F437900

General Info

Members Datasets Scaffolds Average Seq Length
412 286 402 142

Family's Representative Sequence

Representative Sequence 3300047445|Ga0495677_0337202|Ga0495677_0337202_73_585
Length 170
Sequence MRKRTWSTTADEHTSSKQASTFQRFLAEIFMQSIPLFHLAFPVRDLAEARRFYGDLLGCPEGRSSDEWVDFNFYGHQIVAHLAPDEVSAAPTNAVDGHNVPVRHFGAILPMEEWESLADKLRAADTRFVIEPHVRFKGQVGEQATMFFLDPSGNALEFKAFGDIGQVFAK

Samples

Sample ID Description Type Environment
1 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
2 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
3 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
4 2855730933 Achromobacter sp. HZ28 Isolate Nodule
5 2855767633 Achromobacter sp. HZ34 Isolate Nodule
6 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
7 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
8 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
56 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
79 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
80 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
83 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
86 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
126 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
127 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
128 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
129 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
140 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
141 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
142 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
143 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
145 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
146 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
147 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
148 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
149 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
153 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
161 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
162 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
163 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
164 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
165 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
166 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
169 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
170 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
171 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
172 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
173 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
174 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
175 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
176 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
177 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
178 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
179 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
180 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
181 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
182 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
183 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
184 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
185 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
186 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
187 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
188 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
189 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
190 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
191 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
192 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
193 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
194 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
195 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
196 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
197 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
198 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
