F437947

General Info

Members Datasets Scaffolds Average Seq Length
412 273 354 496

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2939598168|2939599129
Length 583
Sequence WRQRVFTCWRTTTARPKSMLGQEATSPSRSLPRWWHQRLAIQAKLRGTPQSLTAHRGSYLMCPSWPTPAGPHQSDLKKAFAEPSSGSGTTFSPFAANRPWKWGNSLSEDANWRRRSSRRLRSVDAFVVIWAVVGAYLIRFGLDQDSSSAGQDVLYVWFSVVLAAAWWVMLGAWNSRQSRILGSGPDEYKRVAAASLWLFGIVAIVSYVFRIDTARGYVGLALPVGLLGLLLARWLIRQHLSIKRGQGQSMSRLLLLGGPGAVAHLAASLHGAKHAGYLPVAAYIPGLEAGVGVEPNSGLKIVGHKPDPHSIVTALEACGADAVAVSAGVQLQPQTLRHLGWELAARNIGLIMAPALTDIAGPRIHTQQVAGLPLIHVTTPTLEGGQRVAKRLFDVFAAALLLLLASPTMILVALLIKLDSAGPVLFRQERVGMEGNPFFMLKFRSMVSDAETRLAELAPKNEGSGPLFKIKNDPRVTRVGAFLRRFSVDELPQLLNVLSGSMSLVGPRPPLSREVEAYESDVRRRLLVKPGLTGLWQVSGRSNLSWQDSVRLDLYYVENWSLAGDLVIILRTVRAVFGSTGAY

Samples

Sample ID Description Type Environment
1 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
2 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
3 2643221572 Leifsonia sp. Root60 Isolate Unclassified
4 2643221616 Leifsonia sp. Root227 Isolate Unclassified
5 2643221649 Leifsonia sp. Root4 Isolate Unclassified
6 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
7 2643221711 Terrabacter sp. Root85 Isolate Unclassified
8 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
9 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
10 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
11 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
12 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
13 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
14 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
15 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
16 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
17 2808606372 Agromyces sp. 23-23 Isolate Unclassified
18 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
19 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
20 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
21 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
22 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
23 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
24 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
25 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
26 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
27 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
28 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
29 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
30 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
31 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
32 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
33 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
34 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
35 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
36 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
37 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
38 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
39 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
40 2928153084 Leifsonia sp. 563 Isolate Unclassified
41 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
42 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
43 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
44 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
45 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
46 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
47 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
48 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
49 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
50 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
51 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
52 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
53 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
54 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
55 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
56 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
57 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
58 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
60 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
61 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
62 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
63 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
64 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
65 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
66 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
67 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
68 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
69 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
70 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
71 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
72 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
73 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
74 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
75 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
76 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
77 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
78 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
79 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
80 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
81 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
82 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
83 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
84 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
85 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
86 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
87 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
88 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
89 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
92 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
121 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
122 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
126 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
152 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
153 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
154 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
162 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
163 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
164 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
165 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
166 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
167 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
168 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
169 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
170 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
171 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
