metagRoot

F437984

General Info

Members	Datasets	Scaffolds	Average Seq Length
413	210	406	470

Family's Representative Sequence

Representative Sequence	3300005341\|Ga0070691_10055032\|Ga0070691_100550322
Length	511
Sequence	MCHAPDECCPKSRGGTVQGVQWGSRGWLTNGVDMRRLNGVDALMLYTETPEIHMHTLKIGVLDVSGVEGGYSFDLFRHVAYPRLQAMAPLRHQLVDVPLKLHHPMWVVNDDIDFDYHVRRVRVPAPGGRRELDQLIGEIASTPLDRSRPLWEMYVAEGLTDGRIAIIHKVHHVLADGVASANQMARAMEPYEPPAGVRVSEGSSTAWTRADLLKAAGRDHVGLIRKLPRLINETATGVSRVRRRSKERGHHPDLARNFAPPQCFINHVVSPRRRFATAPLSLADVKETSKHLGVTLNDIVLATAAGALRQLLLRYDRHADSPLIAGVPVSYNTSPERLVGNEFTYMTPSLPVQIDDPMERVKLTSVATAIAKENHQLLGPTLLPAWLSYLPPALAPGVFRRQASRLESASVMNLTISNVPGPRQRGHIEGATVSEIYSVGPVVTGSGMNITVWSYVDQLAISVLTDDLTLEDPHEATDAMIDGFIEIRRAAGLSADLTPVEDTLPLAAATG

Samples

	Sample ID	Description	Type	Environment
1	2643221687	Mycobacterium sp. Root135	Isolate	Unclassified
2	2643221715	Mycobacterium sp. Root265	Isolate	Unclassified
3	2842134933	Mycolicibacterium obuense SEMIA 442	Isolate	Nodule
4	2902810491	Mycolicibacterium sp. P9-22	Isolate	Unclassified
5	2902837492	Mycolicibacterium sp. P1-18	Isolate	Unclassified
6	2929212328	Mycolicibacterium sp. R-73050 Hybrid assembly	Isolate	Unclassified
7	3300001977	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5	Metagenome	Rhizosphere
8	3300002074	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1	Metagenome	Rhizosphere
9	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
10	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
11	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
12	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
13	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
14	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
15	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
16	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
17	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
18	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
19	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
20	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
21	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
22	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
23	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
24	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
25	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
26	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
27	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
28	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
29	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
30	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
31	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
32	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
33	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
34	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
35	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
36	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
37	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
38	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
39	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
40	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
41	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
42	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
43	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
44	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
45	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
46	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
47	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
48	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
49	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
50	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
51	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
52	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
53	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
54	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
55	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
56	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
57	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
58	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
59	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
60	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
61	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
62	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
63	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
64	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
65	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
66	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
67	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
68	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
69	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
70	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
71	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
72	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
73	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
74	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
75	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
76	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
77	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
78	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
79	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
80	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
81	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
82	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
83	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
84	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
85	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
86	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
87	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
88	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
89	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
119	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
123	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
124	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
125	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
126	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
127	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
128	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
129	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
130	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
131	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
132	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
133	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
134	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
135	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
136	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
137	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
138	3300042002	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616	Metagenome	Rhizosphere
139	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
140	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
141	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
142	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
143	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
144	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
145	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
146	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
147	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
148	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
149	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
150	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
151	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
152	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
153	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
154	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
155	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
156	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
157	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
158	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
159	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
160	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
161	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
162	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
163	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
164	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
165	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
166	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
167	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
168	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
169	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
170	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
171	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
172	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
173	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
174	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
175	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
176	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
177	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
178	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
179	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
180	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
181	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
182	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
183	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
184	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
185	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
186	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
187	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
188	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
189	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
190	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
191	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
192	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
193	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
194	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
195	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
196	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
197	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
198	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
199	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
200	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
201	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
202	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
203	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
204	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
205	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
206	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
207	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
208	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
209	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
210	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	98.31
Metatranscriptomes	0
Isolates	1.69

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	17.43
Nodule	0.24
Rhizoplane	12.83
Rhizosphere	62.71
Stem	0
Stem Tuber	0
Unclassified	6.78