199 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
200 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
201 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
202 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
203 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
204 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
205 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
206 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
207 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
208 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
209 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
210 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
211 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
212 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
213 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
214 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
215 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
216 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
217 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
218 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
219 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
220 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
221 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
222 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
223 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
224 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
225 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
226 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
227 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
228 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
229 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
230 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
231 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
237 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
238 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
239 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
240 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
241 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
242 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
243 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
244 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
245 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
246 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
247 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
248 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
249 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
254 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
255 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
256 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
257 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
258 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
259 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
260 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
261 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
262 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
263 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
264 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
266 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
267 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
268 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
269 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
270 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
271 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
272 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
273 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
274 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
275 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
276 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
277 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
278 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
279 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
280 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
281 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
282 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
283 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
284 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
285 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
286 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.57
Metatranscriptomes 0
Isolates 2.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.19
Nodule 1.7
Rhizoplane 2.91
Rhizosphere 80.34
Stem 0
Stem Tuber 0
Unclassified 4.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000065 3300003187 Bacteria 145136
2 JGI25151J46595_10003429 3300003187 Bacteria 8764
3 Ga0055526_1001853 3300003771 Bacteria 14643
4 Ga0055526_1001881 3300003771 Bacteria 14544
5 Ga0055526_1019875 3300003771 Bacteria 2423
6 Ga0055524_1012514 3300003775 Bacteria 3254
7 Ga0055536_1000942 3300003781 Bacteria 18723
8 Ga0055534_1000135 3300003784 Bacteria 55272
9 Ga0055534_1004203 3300003784 Bacteria 4247
10 Ga0065714_10073033 3300005288 Bacteria 3256
11 Ga0070658_10958988 3300005327 Bacteria 744
12 Ga0070677_10175036 3300005333 Bacteria 1018
13 Ga0070666_10161701 3300005335 Bacteria 1565
14 Ga0070682_100002178 3300005337 Bacteria 10856
15 Ga0070682_100045001 3300005337 Bacteria 2734
16 Ga0068868_100381585 3300005338 Bacteria 1213
17 Ga0068868_100694224 3300005338 Bacteria 910
18 Ga0070689_100635349 3300005340 Bacteria 927
19 Ga0070689_100740733 3300005340 Bacteria 861
20 Ga0070692_10852597 3300005345 Bacteria 626
21 Ga0070668_100080635 3300005347 Bacteria 2550
22 Ga0070669_101015288 3300005353 Bacteria 712
23 Ga0070675_100274328 3300005354 Bacteria 1481
24 Ga0070674_100252205 3300005356 Bacteria 1386
25 Ga0070673_100851502 3300005364 Bacteria 844
26 Ga0070688_100292489 3300005365 Bacteria 1174
27 Ga0070667_100281590 3300005367 Bacteria 1493
28 Ga0070714_100004717 3300005435 Bacteria 10311
29 Ga0070700_100379524 3300005441 Bacteria 1057
30 Ga0070663_100046775 3300005455 Bacteria 3063
31 Ga0070678_100159500 3300005456 Bacteria 1826
32 Ga0070662_100269225 3300005457 Bacteria 1375
33 Ga0070662_100790977 3300005457 Bacteria 806
34 Ga0068867_100155915 3300005459 Bacteria 1797
35 Ga0068867_100387136 3300005459 Bacteria 1176
36 Ga0070685_11296879 3300005466 Bacteria 556
37 Ga0070707_100854754 3300005468 Bacteria 874
38 Ga0070672_100671262 3300005543 Bacteria 906
39 Ga0070672_100781793 3300005543 Bacteria 839
40 Ga0070693_100205804 3300005547 Bacteria 1281
41 Ga0070693_100294426 3300005547 Bacteria 1091
42 Ga0070693_101299234 3300005547 Bacteria 562
43 Ga0070665_100578658 3300005548 Bacteria 1136
44 Ga0068855_100007211 3300005563 Bacteria 13487
45 Ga0068852_100046536 3300005616 Bacteria 3697
46 Ga0068866_10592608 3300005718 Bacteria 747
47 Ga0068866_10598251 3300005718 Bacteria 744
48 Ga0068861_100015541 3300005719 Bacteria 5367
49 Ga0068858_100000589 3300005842 Bacteria 38060
50 Ga0070717_10402320 3300006028 Bacteria 1230
51 Ga0075363_100159952 3300006048 Bacteria 1275
52 Ga0075364_10007777 3300006051 Bacteria 6386
53 Ga0075432_10093911 3300006058 Bacteria 1101
54 Ga0075362_10005656 3300006177 Bacteria 4593
55 Ga0075366_10005689 3300006195 Bacteria 6763
56 Ga0075366_10043785 3300006195 Bacteria 2652
57 Ga0075366_10635527 3300006195 Bacteria 662
58 Ga0097621_100167966 3300006237 Bacteria 1889
59 Ga0075370_10600230 3300006353 Bacteria 667
60 Ga0068865_100199663 3300006881 Bacteria 1552
61 Ga0075436_100099944 3300006914 Bacteria 2020
62 Ga0075436_100330286 3300006914 Bacteria 1096
63 Ga0099826_10000011 3300006948 Bacteria 287659
64 Ga0105251_10158650 3300009011 Bacteria 1020
65 Ga0105240_10011877 3300009093 Bacteria 12085
66 Ga0105240_10523513 3300009093 Bacteria 1315
67 Ga0111539_10050234 3300009094 Bacteria 4968
68 Ga0105245_10238283 3300009098 Bacteria 1762
69 Ga0105241_11290907 3300009174 Bacteria 695
70 Ga0105242_10002633 3300009176 Bacteria 14068
71 Ga0105242_10120170 3300009176 Bacteria 2253