172 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
173 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
174 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
175 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
176 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
177 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
178 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
179 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
180 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
181 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
182 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
183 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
186 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
187 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
188 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
189 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
190 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
191 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
192 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
193 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
194 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
195 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
196 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
197 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
198 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
199 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
200 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
217 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
218 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
219 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
220 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
221 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
222 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
237 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
238 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
239 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
240 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
241 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
242 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
243 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
244 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
245 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
246 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
247 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
248 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
249 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
252 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
253 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
254 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
255 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
256 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
257 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
258 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
259 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
260 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
261 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
262 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
263 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
264 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
265 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
266 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
267 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
269 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
270 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
271 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
272 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
273 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.95
Metatranscriptomes 0.97
Isolates 14.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.56
Nodule 0.24
Rhizoplane 9.71
Rhizosphere 66.99
Stem 0
Stem Tuber 0.24
Unclassified 8.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1000433 3300000549 Bacteria 6960
2 LJQas_1000469 3300000549 Bacteria 6684
3 JGI24740J21852_10000214 3300001979 Bacteria 24313
4 JGI24740J21852_10016638 3300001979 Bacteria 2652
5 JGI24739J22299_10020539 3300001989 Bacteria 2359
6 JGI24737J22298_10002646 3300001990 Bacteria 6333
7 JGI24735J21928_10002653 3300002067 Bacteria 6184
8 JGI25164J39214_1000505 3300002772 Bacteria 18861
9 JGI25406J46586_10004419 3300003203 Bacteria 6550
10 JGI25165J46597_1000055 3300003214 Bacteria 224187
11 Ga0055539_1000019 3300003752 Bacteria 341727
12 Ga0055533_1000023 3300003756 Bacteria 341727
13 Ga0055525_1000088 3300003759 Bacteria 143732
14 Ga0055525_1002932 3300003759 Bacteria 1602
15 Ga0055527_1000101 3300003760 Bacteria 62117
16 Ga0055542_1000246 3300003762 Bacteria 62117
17 Ga0055529_1000265 3300003763 Bacteria 62117
18 Ga0065714_10003036 3300005288 Bacteria 11505
19 Ga0065714_10068741 3300005288 Bacteria 4564
20 Ga0065712_10072157 3300005290 Bacteria 4876
21 Ga0070658_10000103 3300005327 Bacteria 75387
22 Ga0070658_10070411 3300005327 Bacteria 2863
23 Ga0070676_10131657 3300005328 Bacteria 1582
24 Ga0070666_10003614 3300005335 Bacteria 9377
25 Ga0070669_100009997 3300005353 Bacteria 6744
26 Ga0070675_100002864 3300005354 Bacteria 12997
27 Ga0070671_100169344 3300005355 Bacteria 1847
28 Ga0070674_100017102 3300005356 Bacteria 4554
29 Ga0070659_100098948 3300005366 Bacteria 2345
30 Ga0070667_100005488 3300005367 Bacteria 10586
31 Ga0070667_100008909 3300005367 Bacteria 8304
32 Ga0070678_100017060 3300005456 Bacteria 4663
33 Ga0070679_100048055 3300005530 Bacteria 4252
34 Ga0068853_100012894 3300005539 Bacteria 6811
35 Ga0070672_100003992 3300005543 Bacteria 9620
36 Ga0070672_100077998 3300005543 Bacteria 2650
37 Ga0068855_100003181 3300005563 Bacteria 20106
38 Ga0068855_100029862 3300005563 Bacteria 6519
39 Ga0068856_100037649 3300005614 Bacteria 4747
40 Ga0068852_100017703 3300005616 Bacteria 5597
41 Ga0081539_10000659 3300005985 Bacteria 69319
42 Ga0075365_10003092 3300006038 Bacteria 8457
43 Ga0075365_10008956 3300006038 Bacteria 5721
44 Ga0075365_10045690 3300006038 Bacteria 2874
45 Ga0075365_10146590 3300006038 Bacteria 1640
46 Ga0075363_100015598 3300006048 Bacteria 3737
47 Ga0075364_10011455 3300006051 Bacteria 5386
48 Ga0075364_10054945 3300006051 Bacteria 2605
49 Ga0075369_10000135 3300006186 Bacteria 20568
50 Ga0075369_10039001 3300006186 Bacteria 2027
51 Ga0075370_10007849 3300006353 Bacteria 5460
52 Ga0075430_100072800 3300006846 Bacteria 2881
53 Ga0105251_10021289 3300009011 Bacteria 3389
54 Ga0105244_10044373 3300009036 Bacteria 2290
55 Ga0105245_10007065 3300009098 Bacteria 9850