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24746J21847_1001885	3300001977	Bacteria	3345
2	JGI24748J21848_1003748	3300002074	Bacteria	1738
3	JGI24744J21845_10000411	3300002077	Bacteria	7437
4	JGI24744J21845_10003095	3300002077	Bacteria	3408
5	JGI24744J21845_10004280	3300002077	Bacteria	2946
6	JGI24742J22300_10000708	3300002244	Bacteria	5050
7	Ga0055540_1000102	3300003792	Bacteria	95294
8	Ga0055540_1002874	3300003792	Bacteria	8742
9	Ga0055540_1007940	3300003792	Bacteria	3902
10	Ga0055540_1010196	3300003792	Bacteria	3147
11	Ga0070676_10004577	3300005328	Bacteria	7289
12	Ga0070690_100008096	3300005330	Bacteria	6038
13	Ga0068869_100023638	3300005334	Bacteria	4249
14	Ga0070666_10068818	3300005335	Bacteria	2406
15	Ga0070682_100010307	3300005337	Bacteria	5303
16	Ga0070682_100010626	3300005337	Bacteria	5230
17	Ga0068868_100004288	3300005338	Bacteria	9987
18	Ga0070689_100086358	3300005340	Bacteria	2467
19	Ga0070689_100138008	3300005340	Bacteria	1959
20	Ga0070691_10043037	3300005341	Bacteria	2138
21	Ga0070691_10055032	3300005341	Bacteria	1905
22	Ga0070668_100000721	3300005347	Bacteria	22652
23	Ga0070669_100002794	3300005353	Bacteria	12596
24	Ga0070675_100114181	3300005354	Bacteria	2288
25	Ga0070671_100053998	3300005355	Bacteria	3340
26	Ga0070674_100012853	3300005356	Bacteria	5154
27	Ga0070659_100061561	3300005366	Bacteria	2966
28	Ga0070667_100000266	3300005367	Bacteria	59196
29	Ga0070667_100001170	3300005367	Bacteria	23854
30	Ga0070667_100037531	3300005367	Bacteria	4062
31	Ga0070710_10000779	3300005437	Bacteria	15236
32	Ga0070701_10000490	3300005438	Bacteria	13560
33	Ga0070711_100000647	3300005439	Bacteria	18182
34	Ga0070711_100003202	3300005439	Bacteria	9502
35	Ga0070705_100001755	3300005440	Bacteria	11262
36	Ga0070700_100001433	3300005441	Bacteria	11864
37	Ga0070700_100023712	3300005441	Bacteria	3592
38	Ga0070663_100074335	3300005455	Bacteria	2481
39	Ga0070663_100123896	3300005455	Bacteria	1955
40	Ga0070678_100000061	3300005456	Bacteria	39817
41	Ga0070678_100135730	3300005456	Bacteria	1962
42	Ga0070662_100002954	3300005457	Bacteria	10565
43	Ga0068867_100004485	3300005459	Bacteria	9808
44	Ga0068867_100161814	3300005459	Bacteria	1765
45	Ga0068867_100184496	3300005459	Bacteria	1661
46	Ga0070679_100202518	3300005530	Bacteria	1950
47	Ga0068853_100002938	3300005539	Bacteria	12966
48	Ga0070672_100079309	3300005543	Bacteria	2628
49	Ga0070695_100010220	3300005545	Bacteria	5600
50	Ga0070696_100112524	3300005546	Bacteria	1962
51	Ga0070665_100001918	3300005548	Bacteria	23511
52	Ga0070665_100003028	3300005548	Bacteria	18124
53	Ga0070665_100020711	3300005548	Bacteria	6608
54	Ga0070665_100040130	3300005548	Bacteria	4706
55	Ga0070704_100018226	3300005549	Bacteria	4483
56	Ga0068854_100004628	3300005578	Bacteria	8679
57	Ga0068854_100077359	3300005578	Bacteria	2448
58	Ga0068854_100115392	3300005578	Bacteria	2031
59	Ga0068854_100159321	3300005578	Bacteria	1746
60	Ga0068856_100183325	3300005614	Bacteria	2107
61	Ga0070702_100000241	3300005615	Bacteria	18557
62	Ga0068852_100038316	3300005616	Bacteria	4028
63	Ga0068859_100001872	3300005617	Bacteria	21423
64	Ga0068859_100091820	3300005617	Bacteria	3087
65	Ga0068866_10000351	3300005718	Bacteria	21618
66	Ga0068866_10013211	3300005718	Bacteria	3616
67	Ga0068861_100000122	3300005719	Bacteria	39876
68	Ga0068861_100083138	3300005719	Bacteria	2511
69	Ga0068863_100098436	3300005841	Bacteria	2778
70	Ga0068863_100284390	3300005841	Bacteria	1603
71	Ga0068858_100011223	3300005842	Bacteria	8465
72	Ga0068858_100026412	3300005842	Bacteria	5395
73	Ga0068858_100089431	3300005842	Bacteria	2865
74	Ga0068860_100001605	3300005843	Bacteria	24276
75	Ga0068860_100066688	3300005843	Bacteria	3419
76	Ga0068862_100019588	3300005844	Bacteria	5650
77	Ga0081455_10081624	3300005937	Bacteria	2647
78	Ga0075365_10000414	3300006038	Bacteria	15706
79	Ga0075365_10000611	3300006038	Bacteria	14048
80	Ga0075365_10002297	3300006038	Bacteria	9299
81	Ga0075365_10005689	3300006038	Bacteria	6759
82	Ga0075365_10015906	3300006038	Bacteria	4560
83	Ga0075365_10056281	3300006038	Bacteria	2614
84	Ga0075365_10097396	3300006038	Bacteria	2011
85	Ga0075368_10003749	3300006042	Bacteria	5102
86	Ga0075363_100000524	3300006048	Bacteria	12347
87	Ga0075363_100000840	3300006048	Bacteria	10684
88	Ga0075363_100003923	3300006048	Bacteria	6417
89	Ga0075363_100037012	3300006048	Bacteria	2561
90	Ga0075363_100041119	3300006048	Bacteria	2438
91	Ga0075364_10001330	3300006051	Bacteria	13298
92	Ga0075364_10008437	3300006051	Bacteria	6158
93	Ga0075364_10014135	3300006051	Bacteria	4926
94	Ga0075364_10098149	3300006051	Bacteria	1949
95	Ga0075364_10122904	3300006051	Bacteria	1739
96	Ga0070716_100018357	3300006173	Bacteria	3643
97	Ga0070716_100047173	3300006173	Bacteria	2428
98	Ga0070712_100003368	3300006175	Bacteria	9826
99	Ga0075362_10009107	3300006177	Bacteria	3822
100	Ga0075362_10021516	3300006177	Bacteria	2708
101	Ga0075367_10010176	3300006178	Bacteria	4931
102	Ga0075369_10003185	3300006186	Bacteria	5952
103	Ga0075369_10003726	3300006186	Bacteria	5576
104	Ga0075369_10005644	3300006186	Bacteria	4688
105	Ga0075369_10013630	3300006186	Bacteria	3233
106	Ga0075369_10069200	3300006186	Bacteria	1552
107	Ga0075370_10005284	3300006353	Bacteria	6396
108	Ga0075370_10005874	3300006353	Bacteria	6134
109	Ga0075370_10006321	3300006353	Bacteria	5950
110	Ga0075370_10012981	3300006353	Bacteria	4418
111	Ga0075370_10013139	3300006353	Bacteria	4395
112	Ga0075370_10013204	3300006353	Bacteria	4384
113	Ga0075370_10051617	3300006353	Bacteria	2333
114	Ga0075370_10072928	3300006353	Bacteria	1966
115	Ga0068865_100000197	3300006881	Bacteria	33642
116	Ga0097620_100001872	3300006931	Bacteria	21423
117	Ga0097620_100091816	3300006931	Bacteria	3087
118	Ga0105250_10013511	3300009092	Bacteria	3364
119	Ga0105245_10004240	3300009098	Bacteria	12719
120	Ga0105245_10064525	3300009098	Bacteria	3309
121	Ga0105247_10000456	3300009101	Bacteria	34514
122	Ga0105242_10002141	3300009176	Bacteria	15592
123	Ga0105248_10002640	3300009177	Bacteria	19918
124	Ga0105248_10077932	3300009177	Bacteria	3727
125	Ga0105237_10003621	3300009545	Bacteria	18248
126	Ga0105249_10001439	3300009553	Bacteria	20816
127	Ga0105249_10039655	3300009553	Bacteria	4276
128	Ga0105249_10040169	3300009553	Bacteria	4249
129	Ga0105249_10060452	3300009553	Bacteria	3476
130	Ga0105249_10098570	3300009553	Bacteria	2745
131	Ga0105239_10007153	3300010375	Bacteria	12840
132	Ga0105239_10076676	3300010375	Bacteria	3677
133	Ga0105246_10021988	3300011119	Bacteria	4112
134	Ga0157374_10068634	3300013296	Bacteria	3336
135	Ga0157374_10183785	3300013296	Bacteria	2043
