ga0265313_10002612
631 Ga0265313_10025040
632 Ga0265313_10077886
633 Ga0265314_10006684
634 Ga0265314_10012907
635 Ga0265342_10004404
636 Ga0265342_10033366
637 Ga0307413_10008061
638 Ga0307413_10227354
639 Ga0307410_10023547
640 Ga0307410_10034405
641 Ga0307406_10072800
642 Ga0307406_10225957
643 Ga0307407_10123317
644 Ga0307412_10030849
645 Ga0307412_10123816
646 Ga0307409_100026387
647 Ga0307416_100006707
648 Ga0307416_100042444
649 Ga0307416_100356067
650 Ga0307414_10034616
651 Ga0307411_10334427
652 Ga0307415_100024746
653 Ga0307415_100224150
654 Ga0307415_100341701
655 Ga0373933_0265140
656 Ga0373947_0003243
657 Ga0373937_0051802
658 Ga0373925_0050568
659 Ga0395899_0007958
660 Ga0395899_0010422
661 Ga0395900_0004262
662 Ga0395900_0008213
663 Ga0395900_0028116
664 Ga0395900_0043367
665 Ga0395900_0060593
666 Ga0395900_0064504
667 Ga0395900_0302257
668 Ga0395900_0844940
669 Ga0395900_0867201
670 Ga0395898_0000836
671 Ga0395898_0010958
672 Ga0395898_0047879
673 Ga0395898_0057997
674 Ga0395898_0063089
675 Ga0395898_0100699
676 Ga0395898_0218177
677 Ga0395898_0430994
678 Ga0395905_0015297
679 Ga0395905_0020406
680 Ga0395905_0061922
681 Ga0395905_0067511
682 Ga0395901_0001336
683 Ga0395901_0003948
684 Ga0395901_0008719
685 Ga0395901_0014925
686 Ga0395901_0020047
687 Ga0395901_0026545
688 Ga0395901_0097111
689 Ga0395901_0103168
690 Ga0395901_0126872
691 Ga0395901_0166762
692 Ga0395901_0350939
693 Ga0395901_0365455
694 Ga0395901_0416109
695 Ga0451839_0296119
696 Ga0439451_005567
697 Ga0450910_020861
698 Ga0466963_0018680
699 Ga0466963_0174156
700 Ga0466964_0034583
701 Ga0466964_0046288
702 Ga0466968_0010377
703 Ga0466957_0031830
704 Ga0466960_0038849
705 Ga0466960_0262847
706 Ga0466958_0122750
707 Ga0466958_0203808
708 Ga0466967_0013620
709 Ga0466967_0072114
710 Ga0466967_0123754
711 Ga0466967_0137469
712 Ga0495603_0010348
713 Ga0495629_0017577
714 Ga0495641_0023604
715 Ga0495653_0263681
716 Ga0495653_0310434
717 Ga0495582_0073387
718 Ga0495662_0048424
719 Ga0495664_0000012
720 Ga0495664_0034346
721 Ga0495584_0331195
722 Ga0495630_0072094
723 Ga0495630_0131473
724 Ga0495652_0202403
725 Ga0495587_0227001
726 Ga0495609_0112447
727 Ga0495667_0155323
728 Ga0495667_0202523
729 Ga0495588_0038202
730 Ga0495657_0290529
731 Ga0495599_0215283
732 Ga0495623_0108355
733 Ga0495613_0144372
734 Ga0495600_0104293
735 Ga0495600_0219440
736 Ga0495581_0051568
737 Ga0495676_0024695
738 Ga0495676_0126441
739 Ga0495680_0025400
740 Ga0495680_0116609
741 Ga0496101_0201194
742 Ga0496101_0367715
743 Ga0496102_0000027
744 Ga0496102_0051495
745 Ga0496102_0179711
746 Ga0496103_0000047
747 Ga0496104_0042664
748 Ga0496105_0043750
749 Ga0496105_0046043
750 Ga0496106_0016447
751 Ga0496106_0096202
752 Ga0496107_0008738
753 Ga0496107_0086883
754 Ga0496108_0009490
755 Ga0496109_0000950
756 Ga0496109_0031913
757 Ga0496109_0247708
758 Ga0496110_0006177
759 Ga0496110_0008718
760 Ga0496111_0000705
761 Ga0496111_0000842
762 Ga0496112_0008005
763 Ga0496112_0031734
764 Ga0496112_0065641
765 Ga0496112_0319954
766 Ga0496112_0731120
767 Ga0496113_0012282
768 Ga0496113_0231346
769 Ga0496114_0051163
770 Ga0496114_0069730
771 Ga0496115_0013654
772 Ga0501031_0111723
773 Ga0501034_0014643
774 Ga0501036_0565816
775 Ga0501039_0029017
776 Ga0501039_0185266
777 Ga0501040_0040197
778 Ga0501040_0366550
779 Ga0501041_0010996
780 Ga0501041_0080242
781 Ga0501042_0015274
782 Ga0501048_0015356
783 Ga0501070_0001690
784 Ga0501070_0005351
785 Ga0501071_0041446
786 Ga0501071_0173224
787 Ga0501072_0013400
788 Ga0501072_0018369
789 Ga0501072_0163147
790 Ga0501073_0030075
791 Ga0501073_0036562
792 Ga0501074_0022845
793 Ga0501074_0039312
794 Ga0501075_0111972
795 Ga0501077_0149683
796 Ga0501079_0322254
797 Ga0501080_0000790
798 Ga0501080_0163182
799 Ga0501081_0053204
800 Ga0501083_0001358
801 nmdc:mga0yw44_115884_c1
802 nmdc:mga05p37_189384_c1
803 nmdc:mga05p37_18939_c1
804 nmdc:mga05p37_7752_c1
805 nmdc:mga06r32_27376_c1
806 nmdc:mga06r32_86978_c1
807 nmdc:mga08y16_67633_c1
808 nmdc:mga08y16_7333_c1
809 nmdc:mga08y16_7674_c1
810 nmdc:mga0n895_128207_c1
811 nmdc:mga0n895_685958_c1
812 nmdc:mga0n895_7844_c1
813 nmdc:mga0rr50_40726_c1
814 nmdc:mga08x19_34700_c1
815 nmdc:mga08x19_45778_c1
816 nmdc:mga0a205_130130_c1
817 nmdc:mga0a205_344855_c1
818 nmdc:mga0a205_52698_c1
819 Ga0495601_0091154
820 Ga0495619_0011696
821 Ga0495619_0155651
822 Ga0501084_0004087
823 Ga0501084_0083826
824 Ga0501084_0287055
825 Ga0501082_0078899
826 Ga0501082_0130756