56 Ga0105245_10011951 3300009098 Bacteria 7547
57 Ga0105247_10040248 3300009101 Bacteria 2856
58 Ga0105247_10076249 3300009101 Bacteria 2105
59 Ga0114129_10192907 3300009147 Bacteria 2764
60 Ga0105243_10005638 3300009148 Bacteria 9746
61 Ga0105243_10253445 3300009148 Bacteria 1572
62 Ga0105241_10115077 3300009174 Bacteria 2158
63 Ga0105248_10000373 3300009177 Bacteria 52186
64 Ga0105248_10117502 3300009177 Bacteria 2999
65 Ga0105248_10120481 3300009177 Bacteria 2960
66 Ga0105237_10021448 3300009545 Bacteria 6641
67 Ga0105238_10170085 3300009551 Bacteria 2155
68 Ga0105239_10187872 3300010375 Bacteria 2312
69 Ga0105239_10249393 3300010375 Bacteria 1994
70 Ga0105239_10339499 3300010375 Bacteria 1695
71 Ga0105246_10004322 3300011119 Bacteria 8640
72 Ga0105246_10084484 3300011119 Bacteria 2271
73 Ga0157373_10004473 3300013100 Bacteria 10521
74 Ga0157371_10001372 3300013102 Bacteria 25534
75 Ga0157371_10002466 3300013102 Bacteria 17629
76 Ga0157370_10011531 3300013104 Bacteria 9233
77 Ga0157369_10001256 3300013105 Bacteria 31563
78 Ga0157369_10007246 3300013105 Bacteria 12766
79 Ga0157369_10011101 3300013105 Bacteria 10248
80 Ga0157374_10011489 3300013296 Bacteria 7671
81 Ga0163162_10027153 3300013306 Bacteria 5660
82 Ga0163162_10060430 3300013306 Bacteria 3825
83 Ga0157372_10072002 3300013307 Bacteria 3895
84 Ga0157375_10003250 3300013308 Bacteria 14108
85 Ga0157375_10017730 3300013308 Bacteria 6435
86 Ga0157380_10008218 3300014326 Bacteria 7436
87 Ga0157380_10025260 3300014326 Bacteria 4504
88 Ga0157376_10047259 3300014969 Bacteria 3552
89 Ga0206356_10353036 3300020070 Bacteria 5135
90 Ga0206354_10306171 3300020081 Bacteria 7111
91 Ga0206353_11470790 3300020082 Bacteria 8970
92 Ga0209566_100031 3300025225 Bacteria 341555
93 Ga0209674_100001 3300025226 Bacteria 4013750
94 Ga0209672_100152 3300025228 Bacteria 62169
95 Ga0209563_100001 3300025230 Bacteria 4013775
96 Ga0209563_100155 3300025230 Bacteria 64311
97 Ga0207427_100028 3300025231 Bacteria 388949
98 Ga0209437_100619 3300025233 Bacteria 21553
99 Ga0209258_101358 3300025242 Bacteria 8895
100 Ga0209677_100001 3300025253 Bacteria 4013787
101 Ga0209677_102343 3300025253 Bacteria 7257
102 Ga0209148_1000341 3300025254 Bacteria 62169
103 Ga0209233_1000001 3300025261 Bacteria 2992747
104 Ga0209455_1000258 3300025272 Bacteria 62169
105 Ga0209455_1000425 3300025272 Bacteria 33165
106 Ga0207697_10000015 3300025315 Bacteria 59450
107 Ga0207655_1003325 3300025728 Bacteria 12048
108 Ga0207655_1003744 3300025728 Bacteria 11160
109 Ga0207713_1025700 3300025735 Bacteria 2712
110 Ga0207710_10023381 3300025900 Bacteria 2655
111 Ga0207647_10086571 3300025904 Bacteria 1872
112 Ga0207645_10003833 3300025907 Bacteria 11264
113 Ga0207705_10000001 3300025909 Bacteria 2061880
114 Ga0207654_10072651 3300025911 Bacteria 2048
115 Ga0207671_10053007 3300025914 Bacteria 3006
116 Ga0207657_10001090 3300025919 Bacteria 28772
117 Ga0207650_10005566 3300025925 Bacteria 8599
118 Ga0207687_10021856 3300025927 Bacteria 4252
119 Ga0207687_10035770 3300025927 Bacteria 3380
120 Ga0207690_10010719 3300025932 Bacteria 5463
121 Ga0207709_10012536 3300025935 Bacteria 4669
122 Ga0207709_10082192 3300025935 Bacteria 2079
123 Ga0207669_10009830 3300025937 Bacteria 4575
124 Ga0207691_10000240 3300025940 Bacteria 53770
125 Ga0207691_10093490 3300025940 Bacteria 2692
126 Ga0207691_10120805 3300025940 Bacteria 2322
127 Ga0207711_10000702 3300025941 Bacteria 33018
128 Ga0207711_10164282 3300025941 Bacteria 2011
129 Ga0207667_10000866 3300025949 Bacteria 38929
130 Ga0207658_10004742 3300025986 Bacteria 9417
131 Ga0207658_10007714 3300025986 Bacteria 7330
132 Ga0207677_10005523 3300026023 Bacteria 6867
133 Ga0207639_10008549 3300026041 Bacteria 7026
134 Ga0207678_10038057 3300026067 Bacteria 4182
135 Ga0207683_10013671 3300026121 Bacteria 6923
136 Ga0207683_10036767 3300026121 Bacteria 4264
137 Ga0207698_10000587 3300026142 Bacteria 21197
138 Ga0265338_10013894 3300028800 Bacteria 9038
139 Ga0265325_10000922 3300031241 Bacteria 21220
140 Ga0265314_10027637 3300031711 Bacteria 4246
141 Ga0265342_10014657 3300031712 Bacteria 5196
142 Ga0307409_100028835 3300031995 Bacteria 3962
143 Ga0307409_100045443 3300031995 Bacteria 3316
144 Ga0307416_100020031 3300032002 Bacteria 4761
145 Ga0307416_100081385 3300032002 Bacteria 2738
146 Ga0395899_0004875 3300037312 Bacteria 10449
147 Ga0395899_0005815 3300037312 Bacteria 9574
148 Ga0395900_0038805 3300037418 Bacteria 4910
149 Ga0395900_0153388 3300037418 Bacteria 2353
150 Ga0395900_0191330 3300037418 Bacteria 2075
151 Ga0395898_0000100 3300037466 Bacteria 226446
152 Ga0395898_0005195 3300037466 Bacteria 14076
153 Ga0395898_0093942 3300037466 Bacteria 2882
154 Ga0395898_0200449 3300037466 Bacteria 1906
155 Ga0395901_0004854 3300038443 Bacteria 13571
156 Ga0395901_0017049 3300038443 Bacteria 7403
157 Ga0395901_0090866 3300038443 Bacteria 3196
158 Ga0395901_0107836 3300038443 Bacteria 2923
159 Ga0439436_0006736 3300041404 Bacteria 3528
160 Ga0439447_018871 3300041407 Bacteria 1850
161 Ga0439466_0004506 3300041411 Bacteria 5355
162 Ga0439433_0000033 3300041999 Bacteria 17255
163 Ga0439442_000248 3300042002 Bacteria 13168
164 Ga0439442_000902 3300042002 Bacteria 6116
165 Ga0439432_003440 3300042006 Bacteria 5871
166 Ga0439449_0001096 3300042007 Bacteria 10659
167 Ga0439449_0023846 3300042007 Bacteria 2288
168 Ga0439452_000877 3300042010 Bacteria 13895
169 Ga0439457_005270 3300042014 Bacteria 3271
170 Ga0439462_0000065 3300042015 Bacteria 15578
171 Ga0450920_000174 3300042122 Bacteria 9108
172 Ga0439434_0000086 3300042435 Bacteria 23136
173 Ga0450918_001669 3300042531 Bacteria 4350
174 Ga0466965_0011080 3300044683 Bacteria 4216
175 Ga0466966_0003499 3300044684 Bacteria 10356
176 Ga0466961_0004595 3300044693 Bacteria 8669
177 Ga0466963_0036074 3300044694 Bacteria 3223
178 Ga0466971_0009191 3300044719 Bacteria 4321
179 Ga0466970_0002088 3300044765 Bacteria 9657
180 Ga0466970_0006731 3300044765 Bacteria 5751
181 Ga0466970_0009094 3300044765 Bacteria 5014
182 Ga0466957_0024735 3300044842 Bacteria 3556
183 Ga0466960_0018336 3300044901 Bacteria 3065
184 Ga0466959_0003251 3300045049 Bacteria 10579
185 Ga0466959_0003457 3300045049 Bacteria 10339
186 Ga0466959_0011731 3300045049 Bacteria 6305
187 Ga0466959_0052685 3300045049 Bacteria 2979
188 Ga0466958_0015468 3300045836 Bacteria 4372
189 Ga0466958_0029536 3300045836 Bacteria 3253
190 Ga0466958_0103024 3300045836 Bacteria 1777
191 Ga0466967_0021547 3300045976 Bacteria 5240
192 Ga0466967_0156795 3300045976 Bacteria 2133
193 Ga0495590_0000115 3300046457 Bacteria 48176
194 Ga0495638_0041181 3300046460 Bacteria 2924
195 Ga0495582_0059156 3300046473 Bacteria 2114
196 Ga0495639_0003119 3300046475 Bacteria 7202
197 Ga0495642_0014055 3300046528 Bacteria 3103
198 Ga0495665_0068845 3300046531 Bacteria 1866