136	Ga0157378_10001662	3300013297	Bacteria	20101
137	Ga0157378_10128746	3300013297	Bacteria	2341
138	Ga0163162_10003575	3300013306	Bacteria	14865
139	Ga0163162_10012011	3300013306	Bacteria	8445
140	Ga0163162_10035354	3300013306	Bacteria	4976
141	Ga0163162_10061612	3300013306	Bacteria	3789
142	Ga0163162_10170849	3300013306	Bacteria	2299
143	Ga0157372_10218207	3300013307	Bacteria	2211
144	Ga0157375_10062021	3300013308	Bacteria	3714
145	Ga0157375_10076033	3300013308	Bacteria	3383
146	Ga0157375_10119165	3300013308	Bacteria	2747
147	Ga0157375_10172747	3300013308	Bacteria	2309
148	Ga0163163_10123565	3300014325	Bacteria	2624
149	Ga0157380_10002545	3300014326	Bacteria	12308
150	Ga0157377_10007055	3300014745	Bacteria	5396
151	Ga0157377_10067939	3300014745	Bacteria	2053
152	Ga0157379_10002932	3300014968	Bacteria	14394
153	Ga0163161_10075889	3300017792	Bacteria	2467
154	Ga0163161_10136675	3300017792	Bacteria	1853
155	Ga0213876_10003462	3300021384	Bacteria	9022
156	Ga0213876_10011239	3300021384	Bacteria	4783
157	Ga0213875_10035136	3300021388	Bacteria	2366
158	Ga0209051_1000116	3300025303	Bacteria	150182
159	Ga0209051_1000374	3300025303	Bacteria	64311
160	Ga0209051_1001965	3300025303	Bacteria	15801
161	Ga0209051_1023839	3300025303	Bacteria	2534
162	Ga0207692_10001070	3300025898	Bacteria	10018
163	Ga0207642_10007227	3300025899	Bacteria	3740
164	Ga0207710_10003936	3300025900	Bacteria	6553
165	Ga0207688_10003984	3300025901	Bacteria	8049
166	Ga0207688_10004582	3300025901	Bacteria	7524
167	Ga0207680_10044696	3300025903	Bacteria	2607
168	Ga0207671_10003961	3300025914	Bacteria	14403
169	Ga0207693_10000189	3300025915	Bacteria	56358
170	Ga0207681_10010501	3300025923	Bacteria	5671
171	Ga0207687_10035636	3300025927	Bacteria	3386
172	Ga0207690_10151847	3300025932	Bacteria	1718
173	Ga0207706_10001089	3300025933	Bacteria	27567
174	Ga0207670_10112153	3300025936	Bacteria	1967
175	Ga0207669_10001796	3300025937	Bacteria	9098
176	Ga0207669_10012776	3300025937	Bacteria	4142
177	Ga0207669_10087619	3300025937	Bacteria	2017
178	Ga0207704_10002044	3300025938	Bacteria	9025
179	Ga0207704_10041809	3300025938	Bacteria	2692
180	Ga0207665_10002245	3300025939	Bacteria	13044
181	Ga0207665_10003491	3300025939	Bacteria	10499
182	Ga0207691_10045932	3300025940	Bacteria	4015
183	Ga0207711_10008877	3300025941	Bacteria	8406
184	Ga0207689_10032252	3300025942	Bacteria	4358
185	Ga0207689_10062951	3300025942	Bacteria	3051
186	Ga0207689_10095011	3300025942	Bacteria	2448
187	Ga0207712_10014862	3300025961	Bacteria	5013
188	Ga0207712_10100046	3300025961	Bacteria	2154
189	Ga0207658_10000206	3300025986	Bacteria	61427
190	Ga0207658_10006396	3300025986	Bacteria	8045
191	Ga0207658_10012849	3300025986	Bacteria	5718
192	Ga0207658_10027840	3300025986	Bacteria	3975
193	Ga0207658_10060814	3300025986	Bacteria	2820
194	Ga0207677_10029537	3300026023	Bacteria	3485
195	Ga0207703_10043833	3300026035	Bacteria	3592
196	Ga0207639_10003832	3300026041	Bacteria	10136
197	Ga0207639_10186064	3300026041	Bacteria	1771
198	Ga0207678_10009940	3300026067	Bacteria	8346
199	Ga0207708_10000429	3300026075	Bacteria	32643
200	Ga0207708_10017005	3300026075	Bacteria	5475
201	Ga0207708_10119537	3300026075	Bacteria	2053
202	Ga0207641_10001669	3300026088	Bacteria	21601
203	Ga0207641_10080026	3300026088	Bacteria	2834
204	Ga0207641_10218318	3300026088	Bacteria	1767
205	Ga0207648_10001727	3300026089	Bacteria	23923
206	Ga0207675_100000325	3300026118	Bacteria	45410
207	Ga0207675_100022230	3300026118	Bacteria	5905
208	Ga0207675_100037141	3300026118	Bacteria	4544
209	Ga0207675_100118041	3300026118	Bacteria	2508
210	Ga0207683_10000161	3300026121	Bacteria	56865
211	Ga0207683_10044704	3300026121	Bacteria	3872
212	Ga0207683_10094043	3300026121	Bacteria	2671
213	Ga0209813_10002604	3300027866	Bacteria	4144
214	Ga0268266_10008107	3300028379	Bacteria	9379
215	Ga0268266_10032575	3300028379	Bacteria	4428
216	Ga0268265_10063752	3300028380	Bacteria	2836
217	Ga0268264_10034360	3300028381	Bacteria	4170
218	Ga0265327_10001906	3300031251	Bacteria	24090
219	Ga0307413_10021540	3300031824	Bacteria	3455
220	Ga0307413_10094418	3300031824	Bacteria	1958
221	Ga0307410_10042297	3300031852	Bacteria	3011
222	Ga0307407_10087842	3300031903	Bacteria	1898
223	Ga0307412_10162293	3300031911	Bacteria	1662
224	Ga0307409_100007735	3300031995	Bacteria	6459
225	Ga0307409_100016168	3300031995	Bacteria	4928
226	Ga0307416_100046373	3300032002	Bacteria	3429
227	Ga0373931_0016591	3300035691	Bacteria	3628
228	Ga0373935_0113450	3300035692	Bacteria	1802
229	Ga0436364_0483639	3300037853	Bacteria	3000
230	Ga0436364_1022764	3300037853	Bacteria	5428
231	Ga0436364_1325339	3300037853	Bacteria	11134
232	Ga0436365_0161820	3300039437	Bacteria	55653
233	Ga0436365_1377767	3300039437	Bacteria	53266
234	Ga0436365_1508640	3300039437	Bacteria	5220
235	Ga0439461_0000402	3300041410	Bacteria	6222
236	Ga0439466_0005387	3300041411	Bacteria	4892
237	Ga0439466_0007942	3300041411	Bacteria	4002
238	Ga0439466_0014610	3300041411	Bacteria	2857
239	Ga0439465_0009908	3300041413	Bacteria	3001
240	Ga0439465_0010087	3300041413	Bacteria	2970
241	Ga0439465_0013662	3300041413	Bacteria	2529
242	Ga0439465_0015287	3300041413	Bacteria	2394
243	Ga0439465_0017740	3300041413	Bacteria	2224
244	Ga0451793_0921930	3300041452	Bacteria	2266
245	Ga0439431_0001879	3300041997	Bacteria	4657
246	Ga0439442_004120	3300042002	Bacteria	2884
247	Ga0439445_0002577	3300042004	Bacteria	4032
248	Ga0439448_0001539	3300042005	Bacteria	6027
249	Ga0439434_0001418	3300042435	Bacteria	6915
250	Ga0439434_0012280	3300042435	Bacteria	2535
251	Ga0466972_0014776	3300044658	Bacteria	3906
252	Ga0466972_0016996	3300044658	Bacteria	3639
253	Ga0466965_0004542	3300044683	Bacteria	6176
254	Ga0466965_0006499	3300044683	Bacteria	5313
255	Ga0466965_0032716	3300044683	Bacteria	2540
256	Ga0466966_0007457	3300044684	Bacteria	7254
257	Ga0466961_0009448	3300044693	Bacteria	6209
258	Ga0466961_0022720	3300044693	Bacteria	4034
259	Ga0466968_0003609	3300044735	Bacteria	5729
260	Ga0466968_0006046	3300044735	Bacteria	4545
261	Ga0466957_0002695	3300044842	Bacteria	9600
262	Ga0466957_0017461	3300044842	Bacteria	4203
263	Ga0466957_0022367	3300044842	Bacteria	3730
264	Ga0466957_0024642	3300044842	Bacteria	3562
265	Ga0466957_0055218	3300044842	Bacteria	2427
266	Ga0466960_0000316	3300044901	Bacteria	16570
267	Ga0466960_0000489	3300044901	Bacteria	13508
268	Ga0466959_0012304	3300045049	Bacteria	6178
269	Ga0466959_0015120	3300045049	Bacteria	5621
270	Ga0466959_0104000	3300045049	Bacteria	2031
271	Ga0466958_0008737	3300045836	Bacteria	5624