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06750

A24_N_bact

Bacterial Peptidase A24 N-terminal domain

10

92

0.99

PF01478

Peptidase_A24

Type IV leader peptidase family

102

206

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4knf-assembly1.cif.gz_B crystal structure of a blue-light absorbing proteorhodopsin double-mutant d97n/q105l from hot75 0.3587 90 235
2hqg-assembly1.cif.gz_A-3 conformation of the acrb multidrug efflux pump in mutants of the putative proton relay pathway 0.3264 69 233
6iok-assembly1.cif.gz_F cryo-em structure of multidrug efflux pump mexab-oprm (0 degree state) 0.3093 54 248
7y3m-assembly2.cif.gz_C structure of sall4 zfc1 bound with 16 bp at-rich dsdna 0.3049 34 79
7rr6-assembly1.cif.gz_C multidrug efflux pump subunit acrb 0.3015 48 236
ID Description Score Start End Superfamily
af_I6Y9M6_1_137_1.20.120.1220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8521 97 235 1.20.120.1220
af_I6Y9M6_1_137_1.20.120.1220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8288 97 235 1.20.120.1220
af_P25960_74_220_1.20.120.1220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.808 96 230 1.20.120.1220
af_P25960_74_220_1.20.120.1220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7423 96 230 1.20.120.1220
af_P81324_4_130_1.20.120.1220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7247 99 217 1.20.120.1220
ID Description Score Start End GO Terms
AF-A0A538GUC9-F1-model_v4 Prepilin peptidase 0.9974 109 244 GO:0004190
GO:0005886
GO:0006465
AF-A0A538JAD7-F1-model_v4 Prepilin peptidase 0.9901 2 245 GO:0004190
GO:0005886
GO:0006465
AF-A0A7W0Q0L7-F1-model_v4 Prepilin peptidase 0.9853 4 245 GO:0004190
GO:0005886
GO:0006465
AF-A0A7V8XIE8-F1-model_v4 Prepilin peptidase 0.9743 71 242 GO:0004190
GO:0005886
GO:0006465
AF-A0A7Y5X3M6-F1-model_v4 Prepilin peptidase 0.9715 2 156 GO:0004190
GO:0005886
GO:0006465

Map