199 Ga0495586_0003992 3300046535 Bacteria 7907
200 Ga0495656_0000265 3300046615 Bacteria 18505
201 Ga0495588_0005623 3300046674 Bacteria 5585
202 Ga0495588_0045876 3300046674 Bacteria 2241
203 Ga0495670_0002421 3300046691 Bacteria 9211
204 Ga0495581_0005085 3300047315 Bacteria 7617
205 Ga0495636_0002109 3300047318 Bacteria 7643
206 Ga0495672_0004825 3300047320 Bacteria 10871
207 Ga0495672_0049720 3300047320 Bacteria 2480
208 Ga0495686_0053492 3300047472 Bacteria 2530
209 Ga0495626_0021010 3300048091 Bacteria 3247
210 Ga0496100_0031815 3300048903 Bacteria 3283
211 Ga0496101_0007235 3300048904 Bacteria 7182
212 Ga0496101_0009756 3300048904 Bacteria 6320
213 Ga0496102_0004858 3300048905 Bacteria 11367
214 Ga0496102_0013396 3300048905 Bacteria 7102
215 Ga0496102_0024847 3300048905 Bacteria 5328
216 Ga0496102_0043825 3300048905 Bacteria 4058
217 Ga0496102_0081000 3300048905 Bacteria 2992
218 Ga0496103_0002635 3300048906 Bacteria 11240
219 Ga0496103_0026521 3300048906 Bacteria 3507
220 Ga0496103_0030791 3300048906 Bacteria 3266
221 Ga0496104_0008770 3300048907 Bacteria 8990
222 Ga0496104_0026242 3300048907 Bacteria 5376
223 Ga0496104_0042038 3300048907 Bacteria 4287
224 Ga0496104_0046455 3300048907 Bacteria 4090
225 Ga0496104_0078961 3300048907 Bacteria 3136
226 Ga0496104_0088112 3300048907 Bacteria 2965
227 Ga0496105_0005681 3300048908 Bacteria 9493
228 Ga0496105_0032038 3300048908 Bacteria 4311
229 Ga0496105_0039078 3300048908 Bacteria 3910
230 Ga0496105_0050834 3300048908 Bacteria 3424
231 Ga0496106_0052643 3300048909 Bacteria 3072
232 Ga0496107_0007446 3300048910 Bacteria 7546
233 Ga0496107_0046571 3300048910 Bacteria 3121
234 Ga0496108_0015338 3300048911 Bacteria 6250
235 Ga0496109_0024810 3300048912 Bacteria 5335
236 Ga0496110_0002451 3300048913 Bacteria 13894
237 Ga0496110_0019159 3300048913 Bacteria 5753
238 Ga0496111_0010038 3300048914 Bacteria 6336
239 Ga0496111_0014473 3300048914 Bacteria 5389
240 Ga0496112_0033843 3300048915 Bacteria 4970
241 Ga0496113_0006625 3300048916 Bacteria 7365
242 Ga0496113_0078134 3300048916 Bacteria 2532
243 Ga0496114_0005796 3300048917 Bacteria 9701
244 Ga0496114_0007312 3300048917 Bacteria 8723
245 Ga0496114_0024208 3300048917 Bacteria 4955
246 Ga0496114_0026211 3300048917 Bacteria 4771
247 Ga0496114_0084767 3300048917 Bacteria 2683
248 Ga0496114_0109135 3300048917 Bacteria 2369
249 Ga0496115_0024615 3300048918 Bacteria 4682
250 Ga0496117_0000048 3300048920 Bacteria 295908
251 Ga0496117_0008548 3300048920 Bacteria 9709
252 Ga0496120_0003460 3300048923 Bacteria 14359
253 Ga0496121_0011562 3300048924 Bacteria 9776
254 Ga0496122_0001340 3300048925 Bacteria 40206
255 Ga0496122_0002707 3300048925 Bacteria 24624
256 Ga0496122_0098663 3300048925 Bacteria 1961
257 Ga0496123_0000845 3300048926 Bacteria 48945
258 Ga0496123_0019665 3300048926 Bacteria 5318
259 Ga0496124_0022556 3300048927 Bacteria 5766
260 Ga0496124_0056999 3300048927 Bacteria 3293
261 Ga0501031_0024104 3300049568 Bacteria 3967
262 Ga0501032_0000286 3300049569 Bacteria 42449
263 Ga0501032_0011150 3300049569 Bacteria 6459
264 Ga0501032_0036974 3300049569 Bacteria 3331
265 Ga0501033_0023169 3300049570 Bacteria 4682
266 Ga0501033_0027992 3300049570 Bacteria 4236
267 Ga0501033_0062507 3300049570 Bacteria 2742
268 Ga0501034_0008244 3300049571 Bacteria 11032
269 Ga0501034_0041746 3300049571 Bacteria 4641
270 Ga0501034_0115963 3300049571 Bacteria 2666
271 Ga0501036_0067329 3300049572 Bacteria 3029
272 Ga0501037_0014851 3300049573 Bacteria 5729
273 Ga0501037_0112212 3300049573 Bacteria 1963
274 Ga0501037_0137570 3300049573 Bacteria 1749
275 Ga0501038_0000814 3300049574 Bacteria 27712
276 Ga0501038_0001226 3300049574 Bacteria 23248
277 Ga0501038_0019225 3300049574 Bacteria 6160
278 Ga0501038_0029406 3300049574 Bacteria 4870
279 Ga0501038_0077554 3300049574 Bacteria 2805
280 Ga0501039_0001948 3300049575 Bacteria 15299
281 Ga0501039_0051204 3300049575 Bacteria 3196
282 Ga0501039_0054293 3300049575 Bacteria 3101
283 Ga0501039_0131493 3300049575 Bacteria 1964
284 Ga0501040_0009538 3300049576 Bacteria 6333
285 Ga0501042_0047779 3300049578 Bacteria 3051
286 Ga0501043_0001979 3300049579 Bacteria 17476
287 Ga0501043_0061955 3300049579 Bacteria 2937
288 Ga0501043_0066908 3300049579 Bacteria 2821
289 Ga0501043_0117839 3300049579 Bacteria 2083
290 Ga0501046_0009785 3300049580 Bacteria 8267
291 Ga0501047_0014481 3300049581 Bacteria 7501
292 Ga0501047_0021538 3300049581 Bacteria 6190
293 Ga0501047_0024070 3300049581 Bacteria 5848
294 Ga0501047_0036598 3300049581 Bacteria 4744
295 Ga0501048_0000749 3300049582 Bacteria 23801
296 Ga0501068_0011083 3300049584 Bacteria 5075
297 Ga0501069_0033194 3300049585 Bacteria 2842
298 Ga0501070_0000065 3300049586 Bacteria 88506
299 Ga0501070_0000367 3300049586 Bacteria 41059
300 Ga0501070_0007815 3300049586 Bacteria 9066
301 Ga0501070_0032100 3300049586 Bacteria 4396
302 Ga0501071_0007195 3300049587 Bacteria 7280
303 Ga0501072_0028768 3300049588 Bacteria 4338
304 Ga0501073_0005520 3300049589 Bacteria 9472
305 Ga0501074_0049605 3300049590 Bacteria 3031
306 Ga0501075_0019137 3300049591 Bacteria 4966
307 Ga0501076_0004592 3300049592 Bacteria 9831
308 Ga0501079_0056952 3300049741 Bacteria 3016
309 Ga0501079_0161313 3300049741 Bacteria 1748
310 Ga0501080_0000085 3300049742 Bacteria 62675
311 Ga0501081_0078190 3300049743 Bacteria 2312
312 Ga0501083_0011349 3300049744 Bacteria 6249
313 Ga0501083_0013518 3300049744 Bacteria 5706
314 Ga0501035_0007201 3300049822 Bacteria 10411
315 Ga0501035_0009567 3300049822 Bacteria 9012
316 Ga0501035_0015909 3300049822 Bacteria 6942
317 Ga0501035_0057394 3300049822 Bacteria 3471
318 Ga0501035_0120801 3300049822 Bacteria 2290
319 Ga0501044_0019011 3300049823 Bacteria 7357
320 Ga0501044_0056745 3300049823 Bacteria 4020
321 Ga0501044_0184559 3300049823 Bacteria 2051
322 Ga0501045_0003745 3300049824 Bacteria 10461
323 Ga0501045_0043227 3300049824 Bacteria 3280
324 nmdc:mga03n38_16651_c1 3300050490 Bacteria 2864
325 nmdc:mga00v17_59788_c1 3300050491 Bacteria 2339
326 nmdc:mga0yw44_35736_c1 3300050492 Bacteria 2922
327 nmdc:mga0yw44_8454_c1 3300050492 Bacteria 5131
328 nmdc:mga07m45_3939_c1 3300050496 Bacteria 5383
329 nmdc:mga0sz30_17286_c1 3300050516 Bacteria 2416
330 Ga0500635_0000002 3300053080 Bacteria 265613
331 Ga0500635_0003975 3300053080 Bacteria 3769
332 Ga0500556_0000311 3300053104 Bacteria 37001
333 Ga0500556_0001137 3300053104 Bacteria 13017
334 Ga0500593_000246 3300053117 Bacteria 22239
335 Ga0500652_000058 3300053131 Bacteria 50084
336 Ga0500652_007318 3300053131 Bacteria 3607
337 Ga0500559_0000474 3300053136 Bacteria 28589
338 Ga0500568_0000051 3300053139 Bacteria 112462
339 Ga0500568_0000061 3300053139 Bacteria 107322
340 Ga0500568_0000652 3300053139 Bacteria 25068
341 Ga0500568_0016044 3300053139 Bacteria 3338