272	Ga0466958_0032916	3300045836	Bacteria	3086
273	Ga0466958_0040004	3300045836	Bacteria	2818
274	Ga0466967_0001731	3300045976	Bacteria	13020
275	Ga0466967_0068009	3300045976	Bacteria	3179
276	Ga0466967_0109515	3300045976	Bacteria	2536
277	Ga0466967_0114497	3300045976	Bacteria	2483
278	Ga0495603_0010830	3300046455	Bacteria	5533
279	Ga0495629_0054386	3300046459	Bacteria	2800
280	Ga0495629_0065718	3300046459	Bacteria	2531
281	Ga0495638_0007018	3300046460	Bacteria	8124
282	Ga0495662_0019278	3300046476	Bacteria	3299
283	Ga0495640_0011274	3300046533	Bacteria	6882
284	Ga0495672_0070628	3300047320	Bacteria	1978
285	Ga0495672_0084506	3300047320	Bacteria	1760
286	Ga0495686_0005608	3300047472	Bacteria	9855
287	Ga0495593_0004154	3300047673	Bacteria	8619
288	Ga0495593_0012355	3300047673	Bacteria	4880
289	Ga0496100_0000095	3300048903	Bacteria	50413
290	Ga0496100_0011445	3300048903	Bacteria	5050
291	Ga0496100_0023897	3300048903	Bacteria	3720
292	Ga0496100_0124558	3300048903	Bacteria	1807
293	Ga0496101_0000027	3300048904	Bacteria	199664
294	Ga0496101_0010068	3300048904	Bacteria	6233
295	Ga0496101_0017804	3300048904	Bacteria	4822
296	Ga0496102_0019743	3300048905	Bacteria	5941
297	Ga0496102_0072755	3300048905	Bacteria	3159
298	Ga0496102_0092052	3300048905	Bacteria	2807
299	Ga0496102_0156207	3300048905	Bacteria	2144
300	Ga0496103_0000226	3300048906	Bacteria	54762
301	Ga0496103_0001967	3300048906	Bacteria	13284
302	Ga0496104_0013774	3300048907	Bacteria	7295
303	Ga0496104_0024408	3300048907	Bacteria	5561
304	Ga0496104_0189065	3300048907	Bacteria	1970
305	Ga0496105_0048598	3300048908	Bacteria	3502
306	Ga0496106_0000413	3300048909	Bacteria	30337
307	Ga0496106_0001172	3300048909	Bacteria	19491
308	Ga0496106_0012431	3300048909	Bacteria	6287
309	Ga0496107_0002822	3300048910	Bacteria	11457
310	Ga0496107_0009910	3300048910	Bacteria	6612
311	Ga0496107_0021513	3300048910	Bacteria	4558
312	Ga0496108_0000811	3300048911	Bacteria	24279
313	Ga0496108_0004308	3300048911	Bacteria	11444
314	Ga0496108_0011577	3300048911	Bacteria	7173
315	Ga0496108_0044412	3300048911	Bacteria	3710
316	Ga0496108_0044732	3300048911	Bacteria	3696
317	Ga0496108_0057797	3300048911	Bacteria	3259
318	Ga0496108_0077773	3300048911	Bacteria	2807
319	Ga0496108_0100353	3300048911	Bacteria	2469
320	Ga0496109_0000407	3300048912	Bacteria	38371
321	Ga0496109_0007888	3300048912	Bacteria	9023
322	Ga0496109_0020648	3300048912	Bacteria	5819
323	Ga0496110_0003553	3300048913	Bacteria	11972
324	Ga0496110_0023809	3300048913	Bacteria	5212
325	Ga0496110_0025551	3300048913	Bacteria	5048
326	Ga0496110_0048417	3300048913	Bacteria	3727
327	Ga0496110_0070109	3300048913	Bacteria	3105
328	Ga0496110_0070938	3300048913	Bacteria	3088
329	Ga0496112_0006634	3300048915	Bacteria	10190
330	Ga0496112_0028958	3300048915	Bacteria	5353
331	Ga0496112_0048585	3300048915	Bacteria	4160
332	Ga0496112_0074413	3300048915	Bacteria	3358
333	Ga0496112_0144683	3300048915	Bacteria	2346
334	Ga0496113_0046115	3300048916	Bacteria	3235
335	Ga0496113_0081947	3300048916	Bacteria	2474
336	Ga0496114_0000282	3300048917	Bacteria	37014
337	Ga0496114_0000849	3300048917	Bacteria	22880
338	Ga0496114_0009471	3300048917	Bacteria	7733
339	Ga0496115_0005557	3300048918	Bacteria	9174
340	Ga0496115_0027477	3300048918	Bacteria	4451
341	Ga0496116_0002036	3300048919	Bacteria	21684
342	Ga0496117_0005400	3300048920	Bacteria	13447
343	Ga0496118_0000652	3300048921	Bacteria	56676
344	Ga0496118_0039296	3300048921	Bacteria	3777
345	Ga0496119_0001985	3300048922	Bacteria	23212
346	Ga0496120_0004741	3300048923	Bacteria	11165
347	Ga0496121_0000004	3300048924	Bacteria	1139011
348	Ga0496122_0000763	3300048925	Bacteria	62213
349	Ga0496123_0029809	3300048926	Bacteria	4006
350	Ga0496124_0000030	3300048927	Bacteria	351350
351	Ga0496125_0000003	3300048928	Bacteria	1189767
352	Ga0496126_0000001	3300048929	Bacteria	1139011
353	Ga0496126_0002449	3300048929	Bacteria	25054
354	Ga0501034_0004016	3300049571	Bacteria	16506
355	Ga0501034_0087026	3300049571	Bacteria	3125
356	Ga0501037_0000645	3300049573	Bacteria	26958
357	Ga0501037_0004758	3300049573	Bacteria	9873
358	Ga0501038_0010650	3300049574	Bacteria	8406
359	Ga0501038_0060688	3300049574	Bacteria	3236
360	Ga0501039_0002406	3300049575	Bacteria	13915
361	Ga0501043_0001211	3300049579	Bacteria	22713
362	Ga0501047_0002041	3300049581	Bacteria	19301
363	Ga0501048_0001321	3300049582	Bacteria	18778
364	Ga0501069_0049494	3300049585	Bacteria	2336
365	Ga0501070_0005341	3300049586	Bacteria	10957
366	Ga0501070_0012413	3300049586	Bacteria	7186
367	Ga0501070_0030545	3300049586	Bacteria	4515
368	Ga0501070_0141842	3300049586	Bacteria	1984
369	Ga0501073_0029074	3300049589	Bacteria	3949
370	Ga0501073_0147251	3300049589	Bacteria	1632
371	Ga0501080_0076144	3300049742	Bacteria	3121
372	Ga0501035_0007357	3300049822	Bacteria	10290
373	Ga0501044_0007519	3300049823	Bacteria	11985
374	Ga0501044_0034441	3300049823	Bacteria	5310
375	Ga0501044_0173701	3300049823	Bacteria	2125
376	nmdc:mga03683_21080_c1	3300050489	Bacteria	2507
377	nmdc:mga03683_26141_c1	3300050489	Bacteria	2300
378	nmdc:mga03683_29167_c1	3300050489	Bacteria	2198
379	nmdc:mga03n38_617_c1	3300050490	Bacteria	9114
380	nmdc:mga03n38_9496_c1	3300050490	Bacteria	3543
381	nmdc:mga00v17_17554_c1	3300050491	Bacteria	4053
382	nmdc:mga00v17_2026_c1	3300050491	Bacteria	10433
383	nmdc:mga00v17_20812_c1	3300050491	Bacteria	3763
384	nmdc:mga00v17_25510_c1	3300050491	Bacteria	3436
385	nmdc:mga0yw44_102024_c1	3300050492	Bacteria	1828
386	nmdc:mga0yw44_1905_c1	3300050492	Bacteria	8605
387	nmdc:mga0yw44_20560_c1	3300050492	Bacteria	3666
388	nmdc:mga0yw44_34980_c1	3300050492	Bacteria	2948
389	nmdc:mga0yw44_9170_c1	3300050492	Bacteria	4981
390	nmdc:mga06z11_23712_c1	3300050494	Bacteria	2886
391	nmdc:mga06z11_73055_c1	3300050494	Bacteria	1820
392	nmdc:mga04h51_2525_c1	3300050495	Bacteria	4357
393	nmdc:mga07m45_1959_c1	3300050496	Bacteria	9525
394	nmdc:mga07m45_22516_c1	3300050496	Bacteria	3440
395	nmdc:mga07m45_2619_c1	3300050496	Bacteria	8477
396	nmdc:mga07m45_30770_c1	3300050496	Bacteria	2974
397	nmdc:mga07m45_9226_c1	3300050496	Bacteria	3748
398	nmdc:mga07m45_9320_c1	3300050496	Bacteria	3055
399	nmdc:mga05p37_36536_c1	3300050507	Bacteria	6026
400	nmdc:mga0sz30_1358_c1	3300050516	Bacteria	8743
401	nmdc:mga0sz30_16528_c1	3300050516	Bacteria	2932
402	nmdc:mga0sz30_40998_c1	3300050516	Bacteria	1946
403	nmdc:mga0sz30_5429_c1	3300050516	Bacteria	4677
404	Ga0500635_0001043	3300053080	Bacteria	6628
405	Ga0500652_000103	3300053131	Bacteria	33562
406	Ga0466962_0092934	3300061719	Bacteria	1446