72 Ga0105242_10141099 3300009176 Bacteria 2091
73 Ga0105242_11684313 3300009176 Bacteria 670
74 Ga0105248_10350108 3300009177 Bacteria 1663
75 Ga0105237_10005304 3300009545 Bacteria 14579
76 Ga0105238_10011049 3300009551 Bacteria 9079
77 Ga0105238_10586250 3300009551 Bacteria 1122
78 Ga0105238_10942583 3300009551 Bacteria 883
79 Ga0105239_10005149 3300010375 Bacteria 15440
80 Ga0105246_10457305 3300011119 Bacteria 1074
81 Ga0157371_10000060 3300013102 Bacteria 170456
82 Ga0157370_10001450 3300013104 Bacteria 29357
83 Ga0157370_10007835 3300013104 Bacteria 11576
84 Ga0157378_10374872 3300013297 Bacteria 1396
85 Ga0163162_10005231 3300013306 Bacteria 12511
86 Ga0163162_10013170 3300013306 Bacteria 8077
87 Ga0163162_10079907 3300013306 Bacteria 3337
88 Ga0163162_10297440 3300013306 Bacteria 1746
89 Ga0157375_10238690 3300013308 Bacteria 1977
90 Ga0163163_10033520 3300014325 Bacteria 4968
91 Ga0157380_10874889 3300014326 Bacteria 922
92 Ga0157380_12603010 3300014326 Bacteria 572
93 Ga0182008_10034088 3300014497 Bacteria 2553
94 Ga0157379_10079514 3300014968 Bacteria 2936
95 Ga0157379_10673824 3300014968 Bacteria 969
96 Ga0157376_12035610 3300014969 Bacteria 612
97 Ga0163161_10008518 3300017792 Bacteria 7099
98 Ga0163161_10257129 3300017792 Bacteria 1363
99 Ga0213872_10020302 3300021361 Bacteria 3061
100 Ga0213874_10011832 3300021377 Bacteria 2222
101 Ga0209565_1000109 3300025263 Bacteria 120345
102 Ga0209673_1007883 3300025273 Bacteria 4817
103 Ga0209130_1013179 3300025284 Bacteria 2128
104 Ga0209675_1000026 3300025291 Bacteria 284716
105 Ga0209675_1000118 3300025291 Bacteria 110507
106 Ga0209676_1000059 3300025292 Bacteria 344882
107 Ga0209025_1000066 3300025294 Bacteria 298742
108 Ga0209025_1000071 3300025294 Bacteria 287297
109 Ga0209025_1000159 3300025294 Bacteria 167081
110 Ga0209564_1000663 3300025295 Bacteria 50906
111 Ga0209564_1000715 3300025295 Bacteria 47835
112 Ga0209564_1004238 3300025295 Bacteria 8915
113 Ga0209256_1001659 3300025299 Bacteria 21633
114 Ga0209051_1053957 3300025303 Bacteria 1316
115 Ga0209051_1082205 3300025303 Bacteria 925
116 Ga0207713_1049446 3300025735 Bacteria 1685
117 Ga0207642_10722649 3300025899 Bacteria 629
118 Ga0207688_10092887 3300025901 Bacteria 1734
119 Ga0207680_10524822 3300025903 Bacteria 844
120 Ga0207680_10529885 3300025903 Bacteria 840
121 Ga0207705_10073220 3300025909 Bacteria 2485
122 Ga0207705_10784312 3300025909 Bacteria 740
123 Ga0207695_10010425 3300025913 Bacteria 11369
124 Ga0207695_10282439 3300025913 Bacteria 1554
125 Ga0207671_10002510 3300025914 Bacteria 19582
126 Ga0207652_10264392 3300025921 Bacteria 1552
127 Ga0207646_11072032 3300025922 Bacteria 710
128 Ga0207694_10018042 3300025924 Bacteria 5335
129 Ga0207694_10123985 3300025924 Bacteria 2065
130 Ga0207694_10195274 3300025924 Bacteria 1645
131 Ga0207694_10207505 3300025924 Bacteria 1595
132 Ga0207659_10528190 3300025926 Bacteria 1001
133 Ga0207687_11214800 3300025927 Bacteria 648
134 Ga0207706_10120799 3300025933 Bacteria 2304
135 Ga0207686_10024079 3300025934 Bacteria 3522
136 Ga0207686_10085160 3300025934 Bacteria 2073
137 Ga0207686_10781981 3300025934 Bacteria 764
138 Ga0207670_10608765 3300025936 Bacteria 898
139 Ga0207670_10815329 3300025936 Bacteria 778
140 Ga0207669_10393803 3300025937 Bacteria 1083
141 Ga0207704_10087508 3300025938 Bacteria 2035
142 Ga0207704_10308560 3300025938 Bacteria 1215
143 Ga0207691_10199050 3300025940 Bacteria 1744
144 Ga0207711_10154430 3300025941 Bacteria 2073
145 Ga0207667_10085155 3300025949 Bacteria 3272
146 Ga0207651_10279412 3300025960 Bacteria 1379
147 Ga0207712_10020533 3300025961 Bacteria 4326
148 Ga0207668_10068017 3300025972 Bacteria 2531
149 Ga0207640_11212101 3300025981 Bacteria 671
150 Ga0207658_10288908 3300025986 Bacteria 1408
151 Ga0207677_10604736 3300026023 Bacteria 962
152 Ga0207703_10058588 3300026035 Bacteria 3144
153 Ga0207678_10133086 3300026067 Bacteria 2121
154 Ga0207708_10803983 3300026075 Bacteria 810
155 Ga0207708_12024406 3300026075 Bacteria 504
156 Ga0207648_10183258 3300026089 Bacteria 1854