342 Ga0500573_0000080 3300053140 Bacteria 46390
343 Ga0500573_0012347 3300053140 Unclassified 4796
344 Ga0500573_0027583 3300053140 Bacteria 3267
345 Ga0500573_0056621 3300053140 Bacteria 2250
346 Ga0500573_0079729 3300053140 Bacteria 1861
347 Ga0500616_0004529 3300053153 Bacteria 9857
348 Ga0500616_0032418 3300053153 Bacteria 2857
349 Ga0500627_0001781 3300053158 Bacteria 6121
350 Ga0500645_000070 3300053730 Bacteria 79917
351 Ga0587072_000056 3300059643 Bacteria 7868
352 Ga0501082_0169396 3300060353 Bacteria 1898
353 Ga0466962_0010929 3300061719 Bacteria 4365
354 Ga0466962_0060481 3300061719 Bacteria 1808

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041407 Ga0439447_018871 Ga0439447_018871_92_1348 418
2 3300048907 Ga0496104_0078961 Ga0496104_0078961_1849_3117 420
3 3300025315 Ga0207697_10000015 Ga0207697_1000001537 434
4 3300025940 Ga0207691_10000240 Ga0207691_1000024022 434
5 3300038443 Ga0395901_0090866 Ga0395901_0090866_1133_2491 437
6 3300046457 Ga0495590_0000115 Ga0495590_0000115_20761_22260 440
7 3300028800 Ga0265338_10013894 Ga0265338_100138949 441
8 3300031241 Ga0265325_10000922 Ga0265325_1000092218 441
9 3300031711 Ga0265314_10027637 Ga0265314_100276372 441
10 3300031712 Ga0265342_10014657 Ga0265342_100146574 441
11 3300038443 Ga0395901_0107836 Ga0395901_0107836_940_2271 441
12 3300046528 Ga0495642_0014055 Ga0495642_0014055_1206_2654 446
13 3300045976 Ga0466967_0021547 Ga0466967_0021547_335_1849 447
14 3300009101 Ga0105247_10040248 Ga0105247_100402483 449
15 3300047320 Ga0495672_0049720 Ga0495672_0049720_685_2184 450
16 3300005353 Ga0070669_100009997 Ga0070669_1000099971 452
17 3300025735 Ga0207713_1025700 Ga0207713_10257001 452
18 3300025986 Ga0207658_10007714 Ga0207658_100077147 452
19 3300046674 Ga0495588_0005623 Ga0495588_0005623_4047_5408 452
20 3300048927 Ga0496124_0056999 Ga0496124_0056999_1554_2915 452
21 3300050492 nmdc:mga0yw44_8454_c1 nmdc:mga0yw44_8454_c1_14_1453 452
22 3300061719 Ga0466962_0010929 Ga0466962_0010929_424_1905 452
23 3300053140 Ga0500573_0000080 Ga0500573_0000080_14446_15834 453
24 3300037466 Ga0395898_0200449 Ga0395898_0200449_67_1440 454
25 iso_pu_bacteria 8057345674 8057345940 454
26 3300037418 Ga0395900_0153388 Ga0395900_0153388_114_1553 455
27 3300049574 Ga0501038_0077554 Ga0501038_0077554_1363_2748 455
28 3300049741 Ga0501079_0161313 Ga0501079_0161313_19_1407 455
29 3300009011 Ga0105251_10021289 Ga0105251_100212892 457
30 3300011119 Ga0105246_10004322 Ga0105246_100043224 457
31 3300006038 Ga0075365_10008956 Ga0075365_100089563 458
32 3300038443 Ga0395901_0017049 Ga0395901_0017049_2873_4354 458
33 3300050491 nmdc:mga00v17_59788_c1 nmdc:mga00v17_59788_c1_759_2255 458
34 3300053139 Ga0500568_0000051 Ga0500568_0000051_37782_39182 458
35 3300048925 Ga0496122_0001340 Ga0496122_0001340_31094_32551 459
36 3300048926 Ga0496123_0019665 Ga0496123_0019665_1996_3453 459
37 3300053136 Ga0500559_0000474 Ga0500559_0000474_25489_26985 459
38 3300006353 Ga0075370_10007849 Ga0075370_100078492 460
39 3300050490 nmdc:mga03n38_16651_c1 nmdc:mga03n38_16651_c1_1259_2650 460
40 3300050496 nmdc:mga07m45_3939_c1 nmdc:mga07m45_3939_c1_133_1524 460
41 3300006038 Ga0075365_10003092 Ga0075365_100030926 461
42 3300048917 Ga0496114_0007312 Ga0496114_0007312_7230_8624 461
43 3300049570 Ga0501033_0062507 Ga0501033_0062507_44_1480 461
44 3300049823 Ga0501044_0019011 Ga0501044_0019011_1231_2667 461
45 3300053080 Ga0500635_0003975 Ga0500635_0003975_1480_2874 461
46 3300049579 Ga0501043_0061955 Ga0501043_0061955_649_2061 462
47 3300049581 Ga0501047_0014481 Ga0501047_0014481_5515_6927 462
48 3300049822 Ga0501035_0009567 Ga0501035_0009567_6823_8235 462
49 3300049823 Ga0501044_0184559 Ga0501044_0184559_201_1613 462
50 3300048924 Ga0496121_0011562 Ga0496121_0011562_2817_4379 463
51 iso_pu_bacteria 2818991458 2819667089 463
52 3300049571 Ga0501034_0008244 Ga0501034_0008244_8816_10273 464
53 3300049588 Ga0501072_0028768 Ga0501072_0028768_2010_3467 464
54 3300053139 Ga0500568_0016044 Ga0500568_0016044_13_1470 464
55 3300053140 Ga0500573_0079729 Ga0500573_0079729_74_1495 464
56 3300053153 Ga0500616_0004529 Ga0500616_0004529_7444_8931 464
57 3300005614 Ga0068856_100037649 Ga0068856_1000376491 465
58 3300005616 Ga0068852_100017703 Ga0068852_1000177034 465
59 3300009098 Ga0105245_10007065 Ga0105245_100070653 465
60 3300025927 Ga0207687_10021856 Ga0207687_100218562 465
61 iso_pu_bacteria 2848551377 2848554490 465
62 3300009551 Ga0105238_10170085 Ga0105238_101700852 466
63 3300010375 Ga0105239_10339499 Ga0105239_103394991 466
64 3300037312 Ga0395899_0004875 Ga0395899_0004875_9019_10428 466
65 3300003203 JGI25406J46586_10004419 JGI25406J46586_100044191 467
66 3300005985 Ga0081539_10000659 Ga0081539_100006594 467
67 3300049573 Ga0501037_0137570 Ga0501037_0137570_183_1598 467
68 iso_pu_bacteria 2852643534 2852646425 467
69 3300005327 Ga0070658_10070411 Ga0070658_100704112 468
70 3300005563 Ga0068855_100003181 Ga0068855_1000031815 468
71 3300009101 Ga0105247_10076249 Ga0105247_100762492 468
72 3300009174 Ga0105241_10115077 Ga0105241_101150772 468
73 3300009177 Ga0105248_10120481 Ga0105248_101204812 468
74 3300010375 Ga0105239_10187872 Ga0105239_101878722 468
75 3300025919 Ga0207657_10001090 Ga0207657_1000109015 468
76 3300025949 Ga0207667_10000866 Ga0207667_100008665 468
77 3300025986 Ga0207658_10004742 Ga0207658_100047426 468
78 3300026023 Ga0207677_10005523 Ga0207677_100055235 468
79 3300026041 Ga0207639_10008549 Ga0207639_100085495 468
80 3300048916 Ga0496113_0078134 Ga0496113_0078134_550_2031 468
81 iso_pu_bacteria 2808606370 2808892466 468
82 iso_pu_bacteria 2844852863 2844852932 468
83 3300013306 Ga0163162_10060430 Ga0163162_100604303 469
84 3300013308 Ga0157375_10003250 Ga0157375_1000325013 469
85 3300048905 Ga0496102_0004858 Ga0496102_0004858_7741_9357 469
86 3300048906 Ga0496103_0002635 Ga0496103_0002635_8993_10609 469
87 3300048909 Ga0496106_0052643 Ga0496106_0052643_1150_2766 469
88 3300048912 Ga0496109_0024810 Ga0496109_0024810_3294_4910 469
89 3300048913 Ga0496110_0002451 Ga0496110_0002451_699_2315 469
90 3300048914 Ga0496111_0014473 Ga0496111_0014473_3072_4688 469
91 iso_pu_bacteria 2848551377 2848554493 469
92 3300053140 Ga0500573_0056621 Ga0500573_0056621_76_1515 470
93 iso_pu_bacteria 2808606360 2808849444 470
94 iso_pu_bacteria 2919051321 2919052874 470
95 3300013104 Ga0157370_10011531 Ga0157370_100115313 471
96 3300042002 Ga0439442_000248 Ga0439442_000248_1043_2467 471
97 3300044765 Ga0466970_0002088 Ga0466970_0002088_1859_3391 471
98 3300045836 Ga0466958_0103024 Ga0466958_0103024_136_1668 471
99 iso_pu_bacteria 2808606357 2808828210 471
100 iso_pu_bacteria 2808606366 2808877938 471
101 iso_pu_bacteria 2811994871 2812320050 471
102 iso_pu_bacteria 2904776348 2904777091 471
103 iso_pu_bacteria 2919391150 2919393684 471
104 iso_pu_bacteria 2945956166 2945960385 471