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300048903	Ga0496100_0124558	Ga0496100_0124558_10_1179	380
2	3300014745	Ga0157377_10007055	Ga0157377_100070556	399
3	3300037853	Ga0436364_1325339	Ga0436364_1325339_9879_11120	412
4	3300044693	Ga0466961_0022720	Ga0466961_0022720_1916_3349	422
5	3300044842	Ga0466957_0022367	Ga0466957_0022367_708_2141	422
6	3300045049	Ga0466959_0104000	Ga0466959_0104000_216_1649	422
7	3300045836	Ga0466958_0032916	Ga0466958_0032916_1415_2848	422
8	3300046533	Ga0495640_0011274	Ga0495640_0011274_25_1302	425
9	3300005330	Ga0070690_100008096	Ga0070690_1000080963	428
10	3300047472	Ga0495686_0005608	Ga0495686_0005608_1801_3099	430
11	3300053080	Ga0500635_0001043	Ga0500635_0001043_4913_6271	438
12	3300053131	Ga0500652_000103	Ga0500652_000103_2095_3453	438
13	3300049823	Ga0501044_0173701	Ga0501044_0173701_346_1692	447
14	3300039437	Ga0436365_0161820	Ga0436365_0161820_17949_19301	448
15	3300044842	Ga0466957_0024642	Ga0466957_0024642_2101_3450	448
16	3300044901	Ga0466960_0000316	Ga0466960_0000316_11025_12374	448
17	3300045836	Ga0466958_0040004	Ga0466958_0040004_1354_2703	448
18	3300045976	Ga0466967_0001731	Ga0466967_0001731_4058_5407	448
19	3300061719	Ga0466962_0092934	Ga0466962_0092934_27_1376	448
20	3300014325	Ga0163163_10123565	Ga0163163_101235652	449
21	3300041410	Ga0439461_0000402	Ga0439461_0000402_2943_4298	449
22	3300041997	Ga0439431_0001879	Ga0439431_0001879_160_1515	449
23	3300050489	nmdc:mga03683_21080_c1	nmdc:mga03683_21080_c1_249_1604	449
24	3300050491	nmdc:mga00v17_17554_c1	nmdc:mga00v17_17554_c1_1706_3061	449
25	3300005354	Ga0070675_100114181	Ga0070675_1001141812	450
26	3300005578	Ga0068854_100159321	Ga0068854_1001593211	450
27	3300005841	Ga0068863_100284390	Ga0068863_1002843902	450
28	3300009553	Ga0105249_10040169	Ga0105249_100401693	450
29	3300009553	Ga0105249_10060452	Ga0105249_100604522	450
30	3300013296	Ga0157374_10183785	Ga0157374_101837851	450
31	3300013297	Ga0157378_10128746	Ga0157378_101287462	450
32	3300013306	Ga0163162_10035354	Ga0163162_100353542	450
33	3300013306	Ga0163162_10061612	Ga0163162_100616123	450
34	3300013308	Ga0157375_10062021	Ga0157375_100620212	450
35	3300025938	Ga0207704_10041809	Ga0207704_100418093	450
36	3300025940	Ga0207691_10045932	Ga0207691_100459323	450
37	3300026088	Ga0207641_10218318	Ga0207641_102183182	450
38	3300028379	Ga0268266_10032575	Ga0268266_100325752	450
39	3300041411	Ga0439466_0005387	Ga0439466_0005387_2896_4254	450
40	3300041413	Ga0439465_0009908	Ga0439465_0009908_1499_2857	450
41	3300041413	Ga0439465_0017740	Ga0439465_0017740_294_1652	450
42	3300042002	Ga0439442_004120	Ga0439442_004120_1081_2439	450
43	3300044842	Ga0466957_0055218	Ga0466957_0055218_33_1391	450
44	3300045976	Ga0466967_0114497	Ga0466967_0114497_30_1388	450
45	3300048905	Ga0496102_0019743	Ga0496102_0019743_852_2210	450
46	3300048905	Ga0496102_0156207	Ga0496102_0156207_159_1517	450
47	3300048907	Ga0496104_0013774	Ga0496104_0013774_4266_5624	450
48	3300048909	Ga0496106_0012431	Ga0496106_0012431_4461_5819	450
49	3300048911	Ga0496108_0000811	Ga0496108_0000811_15354_16712	450
50	3300048911	Ga0496108_0044732	Ga0496108_0044732_2317_3675	450
51	3300048913	Ga0496110_0023809	Ga0496110_0023809_2116_3474	450
52	3300048913	Ga0496110_0070938	Ga0496110_0070938_1433_2791	450
53	3300048915	Ga0496112_0006634	Ga0496112_0006634_2503_3861	450
54	3300048915	Ga0496112_0028958	Ga0496112_0028958_1166_2524	450
55	3300048916	Ga0496113_0081947	Ga0496113_0081947_367_1725	450
56	3300050490	nmdc:mga03n38_9496_c1	nmdc:mga03n38_9496_c1_2073_3431	450
57	3300050492	nmdc:mga0yw44_20560_c1	nmdc:mga0yw44_20560_c1_1466_2824	450
58	3300026118	Ga0207675_100037141	Ga0207675_1000371412	453
59	3300021384	Ga0213876_10011239	Ga0213876_100112392	458
60	3300039437	Ga0436365_1377767	Ga0436365_1377767_37864_39273	458
61	3300050489	nmdc:mga03683_29167_c1	nmdc:mga03683_29167_c1_13_1389	458
62	3300049571	Ga0501034_0004016	Ga0501034_0004016_12700_14082	459
63	3300049573	Ga0501037_0004758	Ga0501037_0004758_522_1904	459
64	3300049574	Ga0501038_0060688	Ga0501038_0060688_1584_2966	459
65	3300049581	Ga0501047_0002041	Ga0501047_0002041_16885_18267	459
66	3300049582	Ga0501048_0001321	Ga0501048_0001321_16614_17996	459
67	3300049585	Ga0501069_0049494	Ga0501069_0049494_271_1653	459
68	3300049586	Ga0501070_0005341	Ga0501070_0005341_3667_5049	459
69	3300049742	Ga0501080_0076144	Ga0501080_0076144_501_1883	459
70	3300049822	Ga0501035_0007357	Ga0501035_0007357_3536_4918	459
71	3300049823	Ga0501044_0007519	Ga0501044_0007519_3434_4816	459
72	3300006038	Ga0075365_10000611	Ga0075365_100006115	460
73	3300006042	Ga0075368_10003749	Ga0075368_100037493	460
74	3300006048	Ga0075363_100000524	Ga0075363_10000052410	460
75	3300006177	Ga0075362_10021516	Ga0075362_100215161	460
76	3300006353	Ga0075370_10006321	Ga0075370_100063213	460
77	3300050494	nmdc:mga06z11_73055_c1	nmdc:mga06z11_73055_c1_21_1421	460
78	3300049571	Ga0501034_0087026	Ga0501034_0087026_993_2384	461
79	3300050489	nmdc:mga03683_26141_c1	nmdc:mga03683_26141_c1_59_1450	461
80	3300050516	nmdc:mga0sz30_16528_c1	nmdc:mga0sz30_16528_c1_1503_2894	461
81	3300031824	Ga0307413_10094418	Ga0307413_100944182	463
82	3300031995	Ga0307409_100007735	Ga0307409_1000077355	463
83	3300032002	Ga0307416_100046373	Ga0307416_1000463732	463
84	3300049586	Ga0501070_0030545	Ga0501070_0030545_418_1836	463
85	3300049589	Ga0501073_0147251	Ga0501073_0147251_138_1556	463
86	3300005367	Ga0070667_100037531	Ga0070667_1000375312	464
87	3300009553	Ga0105249_10039655	Ga0105249_100396552	464
88	3300025961	Ga0207712_10100046	Ga0207712_101000462	464
89	3300048911	Ga0496108_0100353	Ga0496108_0100353_1008_2435	464
90	3300048915	Ga0496112_0074413	Ga0496112_0074413_881_2308	464
91	3300005578	Ga0068854_100077359	Ga0068854_1000773592	465
92	3300037853	Ga0436364_1022764	Ga0436364_1022764_3339_4739	465
93	iso_pu_bacteria	2643221715	2644638727	465
94	iso_pu_bacteria	2902810491	2902811383	465
95	3300005337	Ga0070682_100010626	Ga0070682_1000106266	466
96	3300005455	Ga0070663_100074335	Ga0070663_1000743352	466
97	3300006048	Ga0075363_100041119	Ga0075363_1000411193	466
98	3300026067	Ga0207678_10009940	Ga0207678_100099403	466
99	iso_pu_bacteria	2929212328	2929212633	466
100	3300009177	Ga0105248_10077932	Ga0105248_100779322	467
101	3300013308	Ga0157375_10172747	Ga0157375_101727473	467
102	3300026075	Ga0207708_10119537	Ga0207708_101195371	467
103	3300031903	Ga0307407_10087842	Ga0307407_100878421	467
104	3300031911	Ga0307412_10162293	Ga0307412_101622932	467
105	3300031995	Ga0307409_100016168	Ga0307409_1000161686	467
106	3300048903	Ga0496100_0023897	Ga0496100_0023897_1414_2817	467
107	3300048904	Ga0496101_0010068	Ga0496101_0010068_4014_5417	467
108	3300048907	Ga0496104_0189065	Ga0496104_0189065_418_1821	467
109	3300048910	Ga0496107_0021513	Ga0496107_0021513_2837_4240	467
110	3300048917	Ga0496114_0009471	Ga0496114_0009471_801_2204	467
111	3300003792	Ga0055540_1007940	Ga0055540_10079402	468
112	3300005843	Ga0068860_100066688	Ga0068860_1000666883	468
113	3300006038	Ga0075365_10097396	Ga0075365_100973962	468
114	3300006051	Ga0075364_10008437	Ga0075364_100084372	468
115	3300006051	Ga0075364_10098149	Ga0075364_100981492	468
116	3300021384	Ga0213876_10003462	Ga0213876_100034625	468
117	3300026118	Ga0207675_100022230	Ga0207675_1000222303	468
118	3300048921	Ga0496118_0000652	Ga0496118_0000652_27707_29116	468
119	3300048929	Ga0496126_0002449	Ga0496126_0002449_14769_16178	468
120	3300050491	nmdc:mga00v17_25510_c1	nmdc:mga00v17_25510_c1_1893_3332	468
121	3300006038	Ga0075365_10000414	Ga0075365_1000041411	469
122	3300006048	Ga0075363_100037012	Ga0075363_1000370122	469
123	3300006051	Ga0075364_10122904	Ga0075364_101229042	469
124	3300006186	Ga0075369_10069200	Ga0075369_100692002	469
125	3300006353	Ga0075370_10012981	Ga0075370_100129813	469
126	3300006353	Ga0075370_10072928	Ga0075370_100729282	469
127	3300041411	Ga0439466_0014610	Ga0439466_0014610_1124_2539	469
128	3300041413	Ga0439465_0013662	Ga0439465_0013662_1055_2470	469
129	3300041413	Ga0439465_0015287	Ga0439465_0015287_816_2231	469
130	3300042004	Ga0439445_0002577	Ga0439445_0002577_615_2030	469
131	3300042435	Ga0439434_0001418	Ga0439434_0001418_1865_3280	469
132	3300044658	Ga0466972_0014776	Ga0466972_0014776_808_2247	469
133	3300044683	Ga0466965_0006499	Ga0466965_0006499_808_2247	469
134	3300044842	Ga0466957_0017461	Ga0466957_0017461_1230_2669	469
135	3300045976	Ga0466967_0068009	Ga0466967_0068009_647_2086	469
136	3300048915	Ga0496112_0048585	Ga0496112_0048585_1983_3422	469
137	3300048916	Ga0496113_0046115	Ga0496113_0046115_1472_2911	469