157 Ga0207648_10361934 3300026089 Bacteria 1309
158 Ga0207675_100005476 3300026118 Bacteria 12159
159 Ga0207675_101707517 3300026118 Bacteria 649
160 Ga0207683_10043524 3300026121 Bacteria 3924
161 Ga0207683_10086802 3300026121 Bacteria 2782
162 Ga0207683_10107295 3300026121 Bacteria 2498
163 Ga0207698_10121211 3300026142 Bacteria 2214
164 Ga0207698_11619641 3300026142 Bacteria 663
165 Ga0209282_1000056 3300027666 Bacteria 100584
166 Ga0268266_10551614 3300028379 Bacteria 1104
167 Ga0268265_11102005 3300028380 Bacteria 788
168 Ga0307515_10340672 3300028794 Bacteria 1152
169 Ga0316177_1213926 3300030731 Bacteria 3021
170 Ga0316178_1011118 3300030735 Bacteria 9249
171 Ga0265330_10065796 3300031235 Bacteria 1573
172 Ga0265340_10000159 3300031247 Bacteria 34106
173 Ga0307408_100182231 3300031548 Bacteria 1685
174 Ga0307408_100323472 3300031548 Bacteria 1300
175 Ga0307405_10050322 3300031731 Bacteria 2579
176 Ga0307413_10604870 3300031824 Bacteria 898
177 Ga0307410_10555179 3300031852 Unclassified 952
178 Ga0307410_10859961 3300031852 Bacteria 775
179 Ga0307406_10031411 3300031901 Bacteria 3234
180 Ga0307409_100805384 3300031995 Bacteria 947
181 Ga0307409_101675675 3300031995 Bacteria 664
182 Ga0307414_10262012 3300032004 Bacteria 1443
183 Ga0307411_10070409 3300032005 Bacteria 2367
184 Ga0307411_10919601 3300032005 Bacteria 778
185 Ga0307415_100011650 3300032126 Bacteria 5044
186 Ga0373930_0005405 3300034816 Bacteria 2124
187 Ga0373926_0112955 3300035083 Bacteria 1021
188 Ga0373934_0000243 3300035086 Bacteria 19594
189 Ga0373934_0131859 3300035086 Bacteria 1019
190 Ga0373944_0277405 3300035089 Bacteria 624
191 Ga0373923_0012284 3300035111 Bacteria 3160
192 Ga0373953_0010519 3300035117 Bacteria 3222
193 Ga0373953_0013942 3300035117 Bacteria 2881
194 Ga0373954_0006295 3300035118 Bacteria 5174
195 Ga0373954_0008365 3300035118 Bacteria 4538
196 Ga0373954_0030569 3300035118 Bacteria 2483
197 Ga0373954_0038102 3300035118 Bacteria 2235
198 Ga0373956_0000029 3300035119 Bacteria 45843
199 Ga0373957_0001375 3300035120 Bacteria 6556
200 Ga0373957_0007067 3300035120 Bacteria 3571
201 Ga0373955_0033776 3300035172 Bacteria 2696
202 Ga0373924_0004115 3300035410 Bacteria 5061
203 Ga0373931_0096157 3300035691 Bacteria 1659
204 Ga0373931_0125821 3300035691 Bacteria 1470
205 Ga0373935_0015248 3300035692 Bacteria 4643
206 Ga0373927_0020808 3300035695 Bacteria 4300
207 Ga0373933_0000579 3300035724 Bacteria 22962
208 Ga0373933_0015773 3300035724 Bacteria 4214
209 Ga0373933_0044031 3300035724 Bacteria 2642
210 Ga0373947_0299823 3300035725 Bacteria 1071
211 Ga0373937_0000441 3300036401 Bacteria 38394
212 Ga0373937_0018566 3300036401 Bacteria 6212
213 Ga0373937_0468726 3300036401 Bacteria 1196
214 Ga0395899_0236231 3300037312 Bacteria 1260
215 Ga0395900_0133120 3300037418 Bacteria 2547
216 Ga0395898_0069437 3300037466 Bacteria 3409
217 Ga0395905_0726998 3300037471 Bacteria 895
218 Ga0436364_0776345 3300037853 Bacteria 922
219 Ga0436365_0255624 3300039437 Bacteria 2215
220 Ga0436361_0760266 3300039447 Bacteria 1114
221 Ga0436361_0959402 3300039447 Bacteria 9187
222 Ga0436363_1255904 3300039450 Bacteria 6631
223 Ga0451793_1616509 3300041452 Bacteria 668
224 Ga0451853_3763280 3300041512 Bacteria 559
225 Ga0439459_0009584 3300042438 Bacteria 1676
226 Ga0451576_1829366 3300045051 Bacteria 627
227 Ga0495592_0001747 3300046454 Bacteria 15259
228 Ga0495592_0007755 3300046454 Bacteria 8042
229 Ga0495592_0029296 3300046454 Bacteria 4169
230 Ga0495592_0137208 3300046454 Bacteria 1705
231 Ga0495590_0046396 3300046457 Bacteria 1516
232 Ga0495638_0092496 3300046460 Bacteria 1820
233 Ga0495638_0121902 3300046460 Bacteria 1539
234 Ga0495641_0007083 3300046461 Bacteria 7099
235 Ga0495651_0000356 3300046462 Bacteria 35210
236 Ga0495651_0022011 3300046462 Bacteria 4956
237 Ga0495651_0356470 3300046462 Bacteria 965
238 Ga0495580_0006213 3300046472 Bacteria 9759
239 Ga0495580_0029055 3300046472 Bacteria 4015
240 Ga0495580_0592106 3300046472 Bacteria 733
241 Ga0495605_0002092 3300046474 Bacteria 12525