105 iso_pu_bacteria 2946059875 2946061612 471
106 iso_pu_bacteria 2953998280 2953999065 471
107 3300013100 Ga0157373_10004473 Ga0157373_100044734 472
108 3300048925 Ga0496122_0002707 Ga0496122_0002707_6391_7887 472
109 3300048926 Ga0496123_0000845 Ga0496123_0000845_44051_45547 472
110 3300053140 Ga0500573_0012347 Ga0500573_0012347_2710_4170 472
111 iso_pu_bacteria 2964326757 2964327477 472
112 3300013102 Ga0157371_10002466 Ga0157371_100024665 473
113 3300048091 Ga0495626_0021010 Ga0495626_0021010_1389_2867 473
114 3300048905 Ga0496102_0024847 Ga0496102_0024847_818_2329 473
115 3300048927 Ga0496124_0022556 Ga0496124_0022556_1350_2828 473
116 3300053104 Ga0500556_0000311 Ga0500556_0000311_2191_3639 473
117 3300053117 Ga0500593_000246 Ga0500593_000246_10981_12429 473
118 iso_pu_bacteria 2852646457 2852646501 473
119 iso_pu_bacteria 2945920336 2945921951 473
120 3300009148 Ga0105243_10253445 Ga0105243_102534451 474
121 3300013306 Ga0163162_10027153 Ga0163162_100271534 474
122 3300037466 Ga0395898_0005195 Ga0395898_0005195_4643_6148 474
123 3300037466 Ga0395898_0093942 Ga0395898_0093942_1362_2837 474
124 3300038443 Ga0395901_0004854 Ga0395901_0004854_7469_8974 474
125 3300048904 Ga0496101_0009756 Ga0496101_0009756_429_1910 474
126 3300048905 Ga0496102_0043825 Ga0496102_0043825_1851_3332 474
127 3300048906 Ga0496103_0026521 Ga0496103_0026521_606_2087 474
128 3300048907 Ga0496104_0026242 Ga0496104_0026242_433_1914 474
129 3300048907 Ga0496104_0042038 Ga0496104_0042038_197_1678 474
130 3300048908 Ga0496105_0039078 Ga0496105_0039078_1572_3053 474
131 3300048908 Ga0496105_0050834 Ga0496105_0050834_1383_2864 474
132 3300048917 Ga0496114_0026211 Ga0496114_0026211_66_1547 474
133 3300048917 Ga0496114_0109135 Ga0496114_0109135_31_1512 474
134 3300048920 Ga0496117_0000048 Ga0496117_0000048_188756_190240 474
135 3300049571 Ga0501034_0115963 Ga0501034_0115963_791_2278 474
136 iso_pu_bacteria 2643221711 2644610723 474
137 iso_pu_bacteria 2818991462 2819690438 474
138 iso_pu_bacteria 2818991469 2819728301 474
139 3300001979 JGI24740J21852_10000214 JGI24740J21852_100002143 475
140 3300006038 Ga0075365_10045690 Ga0075365_100456903 475
141 3300006038 Ga0075365_10146590 Ga0075365_101465901 475
142 3300006186 Ga0075369_10000135 Ga0075369_100001354 475
143 3300009098 Ga0105245_10011951 Ga0105245_100119514 475
144 3300010375 Ga0105239_10249393 Ga0105239_102493932 475
145 3300013307 Ga0157372_10072002 Ga0157372_100720023 475
146 3300014326 Ga0157380_10025260 Ga0157380_100252603 475
147 3300025728 Ga0207655_1003744 Ga0207655_10037447 475
148 3300025927 Ga0207687_10035770 Ga0207687_100357701 475
149 3300025940 Ga0207691_10120805 Ga0207691_101208052 475
150 3300026121 Ga0207683_10036767 Ga0207683_100367672 475
151 3300045049 Ga0466959_0003251 Ga0466959_0003251_7175_8707 475
152 3300048917 Ga0496114_0024208 Ga0496114_0024208_253_1689 475
153 3300049569 Ga0501032_0000286 Ga0501032_0000286_11469_12905 475
154 3300049570 Ga0501033_0023169 Ga0501033_0023169_2112_3596 475
155 3300049573 Ga0501037_0014851 Ga0501037_0014851_2071_3561 475
156 3300049574 Ga0501038_0000814 Ga0501038_0000814_26087_27523 475
157 3300049574 Ga0501038_0029406 Ga0501038_0029406_2875_4326 475
158 3300049575 Ga0501039_0051204 Ga0501039_0051204_986_2422 475
159 3300049575 Ga0501039_0131493 Ga0501039_0131493_502_1953 475
160 3300049579 Ga0501043_0001979 Ga0501043_0001979_13783_15273 475
161 3300049581 Ga0501047_0024070 Ga0501047_0024070_3663_5153 475
162 3300049585 Ga0501069_0033194 Ga0501069_0033194_1170_2660 475
163 3300049586 Ga0501070_0000367 Ga0501070_0000367_12091_13581 475
164 3300049589 Ga0501073_0005520 Ga0501073_0005520_3039_4529 475
165 3300049742 Ga0501080_0000085 Ga0501080_0000085_35735_37225 475
166 3300049744 Ga0501083_0011349 Ga0501083_0011349_660_2150 475
167 3300050492 nmdc:mga0yw44_35736_c1 nmdc:mga0yw44_35736_c1_513_2006 475
168 3300053153 Ga0500616_0032418 Ga0500616_0032418_26_1519 475
169 iso_pu_bacteria 2643221649 2644278996 475
170 iso_pu_bacteria 2784132109 2784471654 475
171 iso_pu_bacteria 8054107350 8054110828 475
172 iso_pu_bacteria 8056037122 8056038215 475
173 3300005328 Ga0070676_10131657 Ga0070676_101316571 476
174 3300005367 Ga0070667_100005488 Ga0070667_1000054887 476
175 3300005539 Ga0068853_100012894 Ga0068853_1000128945 476
176 3300005543 Ga0070672_100077998 Ga0070672_1000779982 476
177 3300009177 Ga0105248_10000373 Ga0105248_1000037344 476
178 3300009545 Ga0105237_10021448 Ga0105237_100214481 476
179 3300013296 Ga0157374_10011489 Ga0157374_100114896 476
180 3300014969 Ga0157376_10047259 Ga0157376_100472592 476
181 3300025900 Ga0207710_10023381 Ga0207710_100233812 476
182 3300025911 Ga0207654_10072651 Ga0207654_100726512 476
183 3300025914 Ga0207671_10053007 Ga0207671_100530071 476
184 3300025940 Ga0207691_10093490 Ga0207691_100934902 476
185 3300025941 Ga0207711_10000702 Ga0207711_1000070231 476
186 3300026142 Ga0207698_10000587 Ga0207698_1000058721 476
187 3300037418 Ga0395900_0038805 Ga0395900_0038805_3057_4529 476
188 3300044694 Ga0466963_0036074 Ga0466963_0036074_1552_3039 476
189 3300045836 Ga0466958_0015468 Ga0466958_0015468_1244_2731 476
190 3300045976 Ga0466967_0156795 Ga0466967_0156795_451_1938 476
191 3300047472 Ga0495686_0053492 Ga0495686_0053492_982_2496 476
192 3300053139 Ga0500568_0000061 Ga0500568_0000061_31261_32733 476
193 3300061719 Ga0466962_0060481 Ga0466962_0060481_125_1612 476
194 iso_pu_bacteria 2808606372 2808903087 476
195 iso_pu_bacteria 2808606372 2808903092 476
196 iso_pu_bacteria 2857737099 2857740133 476
197 iso_pu_bacteria 2862993130 2862994529 476
198 3300006051 Ga0075364_10011455 Ga0075364_100114554 477
199 3300006186 Ga0075369_10039001 Ga0075369_100390012 477
200 3300013102 Ga0157371_10001372 Ga0157371_1000137213 477
201 3300013105 Ga0157369_10001256 Ga0157369_1000125611 477
202 3300031995 Ga0307409_100045443 Ga0307409_1000454432 477
203 3300044684 Ga0466966_0003499 Ga0466966_0003499_2800_4281 477
204 3300044693 Ga0466961_0004595 Ga0466961_0004595_2797_4278 477
205 3300044842 Ga0466957_0024735 Ga0466957_0024735_1628_3112 477
206 3300045049 Ga0466959_0003457 Ga0466959_0003457_7261_8745 477
207 3300045049 Ga0466959_0052685 Ga0466959_0052685_1245_2726 477
208 3300049569 Ga0501032_0011150 Ga0501032_0011150_2296_3801 477
209 3300049570 Ga0501033_0027992 Ga0501033_0027992_2646_4154 477
210 3300049574 Ga0501038_0001226 Ga0501038_0001226_6423_7928 477
211 3300049581 Ga0501047_0021538 Ga0501047_0021538_1660_3165 477
212 3300049582 Ga0501048_0000749 Ga0501048_0000749_14887_16392 477
213 3300049586 Ga0501070_0007815 Ga0501070_0007815_1366_2871 477
214 3300049744 Ga0501083_0013518 Ga0501083_0013518_1015_2523 477
215 3300049822 Ga0501035_0007201 Ga0501035_0007201_2398_3903 477
216 3300050516 nmdc:mga0sz30_17286_c1 nmdc:mga0sz30_17286_c1_855_2351 477