138	3300048926	Ga0496123_0029809	Ga0496123_0029809_498_1937	469
139	3300050492	nmdc:mga0yw44_9170_c1	nmdc:mga0yw44_9170_c1_2385_3800	469
140	3300050494	nmdc:mga06z11_23712_c1	nmdc:mga06z11_23712_c1_517_1932	469
141	3300050496	nmdc:mga07m45_9320_c1	nmdc:mga07m45_9320_c1_144_1559	469
142	3300050516	nmdc:mga0sz30_40998_c1	nmdc:mga0sz30_40998_c1_235_1650	469
143	3300002077	JGI24744J21845_10004280	JGI24744J21845_100042802	470
144	3300003792	Ga0055540_1000102	Ga0055540_100010277	470
145	3300005335	Ga0070666_10068818	Ga0070666_100688182	470
146	3300005355	Ga0070671_100053998	Ga0070671_1000539982	470
147	3300005367	Ga0070667_100000266	Ga0070667_1000002663	470
148	3300005437	Ga0070710_10000779	Ga0070710_1000077911	470
149	3300005439	Ga0070711_100003202	Ga0070711_1000032021	470
150	3300005441	Ga0070700_100023712	Ga0070700_1000237123	470
151	3300005459	Ga0068867_100161814	Ga0068867_1001618142	470
152	3300005546	Ga0070696_100112524	Ga0070696_1001125242	470
153	3300005548	Ga0070665_100003028	Ga0070665_1000030289	470
154	3300005718	Ga0068866_10013211	Ga0068866_100132113	470
155	3300005841	Ga0068863_100098436	Ga0068863_1000984362	470
156	3300005842	Ga0068858_100089431	Ga0068858_1000894312	470
157	3300006038	Ga0075365_10005689	Ga0075365_100056895	470
158	3300006038	Ga0075365_10015906	Ga0075365_100159062	470
159	3300006048	Ga0075363_100000840	Ga0075363_1000008405	470
160	3300006051	Ga0075364_10014135	Ga0075364_100141353	470
161	3300006173	Ga0070716_100047173	Ga0070716_1000471732	470
162	3300006175	Ga0070712_100003368	Ga0070712_1000033683	470
163	3300006178	Ga0075367_10010176	Ga0075367_100101764	470
164	3300006186	Ga0075369_10005644	Ga0075369_100056444	470
165	3300006353	Ga0075370_10005284	Ga0075370_100052842	470
166	3300006353	Ga0075370_10005874	Ga0075370_100058743	470
167	3300009545	Ga0105237_10003621	Ga0105237_100036214	470
168	3300010375	Ga0105239_10076676	Ga0105239_100766763	470
169	3300025303	Ga0209051_1000116	Ga0209051_10001169	470
170	3300025901	Ga0207688_10004582	Ga0207688_100045827	470
171	3300025903	Ga0207680_10044696	Ga0207680_100446962	470
172	3300025914	Ga0207671_10003961	Ga0207671_1000396110	470
173	3300025939	Ga0207665_10003491	Ga0207665_100034916	470
174	3300025942	Ga0207689_10062951	Ga0207689_100629512	470
175	3300025986	Ga0207658_10000206	Ga0207658_1000020614	470
176	3300025986	Ga0207658_10012849	Ga0207658_100128493	470
177	3300025986	Ga0207658_10060814	Ga0207658_100608142	470
178	3300026075	Ga0207708_10017005	Ga0207708_100170052	470
179	3300026088	Ga0207641_10080026	Ga0207641_100800262	470
180	3300026121	Ga0207683_10044704	Ga0207683_100447044	470
181	3300031251	Ga0265327_10001906	Ga0265327_1000190615	470
182	3300031824	Ga0307413_10021540	Ga0307413_100215402	470
183	3300031852	Ga0307410_10042297	Ga0307410_100422972	470
184	3300035692	Ga0373935_0113450	Ga0373935_0113450_255_1673	470
185	3300042005	Ga0439448_0001539	Ga0439448_0001539_2361_3779	470
186	3300044683	Ga0466965_0004542	Ga0466965_0004542_1586_3004	470
187	3300044683	Ga0466965_0032716	Ga0466965_0032716_712_2130	470
188	3300044901	Ga0466960_0000489	Ga0466960_0000489_8902_10320	470
189	3300046459	Ga0495629_0065718	Ga0495629_0065718_403_1821	470
190	3300046476	Ga0495662_0019278	Ga0495662_0019278_1649_3067	470
191	3300047673	Ga0495593_0012355	Ga0495593_0012355_618_2036	470
192	3300048903	Ga0496100_0000095	Ga0496100_0000095_11007_12425	470
193	3300048904	Ga0496101_0000027	Ga0496101_0000027_168029_169447	470
194	3300048905	Ga0496102_0092052	Ga0496102_0092052_1158_2576	470
195	3300048906	Ga0496103_0000226	Ga0496103_0000226_29311_30729	470
196	3300048909	Ga0496106_0000413	Ga0496106_0000413_16910_18328	470
197	3300048910	Ga0496107_0009910	Ga0496107_0009910_1581_2999	470
198	3300048911	Ga0496108_0004308	Ga0496108_0004308_2963_4381	470
199	3300048911	Ga0496108_0057797	Ga0496108_0057797_1245_2663	470
200	3300048912	Ga0496109_0000407	Ga0496109_0000407_33363_34781	470
201	3300048912	Ga0496109_0007888	Ga0496109_0007888_1025_2443	470
202	3300048913	Ga0496110_0003553	Ga0496110_0003553_9650_11068	470
203	3300048913	Ga0496110_0070109	Ga0496110_0070109_1182_2600	470
204	3300048915	Ga0496112_0144683	Ga0496112_0144683_387_1805	470
205	3300048917	Ga0496114_0000282	Ga0496114_0000282_19828_21246	470
206	3300048918	Ga0496115_0027477	Ga0496115_0027477_645_2063	470
207	3300048919	Ga0496116_0002036	Ga0496116_0002036_10872_12290	470
208	3300048920	Ga0496117_0005400	Ga0496117_0005400_1158_2576	470
209	3300048921	Ga0496118_0039296	Ga0496118_0039296_104_1522	470
210	3300048922	Ga0496119_0001985	Ga0496119_0001985_3301_4719	470
211	3300048923	Ga0496120_0004741	Ga0496120_0004741_3344_4762	470
212	3300048924	Ga0496121_0000004	Ga0496121_0000004_912051_913469	470
213	3300048925	Ga0496122_0000763	Ga0496122_0000763_27436_28854	470
214	3300048927	Ga0496124_0000030	Ga0496124_0000030_124390_125808	470
215	3300048928	Ga0496125_0000003	Ga0496125_0000003_276299_277717	470
216	3300048929	Ga0496126_0000001	Ga0496126_0000001_912051_913469	470
217	3300049573	Ga0501037_0000645	Ga0501037_0000645_24101_25543	470
218	3300049574	Ga0501038_0010650	Ga0501038_0010650_1343_2785	470
219	3300049575	Ga0501039_0002406	Ga0501039_0002406_6537_7979	470
220	3300049579	Ga0501043_0001211	Ga0501043_0001211_20855_22297	470
221	3300049589	Ga0501073_0029074	Ga0501073_0029074_1899_3341	470
222	3300049823	Ga0501044_0034441	Ga0501044_0034441_2193_3635	470
223	3300050490	nmdc:mga03n38_617_c1	nmdc:mga03n38_617_c1_596_2038	470
224	3300050491	nmdc:mga00v17_2026_c1	nmdc:mga00v17_2026_c1_8792_10234	470
225	3300050496	nmdc:mga07m45_1959_c1	nmdc:mga07m45_1959_c1_5190_6632	470
226	3300050507	nmdc:mga05p37_36536_c1	nmdc:mga05p37_36536_c1_1624_3039	470
227	iso_pu_bacteria	2929212328	2929214966	470
228	3300044684	Ga0466966_0007457	Ga0466966_0007457_1812_3230	471
229	3300044735	Ga0466968_0003609	Ga0466968_0003609_2089_3507	471
230	3300045049	Ga0466959_0012304	Ga0466959_0012304_4010_5428	471
231	3300006048	Ga0075363_100003923	Ga0075363_1000039236	472
232	3300006051	Ga0075364_10001330	Ga0075364_1000133011	472
233	3300006353	Ga0075370_10013204	Ga0075370_100132043	472
234	3300027866	Ga0209813_10002604	Ga0209813_100026044	472
235	3300050491	nmdc:mga00v17_20812_c1	nmdc:mga00v17_20812_c1_816_2252	472
236	3300050492	nmdc:mga0yw44_1905_c1	nmdc:mga0yw44_1905_c1_3521_4957	472
237	3300050495	nmdc:mga04h51_2525_c1	nmdc:mga04h51_2525_c1_220_1656	472
238	3300050496	nmdc:mga07m45_2619_c1	nmdc:mga07m45_2619_c1_6880_8316	472
239	3300050496	nmdc:mga07m45_9226_c1	nmdc:mga07m45_9226_c1_101_1537	472
240	3300037853	Ga0436364_0483639	Ga0436364_0483639_1318_2739	473
241	iso_pu_bacteria	2643221687	2644486409	473
242	iso_pu_bacteria	2902837492	2902840174	473
243	3300021388	Ga0213875_10035136	Ga0213875_100351362	474
244	3300002074	JGI24748J21848_1003748	JGI24748J21848_10037482	475
245	3300002077	JGI24744J21845_10000411	JGI24744J21845_100004113	475
246	3300002244	JGI24742J22300_10000708	JGI24742J22300_100007084	475
247	3300005328	Ga0070676_10004577	Ga0070676_100045777	475
248	3300005334	Ga0068869_100023638	Ga0068869_1000236383	475
249	3300005337	Ga0070682_100010307	Ga0070682_1000103072	475
250	3300005338	Ga0068868_100004288	Ga0068868_10000428813	475
251	3300005340	Ga0070689_100086358	Ga0070689_1000863582	475
252	3300005341	Ga0070691_10043037	Ga0070691_100430372	475
253	3300005347	Ga0070668_100000721	Ga0070668_10000072123	475
254	3300005353	Ga0070669_100002794	Ga0070669_1000027942	475
255	3300005356	Ga0070674_100012853	Ga0070674_1000128533	475
256	3300005367	Ga0070667_100001170	Ga0070667_10000117011	475
257	3300005438	Ga0070701_10000490	Ga0070701_100004906	475
258	3300005439	Ga0070711_100000647	Ga0070711_10000064718	475
259	3300005440	Ga0070705_100001755	Ga0070705_10000175510	475
260	3300005441	Ga0070700_100001433	Ga0070700_1000014339	475
261	3300005456	Ga0070678_100000061	Ga0070678_10000006136	475
262	3300005457	Ga0070662_100002954	Ga0070662_1000029542	475
263	3300005459	Ga0068867_100004485	Ga0068867_1000044857	475
264	3300005530	Ga0070679_100202518	Ga0070679_1002025181	475
265	3300005539	Ga0068853_100002938	Ga0068853_1000029386	475
266	3300005543	Ga0070672_100079309	Ga0070672_1000793092	475
267	3300005545	Ga0070695_100010220	Ga0070695_1000102205	475
268	3300005548	Ga0070665_100001918	Ga0070665_10000191818	475
269	3300005548	Ga0070665_100020711	Ga0070665_1000207113	475
270	3300005549	Ga0070704_100018226	Ga0070704_1000182263	475
271	3300005578	Ga0068854_100004628	Ga0068854_1000046283	475
272	3300005614	Ga0068856_100183325	Ga0068856_1001833251	475
273	3300005615	Ga0070702_100000241	Ga0070702_10000024111	475