242 Ga0495605_0041316 3300046474 Bacteria 2297
243 Ga0495639_0010775 3300046475 Bacteria 3934
244 Ga0495662_0009192 3300046476 Bacteria 4849
245 Ga0495664_0314533 3300046477 Bacteria 944
246 Ga0495584_0120744 3300046491 Bacteria 1327
247 Ga0495594_0584208 3300046499 Bacteria 633
248 Ga0495596_0000151 3300046500 Bacteria 48207
249 Ga0495607_0020721 3300046501 Bacteria 4150
250 Ga0495583_0000988 3300046506 Bacteria 32598
251 Ga0495610_0000328 3300046512 Bacteria 50375
252 Ga0495616_0000351 3300046513 Bacteria 36157
253 Ga0495616_0005684 3300046513 Bacteria 7639
254 Ga0495628_0004166 3300046516 Bacteria 12869
255 Ga0495628_0014489 3300046516 Bacteria 6608
256 Ga0495628_0018943 3300046516 Bacteria 5695
257 Ga0495630_0011866 3300046517 Bacteria 6316
258 Ga0495631_0266504 3300046518 Bacteria 730
259 Ga0495643_0001603 3300046522 Bacteria 20026
260 Ga0495644_0046931 3300046523 Bacteria 1623
261 Ga0495648_0435498 3300046524 Bacteria 577
262 Ga0495666_0064222 3300046526 Bacteria 1752
263 Ga0495642_0028950 3300046528 Bacteria 2209
264 Ga0495642_0044915 3300046528 Bacteria 1804
265 Ga0495652_0004306 3300046529 Bacteria 13640
266 Ga0495652_0089302 3300046529 Bacteria 2523
267 Ga0495654_0088596 3300046530 Bacteria 1439
268 Ga0495654_0089525 3300046530 Bacteria 1430
269 Ga0495640_0076661 3300046533 Bacteria 2230
270 Ga0495587_0021758 3300046536 Bacteria 3956
271 Ga0495587_0286172 3300046536 Bacteria 923
272 Ga0495609_0086049 3300046538 Bacteria 1370
273 Ga0495597_0045707 3300046542 Bacteria 1942
274 Ga0495645_0000609 3300046543 Bacteria 24694
275 Ga0495633_0231400 3300046558 Bacteria 845
276 Ga0495667_0006380 3300046559 Bacteria 7994
277 Ga0495667_0317840 3300046559 Bacteria 985
278 Ga0495656_0120605 3300046615 Bacteria 1237
279 Ga0495656_0299563 3300046615 Bacteria 824
280 Ga0495656_0396511 3300046615 Bacteria 721
281 Ga0495634_0055888 3300046642 Bacteria 2638
282 Ga0495635_0479360 3300046663 Bacteria 820
283 Ga0495661_0023998 3300046665 Bacteria 3951
284 Ga0495661_0074285 3300046665 Bacteria 1979
285 Ga0495588_0703121 3300046674 Bacteria 529
286 Ga0495657_0013800 3300046675 Bacteria 5946
287 Ga0495657_0088760 3300046675 Bacteria 1987
288 Ga0495599_0001013 3300046678 Bacteria 15801
289 Ga0495599_0036993 3300046678 Bacteria 3067
290 Ga0495647_0002196 3300046681 Bacteria 6103
291 Ga0495658_0129309 3300046683 Bacteria 1535
292 Ga0495624_0442838 3300046690 Bacteria 778
293 Ga0495670_0030248 3300046691 Bacteria 2690
294 Ga0495671_0001007 3300046692 Bacteria 19605
295 Ga0495649_0067323 3300046694 Bacteria 1921
296 Ga0495649_0123914 3300046694 Bacteria 1365
297 Ga0495589_0059671 3300046794 Bacteria 1874
298 Ga0495589_0182441 3300046794 Bacteria 995
299 Ga0495600_0000657 3300046809 Bacteria 17939
300 Ga0495600_0239282 3300046809 Bacteria 1157
301 Ga0495660_0384240 3300046810 Bacteria 618
302 Ga0495660_0390797 3300046810 Bacteria 611
303 Ga0495581_0060071 3300047315 Bacteria 2197
304 Ga0495604_0005804 3300047317 Bacteria 9794
305 Ga0495604_0074579 3300047317 Bacteria 2556
306 Ga0495604_0126381 3300047317 Bacteria 1843
307 Ga0495636_0110032 3300047318 Bacteria 1212
308 Ga0495674_0052241 3300047319 Bacteria 3598
309 Ga0495672_0275808 3300047320 Bacteria 805
310 Ga0495680_0045682 3300047322 Bacteria 3457
311 Ga0495680_0271562 3300047322 Bacteria 1197
312 Ga0495680_0487619 3300047322 Bacteria 838
313 Ga0495675_0073997 3300047444 Bacteria 2148
314 Ga0495675_0133584 3300047444 Bacteria 1541
315 Ga0495677_0117693 3300047445 Bacteria 1012
316 Ga0495677_0337202 3300047445 Bacteria 595
317 Ga0495685_101407 3300047447 Bacteria 950
318 Ga0495684_0028949 3300047471 Bacteria 4250
319 Ga0495686_0000012 3300047472 Bacteria 508428
320 Ga0495602_0704380 3300048088 Bacteria 685
321 Ga0495626_0000044 3300048091 Bacteria 165533
322 Ga0495626_0002425 3300048091 Bacteria 12948
323 Ga0495626_0014747 3300048091 Bacteria 4018
324 Ga0496100_0202485 3300048903 Bacteria 1447
325 Ga0496102_0044287 3300048905 Bacteria 4038
326 Ga0496104_0027782 3300048907 Bacteria 5237
327 Ga0496105_0063992 3300048908 Bacteria 3034