217 3300053104 Ga0500556_0001137 Ga0500556_0001137_1322_2818 477
218 iso_pu_bacteria 2537561592 2537900195 477
219 iso_pu_bacteria 2799112218 2799185861 477
220 iso_pu_bacteria 2933418574 2933421958 477
221 3300037466 Ga0395898_0000100 Ga0395898_0000100_39279_40796 478
222 3300059643 Ga0587072_000056 Ga0587072_000056_6246_7694 478
223 iso_pu_bacteria 2833709550 2833709936 478
224 3300013105 Ga0157369_10007246 Ga0157369_100072468 479
225 3300025272 Ga0209455_1000425 Ga0209455_10004257 479
226 3300047320 Ga0495672_0004825 Ga0495672_0004825_9317_10798 479
227 3300053131 Ga0500652_000058 Ga0500652_000058_44770_46245 479
228 iso_pu_bacteria 2738543028 2739329843 479
229 3300009036 Ga0105244_10044373 Ga0105244_100443732 480
230 3300011119 Ga0105246_10084484 Ga0105246_100844842 480
231 3300025935 Ga0207709_10082192 Ga0207709_100821922 480
232 3300046460 Ga0495638_0041181 Ga0495638_0041181_727_2202 480
233 3300048905 Ga0496102_0081000 Ga0496102_0081000_1305_2792 480
234 iso_pu_bacteria 2738541274 2738704677 480
235 iso_pu_bacteria 2842134933 2842137051 480
236 3300042007 Ga0439449_0023846 Ga0439449_0023846_703_2166 481
237 iso_pu_bacteria 2929212328 2929214169 481
238 3300005530 Ga0070679_100048055 Ga0070679_1000480554 482
239 3300006846 Ga0075430_100072800 Ga0075430_1000728002 482
240 3300049572 Ga0501036_0067329 Ga0501036_0067329_76_1599 482
241 3300049575 Ga0501039_0054293 Ga0501039_0054293_757_2280 482
242 3300049576 Ga0501040_0009538 Ga0501040_0009538_1948_3471 482
243 3300049578 Ga0501042_0047779 Ga0501042_0047779_1481_3004 482
244 3300049587 Ga0501071_0007195 Ga0501071_0007195_4362_5885 482
245 3300049590 Ga0501074_0049605 Ga0501074_0049605_1482_3005 482
246 3300049591 Ga0501075_0019137 Ga0501075_0019137_1893_3416 482
247 3300049592 Ga0501076_0004592 Ga0501076_0004592_193_1716 482
248 3300049741 Ga0501079_0056952 Ga0501079_0056952_100_1623 482
249 3300049743 Ga0501081_0078190 Ga0501081_0078190_618_2141 482
250 3300049822 Ga0501035_0057394 Ga0501035_0057394_1684_3207 482
251 3300049824 Ga0501045_0043227 Ga0501045_0043227_1723_3246 482
252 3300060353 Ga0501082_0169396 Ga0501082_0169396_261_1784 482
253 iso_pu_bacteria 2902799365 2902802905 482
254 3300009147 Ga0114129_10192907 Ga0114129_101929073 483
255 3300053139 Ga0500568_0000652 Ga0500568_0000652_21798_23321 483
256 iso_pu_bacteria 2939657138 2939660669 483
257 3300031995 Ga0307409_100028835 Ga0307409_1000288353 484
258 3300048907 Ga0496104_0088112 Ga0496104_0088112_127_1638 484
259 3300053131 Ga0500652_007318 Ga0500652_007318_278_1768 484
260 3300053158 Ga0500627_0001781 Ga0500627_0001781_3845_5335 484
261 3300053730 Ga0500645_000070 Ga0500645_000070_30941_32431 484
262 3300005327 Ga0070658_10000103 Ga0070658_1000010343 485
263 3300005366 Ga0070659_100098948 Ga0070659_1000989482 485
264 3300005563 Ga0068855_100029862 Ga0068855_1000298623 485
265 3300025909 Ga0207705_10000001 Ga0207705_100000011242 485
266 3300025932 Ga0207690_10010719 Ga0207690_100107193 485
267 3300026067 Ga0207678_10038057 Ga0207678_100380572 485
268 3300041404 Ga0439436_0006736 Ga0439436_0006736_46_1530 485
269 3300041411 Ga0439466_0004506 Ga0439466_0004506_1999_3483 485
270 3300041999 Ga0439433_0000033 Ga0439433_0000033_10137_11621 485
271 3300042002 Ga0439442_000902 Ga0439442_000902_2148_3632 485
272 3300042006 Ga0439432_003440 Ga0439432_003440_3113_4597 485
273 3300042007 Ga0439449_0001096 Ga0439449_0001096_3033_4517 485
274 3300042010 Ga0439452_000877 Ga0439452_000877_5263_6747 485
275 3300042014 Ga0439457_005270 Ga0439457_005270_1370_2854 485
276 3300042015 Ga0439462_0000065 Ga0439462_0000065_7930_9414 485
277 3300042122 Ga0450920_000174 Ga0450920_000174_804_2288 485
278 3300042435 Ga0439434_0000086 Ga0439434_0000086_6142_7626 485
279 3300042531 Ga0450918_001669 Ga0450918_001669_520_2004 485
280 3300049586 Ga0501070_0000065 Ga0501070_0000065_54404_55927 485
281 3300049822 Ga0501035_0015909 Ga0501035_0015909_4959_6482 485
282 iso_pu_bacteria 2844841374 2844843560 485
283 iso_pu_bacteria 2919055335 2919055547 485
284 iso_pu_bacteria 2919523602 2919525680 485
285 iso_pu_bacteria 2928153084 2928153693 485
286 3300003760 Ga0055527_1000101 Ga0055527_100010154 486
287 3300003762 Ga0055542_1000246 Ga0055542_100024654 486
288 3300003763 Ga0055529_1000265 Ga0055529_100026554 486
289 3300006048 Ga0075363_100015598 Ga0075363_1000155982 486
290 3300006051 Ga0075364_10054945 Ga0075364_100549452 486
291 3300025228 Ga0209672_100152 Ga0209672_1001528 486
292 3300025242 Ga0209258_101358 Ga0209258_1013584 486
293 3300025254 Ga0209148_1000341 Ga0209148_10003418 486
294 3300025272 Ga0209455_1000258 Ga0209455_10002588 486
295 3300046473 Ga0495582_0059156 Ga0495582_0059156_478_2061 486
296 3300046475 Ga0495639_0003119 Ga0495639_0003119_3871_5454 486
297 3300046531 Ga0495665_0068845 Ga0495665_0068845_197_1780 486
298 3300046535 Ga0495586_0003992 Ga0495586_0003992_2638_4221 486
299 3300046674 Ga0495588_0045876 Ga0495588_0045876_151_1734 486
300 iso_pu_bacteria 2643221616 2644097998 486
301 iso_pu_bacteria 2884763398 2884766726 486
302 3300003752 Ga0055539_1000019 Ga0055539_1000019173 487
303 3300003756 Ga0055533_1000023 Ga0055533_1000023152 487
304 3300003759 Ga0055525_1000088 Ga0055525_100008875 487
305 3300025225 Ga0209566_100031 Ga0209566_100031152 487
306 3300025226 Ga0209674_100001 Ga0209674_1000012001 487
307 3300025230 Ga0209563_100001 Ga0209563_1000012001 487
308 3300025253 Ga0209677_100001 Ga0209677_1000012001 487
309 3300048908 Ga0496105_0032038 Ga0496105_0032038_1677_3212 487
310 3300048910 Ga0496107_0046571 Ga0496107_0046571_425_1960 487
311 3300053140 Ga0500573_0027583 Ga0500573_0027583_635_2185 487
312 iso_pu_bacteria 2945968032 2945970846 487
313 3300005288 Ga0065714_10068741 Ga0065714_100687412 488
314 3300049569 Ga0501032_0036974 Ga0501032_0036974_932_2452 488
315 3300049579 Ga0501043_0117839 Ga0501043_0117839_434_1954 488
316 3300049586 Ga0501070_0032100 Ga0501070_0032100_2568_4088 488
317 3300053080 Ga0500635_0000002 Ga0500635_0000002_211419_212954 488
318 iso_pu_bacteria 2939660829 2939661733 488
319 3300001979 JGI24740J21852_10016638 JGI24740J21852_100166382 489
320 3300001989 JGI24739J22299_10020539 JGI24739J22299_100205392 489
321 3300001990 JGI24737J22298_10002646 JGI24737J22298_100026462 489
322 3300002067 JGI24735J21928_10002653 JGI24735J21928_100026534 489
323 3300003759 Ga0055525_1002932 Ga0055525_10029321 489
324 3300020070 Ga0206356_10353036 Ga0206356_103530361 489
325 3300020081 Ga0206354_10306171 Ga0206354_103061713 489
326 3300020082 Ga0206353_11470790 Ga0206353_114707902 489
327 3300025230 Ga0209563_100155 Ga0209563_10015536 489
328 3300025253 Ga0209677_102343 Ga0209677_1023431 489
329 3300025904 Ga0207647_10086571 Ga0207647_100865712 489
330 3300037312 Ga0395899_0005815 Ga0395899_0005815_3245_4762 489