274	3300005616	Ga0068852_100038316	Ga0068852_1000383161	475
275	3300005617	Ga0068859_100001872	Ga0068859_10000187218	475
276	3300005718	Ga0068866_10000351	Ga0068866_1000035117	475
277	3300005719	Ga0068861_100000122	Ga0068861_1000001227	475
278	3300005842	Ga0068858_100011223	Ga0068858_1000112238	475
279	3300005843	Ga0068860_100001605	Ga0068860_10000160523	475
280	3300005844	Ga0068862_100019588	Ga0068862_1000195883	475
281	3300005937	Ga0081455_10081624	Ga0081455_100816242	475
282	3300006038	Ga0075365_10002297	Ga0075365_100022972	475
283	3300006173	Ga0070716_100018357	Ga0070716_1000183573	475
284	3300006177	Ga0075362_10009107	Ga0075362_100091072	475
285	3300006186	Ga0075369_10003726	Ga0075369_100037262	475
286	3300006186	Ga0075369_10013630	Ga0075369_100136304	475
287	3300006353	Ga0075370_10013139	Ga0075370_100131392	475
288	3300006353	Ga0075370_10051617	Ga0075370_100516172	475
289	3300006881	Ga0068865_100000197	Ga0068865_10000019715	475
290	3300006931	Ga0097620_100001872	Ga0097620_10000187218	475
291	3300009098	Ga0105245_10004240	Ga0105245_100042406	475
292	3300009101	Ga0105247_10000456	Ga0105247_1000045634	475
293	3300009176	Ga0105242_10002141	Ga0105242_1000214114	475
294	3300009177	Ga0105248_10002640	Ga0105248_100026408	475
295	3300009553	Ga0105249_10001439	Ga0105249_100014394	475
296	3300010375	Ga0105239_10007153	Ga0105239_100071537	475
297	3300013297	Ga0157378_10001662	Ga0157378_1000166210	475
298	3300013306	Ga0163162_10012011	Ga0163162_100120119	475
299	3300013308	Ga0157375_10119165	Ga0157375_101191652	475
300	3300014326	Ga0157380_10002545	Ga0157380_1000254512	475
301	3300014745	Ga0157377_10067939	Ga0157377_100679391	475
302	3300014968	Ga0157379_10002932	Ga0157379_100029326	475
303	3300017792	Ga0163161_10075889	Ga0163161_100758892	475
304	3300025898	Ga0207692_10001070	Ga0207692_100010706	475
305	3300025899	Ga0207642_10007227	Ga0207642_100072273	475
306	3300025900	Ga0207710_10003936	Ga0207710_100039363	475
307	3300025901	Ga0207688_10003984	Ga0207688_100039843	475
308	3300025915	Ga0207693_10000189	Ga0207693_1000018937	475
309	3300025923	Ga0207681_10010501	Ga0207681_100105014	475
310	3300025927	Ga0207687_10035636	Ga0207687_100356363	475
311	3300025932	Ga0207690_10151847	Ga0207690_101518472	475
312	3300025933	Ga0207706_10001089	Ga0207706_100010895	475
313	3300025936	Ga0207670_10112153	Ga0207670_101121532	475
314	3300025937	Ga0207669_10001796	Ga0207669_100017963	475
315	3300025938	Ga0207704_10002044	Ga0207704_100020447	475
316	3300025939	Ga0207665_10002245	Ga0207665_100022453	475
317	3300025941	Ga0207711_10008877	Ga0207711_100088777	475
318	3300025942	Ga0207689_10032252	Ga0207689_100322523	475
319	3300025961	Ga0207712_10014862	Ga0207712_100148622	475
320	3300025986	Ga0207658_10006396	Ga0207658_100063966	475
321	3300025986	Ga0207658_10027840	Ga0207658_100278401	475
322	3300026023	Ga0207677_10029537	Ga0207677_100295372	475
323	3300026035	Ga0207703_10043833	Ga0207703_100438333	475
324	3300026041	Ga0207639_10003832	Ga0207639_100038322	475
325	3300026075	Ga0207708_10000429	Ga0207708_1000042928	475
326	3300026088	Ga0207641_10001669	Ga0207641_100016693	475
327	3300026089	Ga0207648_10001727	Ga0207648_1000172721	475
328	3300026118	Ga0207675_100000325	Ga0207675_10000032511	475
329	3300026121	Ga0207683_10000161	Ga0207683_100001613	475
330	3300028379	Ga0268266_10008107	Ga0268266_100081078	475
331	3300028380	Ga0268265_10063752	Ga0268265_100637521	475
332	3300028381	Ga0268264_10034360	Ga0268264_100343603	475
333	3300035691	Ga0373931_0016591	Ga0373931_0016591_1654_3081	475
334	3300039437	Ga0436365_1508640	Ga0436365_1508640_3501_4931	475
335	3300041411	Ga0439466_0007942	Ga0439466_0007942_1804_3231	475
336	3300041413	Ga0439465_0010087	Ga0439465_0010087_1258_2685	475
337	3300044658	Ga0466972_0016996	Ga0466972_0016996_1194_2621	475
338	3300048903	Ga0496100_0011445	Ga0496100_0011445_746_2173	475
339	3300048904	Ga0496101_0017804	Ga0496101_0017804_623_2050	475
340	3300048905	Ga0496102_0072755	Ga0496102_0072755_1445_2872	475
341	3300048906	Ga0496103_0001967	Ga0496103_0001967_2666_4093	475
342	3300048907	Ga0496104_0024408	Ga0496104_0024408_35_1462	475
343	3300048908	Ga0496105_0048598	Ga0496105_0048598_957_2384	475
344	3300048909	Ga0496106_0001172	Ga0496106_0001172_17189_18616	475
345	3300048910	Ga0496107_0002822	Ga0496107_0002822_1358_2785	475
346	3300048913	Ga0496110_0048417	Ga0496110_0048417_30_1457	475
347	3300048917	Ga0496114_0000849	Ga0496114_0000849_832_2259	475
348	3300048918	Ga0496115_0005557	Ga0496115_0005557_2875_4302	475
349	3300049586	Ga0501070_0141842	Ga0501070_0141842_225_1664	475
350	3300050496	nmdc:mga07m45_22516_c1	nmdc:mga07m45_22516_c1_845_2272	475
351	3300050496	nmdc:mga07m45_30770_c1	nmdc:mga07m45_30770_c1_342_1769	475
352	3300050516	nmdc:mga0sz30_5429_c1	nmdc:mga0sz30_5429_c1_813_2240	475
353	3300046460	Ga0495638_0007018	Ga0495638_0007018_6578_8008	476
354	3300050492	nmdc:mga0yw44_102024_c1	nmdc:mga0yw44_102024_c1_187_1617	476
355	3300003792	Ga0055540_1002874	Ga0055540_10028746	477
356	3300003792	Ga0055540_1010196	Ga0055540_10101962	477
357	3300025303	Ga0209051_1000374	Ga0209051_100037419	477
358	3300025303	Ga0209051_1001965	Ga0209051_100196514	477
359	3300025303	Ga0209051_1023839	Ga0209051_10238392	477
360	3300025937	Ga0207669_10012776	Ga0207669_100127763	477
361	3300041452	Ga0451793_0921930	Ga0451793_0921930_224_1663	477
362	3300044693	Ga0466961_0009448	Ga0466961_0009448_4729_6168	477
363	3300044735	Ga0466968_0006046	Ga0466968_0006046_1110_2549	477
364	3300044842	Ga0466957_0002695	Ga0466957_0002695_6784_8223	477
365	3300045049	Ga0466959_0015120	Ga0466959_0015120_2040_3479	477
366	3300045836	Ga0466958_0008737	Ga0466958_0008737_1079_2518	477
367	3300049586	Ga0501070_0012413	Ga0501070_0012413_1551_2984	477
368	3300005719	Ga0068861_100083138	Ga0068861_1000831382	478
369	3300009092	Ga0105250_10013511	Ga0105250_100135112	478
370	3300009098	Ga0105245_10064525	Ga0105245_100645253	478
371	3300009553	Ga0105249_10098570	Ga0105249_100985702	478
372	3300011119	Ga0105246_10021988	Ga0105246_100219883	478
373	3300013306	Ga0163162_10003575	Ga0163162_1000357516	478
374	3300013306	Ga0163162_10170849	Ga0163162_101708492	478
375	3300013307	Ga0157372_10218207	Ga0157372_102182071	478
376	3300013308	Ga0157375_10076033	Ga0157375_100760332	478
377	3300025937	Ga0207669_10087619	Ga0207669_100876192	478
378	3300042435	Ga0439434_0012280	Ga0439434_0012280_14_1450	478
379	3300047320	Ga0495672_0070628	Ga0495672_0070628_327_1763	478
380	3300047320	Ga0495672_0084506	Ga0495672_0084506_44_1480	478
381	3300048911	Ga0496108_0011577	Ga0496108_0011577_220_1656	478
382	3300048911	Ga0496108_0044412	Ga0496108_0044412_2016_3452	478
383	3300048911	Ga0496108_0077773	Ga0496108_0077773_598_2034	478
384	3300048912	Ga0496109_0020648	Ga0496109_0020648_503_1939	478
385	3300048913	Ga0496110_0025551	Ga0496110_0025551_1305_2741	478
386	3300050516	nmdc:mga0sz30_1358_c1	nmdc:mga0sz30_1358_c1_3187_4623	478
387	3300045976	Ga0466967_0109515	Ga0466967_0109515_624_2063	479
388	3300046455	Ga0495603_0010830	Ga0495603_0010830_704_2143	479
389	3300046459	Ga0495629_0054386	Ga0495629_0054386_596_2035	479
390	3300047673	Ga0495593_0004154	Ga0495593_0004154_3459_4898	479
391	3300006038	Ga0075365_10056281	Ga0075365_100562812	481
392	3300050492	nmdc:mga0yw44_34980_c1	nmdc:mga0yw44_34980_c1_276_1721	481
393	iso_pu_bacteria	2842134933	2842138404	484
394	3300006186	Ga0075369_10003185	Ga0075369_100031855	491
395	3300001977	JGI24746J21847_1001885	JGI24746J21847_10018852	495
396	3300002077	JGI24744J21845_10003095	JGI24744J21845_100030952	495
397	3300005340	Ga0070689_100138008	Ga0070689_1001380082	495
398	3300005341	Ga0070691_10055032	Ga0070691_100550322	495
399	3300005366	Ga0070659_100061561	Ga0070659_1000615615	495
400	3300005455	Ga0070663_100123896	Ga0070663_1001238962	495
401	3300005456	Ga0070678_100135730	Ga0070678_1001357302	495
402	3300005459	Ga0068867_100184496	Ga0068867_1001844961	495
403	3300005548	Ga0070665_100040130	Ga0070665_1000401305	495
404	3300005578	Ga0068854_100115392	Ga0068854_1001153922	495
405	3300005617	Ga0068859_100091820	Ga0068859_1000918205	495
406	3300005842	Ga0068858_100026412	Ga0068858_1000264123	495
407	3300006931	Ga0097620_100091816	Ga0097620_1000918165	495
408	3300013296	Ga0157374_10068634	Ga0157374_100686342	495
409	3300017792	Ga0163161_10136675	Ga0163161_101366752	495
410	3300025942	Ga0207689_10095011	Ga0207689_100950112	495
411	3300026041	Ga0207639_10186064	Ga0207639_101860641	495
412	3300026118	Ga0207675_100118041	Ga0207675_1001180411	495
413	3300026121	Ga0207683_10094043	Ga0207683_100940432	495