328 Ga0496105_0990820 3300048908 Bacteria 629
329 Ga0496106_0965088 3300048909 Bacteria 671
330 Ga0496108_0631049 3300048911 Bacteria 932
331 Ga0496109_0757090 3300048912 Bacteria 909
332 Ga0496110_0065678 3300048913 Bacteria 3208
333 Ga0496113_0194986 3300048916 Bacteria 1609
334 Ga0496114_0161716 3300048917 Bacteria 1947
335 Ga0496116_0002072 3300048919 Bacteria 21455
336 Ga0496121_0021834 3300048924 Bacteria 6251
337 Ga0496121_0085613 3300048924 Bacteria 2480
338 Ga0496122_0001123 3300048925 Bacteria 46098
339 Ga0496122_0143105 3300048925 Bacteria 1492
340 Ga0496123_0000957 3300048926 Bacteria 44790
341 Ga0496124_0000007 3300048927 Bacteria 883534
342 Ga0496125_0102993 3300048928 Bacteria 2096
343 Ga0496125_0194611 3300048928 Bacteria 1335
344 Ga0496126_0197475 3300048929 Bacteria 1701
345 Ga0501299_220476 3300049522 Bacteria 512
346 Ga0501034_0269692 3300049571 Bacteria 1643
347 Ga0501034_1074222 3300049571 Bacteria 687
348 Ga0501039_1215657 3300049575 Bacteria 583
349 Ga0501046_1024016 3300049580 Bacteria 572
350 Ga0501047_0004029 3300049581 Bacteria 13816
351 Ga0501047_0004469 3300049581 Bacteria 13159
352 Ga0501047_0126604 3300049581 Bacteria 2435
353 Ga0501067_0015446 3300049583 Bacteria 4227
354 Ga0501067_0871008 3300049583 Bacteria 508
355 Ga0501068_0063849 3300049584 Bacteria 2240
356 Ga0501068_0150906 3300049584 Bacteria 1460
357 Ga0501069_0690773 3300049585 Bacteria 615
358 Ga0501070_0070247 3300049586 Bacteria 2900
359 Ga0501070_0078606 3300049586 Bacteria 2730
360 Ga0501072_0016454 3300049588 Bacteria 5678
361 Ga0501072_0047312 3300049588 Bacteria 3387
362 Ga0501073_0000686 3300049589 Bacteria 23798
363 Ga0501073_0015989 3300049589 Bacteria 5438
364 Ga0501073_0205693 3300049589 Bacteria 1361
365 Ga0501074_0002270 3300049590 Bacteria 13365
366 Ga0501074_0134159 3300049590 Bacteria 1771
367 Ga0501074_1049741 3300049590 Bacteria 573
368 Ga0501076_0343254 3300049592 Bacteria 1226
369 Ga0501079_0003490 3300049741 Bacteria 11556
370 Ga0501079_0165513 3300049741 Bacteria 1724
371 Ga0501080_0025389 3300049742 Bacteria 5498
372 Ga0501080_0151206 3300049742 Bacteria 2145
373 Ga0501080_0278383 3300049742 Bacteria 1521
374 Ga0501080_0282084 3300049742 Bacteria 1510
375 Ga0501080_0319988 3300049742 Bacteria 1404
376 Ga0501083_0028844 3300049744 Bacteria 3823
377 Ga0501035_0893297 3300049822 Bacteria 704
378 Ga0501035_1073553 3300049822 Bacteria 630
379 Ga0501044_0094663 3300049823 Bacteria 3011
380 Ga0501044_0406755 3300049823 Bacteria 1273
381 Ga0501044_0571167 3300049823 Unclassified 1026
382 nmdc:mga00v17_28553_c1 3300050491 Bacteria 3268
383 nmdc:mga07m45_805716_c1 3300050496 Bacteria 538
384 nmdc:mga08y16_367321_c1 3300050511 Bacteria 1476
385 nmdc:mga08x19_354853_c1 3300050514 Bacteria 1024
386 Ga0495601_0014358 3300053077 Bacteria 4771
387 Ga0495601_0127247 3300053077 Bacteria 1657
388 Ga0495601_0800105 3300053077 Bacteria 598
389 Ga0495612_0144006 3300053078 Bacteria 1035
390 Ga0495595_0004712 3300053084 Bacteria 5487
391 Ga0495619_0202807 3300053085 Bacteria 1373
392 Ga0500644_0008663 3300053088 Bacteria 2691
393 Ga0500641_0433445 3300053096 Bacteria 510
394 Ga0500650_0002028 3300053098 Bacteria 6487
395 Ga0500608_009562 3300053122 Bacteria 4123
396 Ga0500618_030662 3300053125 Bacteria 1264
397 Ga0500628_002835 3300053129 Bacteria 2849
398 Ga0500559_0086538 3300053136 Bacteria 1430
399 Ga0500568_0180804 3300053139 Bacteria 775
400 Ga0501084_0058502 3300054114 Bacteria 3225
401 Ga0500661_003730 3300055283 Bacteria 2859
402 Ga0501082_0016837 3300060353 Bacteria 6295

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005719 Ga0068861_100015541 Ga0068861_1000155415 128
2 3300014325 Ga0163163_10033520 Ga0163163_100335202 128
3 3300025961 Ga0207712_10020533 Ga0207712_100205334 128
4 3300026118 Ga0207675_100005476 Ga0207675_10000547614 128
5 3300028380 Ga0268265_11102005 Ga0268265_111020052 128
6 iso_pu_bacteria 2834641062 2834643676 136
7 iso_pu_bacteria 2855730933 2855735212 136
8 iso_pu_bacteria 2855767633 2855770996 136
9 iso_pu_bacteria 2881412998 2881418380 136