331 3300037418 Ga0395900_0191330 Ga0395900_0191330_452_1969 489
332 3300044765 Ga0466970_0009094 Ga0466970_0009094_1725_3242 489
333 3300048920 Ga0496117_0008548 Ga0496117_0008548_7123_8640 489
334 3300048925 Ga0496122_0098663 Ga0496122_0098663_387_1904 489
335 iso_pu_bacteria 2731639228 2731905905 489
336 iso_pu_bacteria 2895660088 2895660773 489
337 3300002772 JGI25164J39214_1000505 JGI25164J39214_10005059 490
338 3300003214 JGI25165J46597_1000055 JGI25165J46597_100005535 490
339 3300025231 Ga0207427_100028 Ga0207427_100028339 490
340 3300025233 Ga0209437_100619 Ga0209437_10061910 490
341 3300025261 Ga0209233_1000001 Ga0209233_1000001837 490
342 3300044683 Ga0466965_0011080 Ga0466965_0011080_1345_2868 490
343 3300044719 Ga0466971_0009191 Ga0466971_0009191_1867_3390 490
344 3300044765 Ga0466970_0006731 Ga0466970_0006731_4200_5723 490
345 3300044901 Ga0466960_0018336 Ga0466960_0018336_1514_3037 490
346 3300045049 Ga0466959_0011731 Ga0466959_0011731_502_2025 490
347 3300045836 Ga0466958_0029536 Ga0466958_0029536_1339_2862 490
348 3300048907 Ga0496104_0046455 Ga0496104_0046455_1559_3097 490
349 3300048917 Ga0496114_0084767 Ga0496114_0084767_490_2028 490
350 iso_pu_bacteria 8004025490 8004028856 490
351 3300014326 Ga0157380_10008218 Ga0157380_100082182 492
352 iso_pu_bacteria 2643221572 2643876566 492
353 iso_pu_bacteria 2643221669 2644383621 492
354 3300000549 LJQas_1000469 LJQas_10004692 493
355 3300048923 Ga0496120_0003460 Ga0496120_0003460_9693_11201 493
356 3300049568 Ga0501031_0024104 Ga0501031_0024104_1708_3249 493
357 3300049571 Ga0501034_0041746 Ga0501034_0041746_2156_3697 493
358 3300049573 Ga0501037_0112212 Ga0501037_0112212_78_1619 493
359 3300049574 Ga0501038_0019225 Ga0501038_0019225_2916_4457 493
360 3300049575 Ga0501039_0001948 Ga0501039_0001948_11234_12775 493
361 3300049579 Ga0501043_0066908 Ga0501043_0066908_1236_2777 493
362 3300049580 Ga0501046_0009785 Ga0501046_0009785_3870_5411 493
363 3300049581 Ga0501047_0036598 Ga0501047_0036598_3181_4722 493
364 3300049584 Ga0501068_0011083 Ga0501068_0011083_1703_3244 493
365 3300049822 Ga0501035_0120801 Ga0501035_0120801_705_2246 493
366 3300049823 Ga0501044_0056745 Ga0501044_0056745_1663_3204 493
367 3300049824 Ga0501045_0003745 Ga0501045_0003745_8198_9739 493
368 iso_pu_bacteria 8054107350 8054111700 493
369 iso_pu_bacteria 2585428094 2587863515 494
370 3300005288 Ga0065714_10003036 Ga0065714_1000303610 495
371 3300005335 Ga0070666_10003614 Ga0070666_100036146 495
372 3300005354 Ga0070675_100002864 Ga0070675_10000286410 495
373 3300005355 Ga0070671_100169344 Ga0070671_1001693442 495
374 3300005356 Ga0070674_100017102 Ga0070674_1000171023 495
375 3300005367 Ga0070667_100008909 Ga0070667_1000089098 495
376 3300005456 Ga0070678_100017060 Ga0070678_1000170603 495
377 3300005543 Ga0070672_100003992 Ga0070672_1000039928 495
378 3300009148 Ga0105243_10005638 Ga0105243_100056388 495
379 3300009177 Ga0105248_10117502 Ga0105248_101175021 495
380 3300013105 Ga0157369_10011101 Ga0157369_100111013 495
381 3300013308 Ga0157375_10017730 Ga0157375_100177303 495
382 3300025728 Ga0207655_1003325 Ga0207655_10033254 495
383 3300025907 Ga0207645_10003833 Ga0207645_1000383311 495
384 3300025925 Ga0207650_10005566 Ga0207650_100055663 495
385 3300025935 Ga0207709_10012536 Ga0207709_100125364 495
386 3300025937 Ga0207669_10009830 Ga0207669_100098305 495
387 3300025941 Ga0207711_10164282 Ga0207711_101642821 495
388 3300026121 Ga0207683_10013671 Ga0207683_100136714 495
389 3300047315 Ga0495581_0005085 Ga0495581_0005085_116_1729 495
390 3300048903 Ga0496100_0031815 Ga0496100_0031815_1271_2884 495
391 3300048904 Ga0496101_0007235 Ga0496101_0007235_5017_6630 495
392 3300048905 Ga0496102_0013396 Ga0496102_0013396_720_2333 495
393 3300048906 Ga0496103_0030791 Ga0496103_0030791_1271_2884 495
394 3300048907 Ga0496104_0008770 Ga0496104_0008770_7238_8851 495
395 3300048908 Ga0496105_0005681 Ga0496105_0005681_2880_4493 495
396 3300048910 Ga0496107_0007446 Ga0496107_0007446_5551_7164 495
397 3300048911 Ga0496108_0015338 Ga0496108_0015338_511_2124 495
398 3300048913 Ga0496110_0019159 Ga0496110_0019159_3758_5371 495
399 3300048914 Ga0496111_0010038 Ga0496111_0010038_511_2124 495
400 3300048915 Ga0496112_0033843 Ga0496112_0033843_383_1996 495
401 3300048916 Ga0496113_0006625 Ga0496113_0006625_3999_5612 495
402 3300048917 Ga0496114_0005796 Ga0496114_0005796_5001_6614 495
403 3300048918 Ga0496115_0024615 Ga0496115_0024615_2456_4069 495
404 3300005290 Ga0065712_10072157 Ga0065712_100721573 496
405 3300032002 Ga0307416_100020031 Ga0307416_1000200313 497
406 3300046615 Ga0495656_0000265 Ga0495656_0000265_10277_11878 497
407 3300046691 Ga0495670_0002421 Ga0495670_0002421_1047_2648 497
408 3300047318 Ga0495636_0002109 Ga0495636_0002109_3415_5016 497
409 iso_pu_bacteria 2852677369 2852678416 499
410 3300032002 Ga0307416_100081385 Ga0307416_1000813852 500
411 iso_pu_bacteria 2939598168 2939599129 511
412 3300000549 LJQas_1000433 LJQas_10004335 513

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02397

Bac_transf

Bacterial sugar transferase

390

578

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wol-assembly1.cif.gz_A crystal structure of dihydrodipicolinate reductase dapb from coxiella burnetii 0.7943 183 283
8g1n-assembly1.cif.gz_A structure of campylobacter concisus pglc i57m/q175m variant with modeled c-terminus 0.794 313 508
8g1n-assembly2.cif.gz_B structure of campylobacter concisus pglc i57m/q175m variant with modeled c-terminus 0.7895 316 508
8e37-assembly4.cif.gz_D structure of campylobacter concisus wild-type semet pglc 0.7807 313 508
8e37-assembly4.cif.gz_D structure of campylobacter concisus wild-type semet pglc 0.7732 313 508
ID Description Score Start End Superfamily
af_Q2FWL2_132_323_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8536 242 282 3.30.420.40
af_Q2G1K5_138_265_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7697 181 308 3.40.50.720
2gz3B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.766 183 280 3.40.50.720
2hjsA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7346 182 294 3.40.50.720
af_Q2G1K5_138_265_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7221 181 308 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2T6CM79-F1-model_v4 Glycosyl transferase 0.9683 315 513 GO:0016780
AF-A0A7X6XJQ9-F1-model_v4 Exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase 0.9673 315 513 GO:0016020
GO:0016780
AF-A0A3D4HH11-F1-model_v4 Glycosyl transferase 0.9642 314 513 GO:0016020
GO:0016780
AF-A0A0U5IDX4-F1-model_v4 Galactosyl transferase CpsE (EC 2.7.8.-) 0.9624 315 513 GO:0016020
GO:0016780
AF-A0A2W5XDN6-F1-model_v4 Bacterial sugar transferase domain-containing protein 0.9624 309 513 GO:0016020
GO:0016780

Feature Viewer

pLDDT pTM Quality
77.6 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map