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06974

WS_DGAT_C

WS/DGAT C-terminal domain

339

488

0.97 PF03007

WS_DGAT_cat

Wax ester synthase/diacylglycerol acyltransferase catalytic domain

37

300

0.89 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
7nxg-assembly1.cif.gz_A-2	wax synthase 1 from acinetobacter baylyi (abwsd1) co-crystallized with myristic acid	0.7776	18	476
6chj-assembly1.cif.gz_A	wax ester synthase/diacylglycerol acyltransferase from marinobacter aquaeolei vt8	0.7673	21	477
7nxg-assembly1.cif.gz_A-2	wax synthase 1 from acinetobacter baylyi (abwsd1) co-crystallized with myristic acid	0.7626	18	476
6chj-assembly1.cif.gz_A	wax ester synthase/diacylglycerol acyltransferase from marinobacter aquaeolei vt8	0.7619	21	477
6chj-assembly1.cif.gz_B	wax ester synthase/diacylglycerol acyltransferase from marinobacter aquaeolei vt8	0.7541	21	477

ID	Description	Score	Start	End	Superfamily
af_P9WKB7_4_263_3.30.559.10	Alpha Beta;2-Layer Sandwich;Chloramphenicol Acetyltransferase;Chloramphenicol acetyltransferase-like domain	0.9085	21	282	3.30.559.10
af_P9WKB7_4_263_3.30.559.10	Alpha Beta;2-Layer Sandwich;Chloramphenicol Acetyltransferase;Chloramphenicol acetyltransferase-like domain	0.8985	21	282	3.30.559.10
af_P9WKB9_34_203_3.30.559.10	Alpha Beta;2-Layer Sandwich;Chloramphenicol Acetyltransferase;Chloramphenicol acetyltransferase-like domain	0.889	18	180	3.30.559.10
af_P9WKB1_4_268_3.30.559.10	Alpha Beta;2-Layer Sandwich;Chloramphenicol Acetyltransferase;Chloramphenicol acetyltransferase-like domain	0.8798	21	282	3.30.559.10
af_P9WKB1_4_268_3.30.559.10	Alpha Beta;2-Layer Sandwich;Chloramphenicol Acetyltransferase;Chloramphenicol acetyltransferase-like domain	0.8673	21	282	3.30.559.10

ID	Description	Score	Start	End	GO Terms
AF-A0A1X0JPG0-F1-model_v4	Diacylglycerol O-acyltransferase (EC 2.3.1.20)	0.9659	20	477	GO:0001666 GO:0004144 GO:0005886 GO:0006071 GO:0019432 GO:0051701 GO:0071731
AF-A0A0Q9K492-F1-model_v4	deleted	0.9642	20	495
AF-A0A0Q9K492-F1-model_v4	deleted	0.9582	20	495
AF-A0A1X0JPG0-F1-model_v4	Diacylglycerol O-acyltransferase (EC 2.3.1.20)	0.9556	20	477	GO:0001666 GO:0004144 GO:0005886 GO:0006071 GO:0019432 GO:0051701 GO:0071731
AF-A0A1X1TMP5-F1-model_v4	Diacylglycerol O-acyltransferase (EC 2.3.1.20)	0.947	20	486	GO:0001666 GO:0004144 GO:0005886 GO:0006071 GO:0019432 GO:0051701 GO:0071731

Feature Viewer

pLDDT	pTM	Quality
85.82	0.87	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F437984

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF06974

WS_DGAT_C

WS/DGAT C-terminal domain

339

488

0.97

PF03007

WS_DGAT_cat

Wax ester synthase/diacylglycerol acyltransferase catalytic domain

37

300

0.89

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map