10 iso_pu_bacteria 8003400568 8003405062 136
11 3300046500 Ga0495596_0000151 Ga0495596_0000151_7930_8343 137
12 3300046512 Ga0495610_0000328 Ga0495610_0000328_39862_40275 137
13 3300046665 Ga0495661_0023998 Ga0495661_0023998_3415_3828 137
14 3300046694 Ga0495649_0123914 Ga0495649_0123914_367_780 137
15 3300005435 Ga0070714_100004717 Ga0070714_10000471711 138
16 3300005457 Ga0070662_100269225 Ga0070662_1002692252 138
17 3300005543 Ga0070672_100781793 Ga0070672_1007817931 138
18 3300005547 Ga0070693_101299234 Ga0070693_1012992341 138
19 3300006028 Ga0070717_10402320 Ga0070717_104023202 138
20 3300006058 Ga0075432_10093911 Ga0075432_100939112 138
21 3300006914 Ga0075436_100099944 Ga0075436_1000999442 138
22 3300009094 Ga0111539_10050234 Ga0111539_100502343 138
23 3300025933 Ga0207706_10120799 Ga0207706_101207992 138
24 3300031235 Ga0265330_10065796 Ga0265330_100657962 138
25 3300031247 Ga0265340_10000159 Ga0265340_1000015913 138
26 3300031548 Ga0307408_100182231 Ga0307408_1001822312 138
27 3300031852 Ga0307410_10555179 Ga0307410_105551792 138
28 3300031901 Ga0307406_10031411 Ga0307406_100314112 138
29 3300031995 Ga0307409_100805384 Ga0307409_1008053841 138
30 3300031995 Ga0307409_101675675 Ga0307409_1016756751 138
31 3300032004 Ga0307414_10262012 Ga0307414_102620122 138
32 3300032005 Ga0307411_10070409 Ga0307411_100704092 138
33 3300032126 Ga0307415_100011650 Ga0307415_1000116501 138
34 3300049522 Ga0501299_220476 Ga0501299_220476_35_454 138
35 3300050511 nmdc:mga08y16_367321_c1 nmdc:mga08y16_367321_c1_801_1232 138
36 3300005288 Ga0065714_10073033 Ga0065714_100730333 139
37 3300005333 Ga0070677_10175036 Ga0070677_101750361 139
38 3300005335 Ga0070666_10161701 Ga0070666_101617012 139
39 3300005338 Ga0068868_100694224 Ga0068868_1006942241 139
40 3300005347 Ga0070668_100080635 Ga0070668_1000806353 139
41 3300005353 Ga0070669_101015288 Ga0070669_1010152881 139
42 3300005718 Ga0068866_10598251 Ga0068866_105982511 139
43 3300006048 Ga0075363_100159952 Ga0075363_1001599523 139
44 3300006177 Ga0075362_10005656 Ga0075362_100056564 139
45 3300006195 Ga0075366_10635527 Ga0075366_106355272 139
46 3300006237 Ga0097621_100167966 Ga0097621_1001679663 139
47 3300009174 Ga0105241_11290907 Ga0105241_112909071 139
48 3300009176 Ga0105242_10141099 Ga0105242_101410992 139
49 3300009551 Ga0105238_10586250 Ga0105238_105862501 139
50 3300011119 Ga0105246_10457305 Ga0105246_104573052 139
51 3300013306 Ga0163162_10013170 Ga0163162_100131707 139
52 3300013308 Ga0157375_10238690 Ga0157375_102386903 139
53 3300014497 Ga0182008_10034088 Ga0182008_100340882 139
54 3300014968 Ga0157379_10673824 Ga0157379_106738242 139
55 3300014969 Ga0157376_12035610 Ga0157376_120356101 139
56 3300017792 Ga0163161_10008518 Ga0163161_1000851810 139
57 3300025903 Ga0207680_10529885 Ga0207680_105298852 139
58 3300025924 Ga0207694_10207505 Ga0207694_102075053 139
59 3300025934 Ga0207686_10085160 Ga0207686_100851603 139
60 3300025940 Ga0207691_10199050 Ga0207691_101990503 139
61 3300025972 Ga0207668_10068017 Ga0207668_100680172 139
62 3300026023 Ga0207677_10604736 Ga0207677_106047362 139
63 3300026121 Ga0207683_10107295 Ga0207683_101072952 139
64 3300030731 Ga0316177_1213926 Ga0316177_12139262 139
65 3300041452 Ga0451793_1616509 Ga0451793_1616509_207_638 139
66 3300046615 Ga0495656_0120605 Ga0495656_0120605_52_483 139
67 3300046810 Ga0495660_0384240 Ga0495660_0384240_131_562 139
68 3300048903 Ga0496100_0202485 Ga0496100_0202485_949_1380 139
69 3300048905 Ga0496102_0044287 Ga0496102_0044287_2123_2554 139
70 3300048907 Ga0496104_0027782 Ga0496104_0027782_2980_3411 139
71 3300048908 Ga0496105_0063992 Ga0496105_0063992_1029_1460 139
72 3300048908 Ga0496105_0990820 Ga0496105_0990820_188_619 139
73 3300048909 Ga0496106_0965088 Ga0496106_0965088_25_456 139
74 3300048911 Ga0496108_0631049 Ga0496108_0631049_247_678 139
75 3300048912 Ga0496109_0757090 Ga0496109_0757090_128_559 139
76 3300048913 Ga0496110_0065678 Ga0496110_0065678_1705_2136 139
77 3300048916 Ga0496113_0194986 Ga0496113_0194986_751_1182 139
78 3300048917 Ga0496114_0161716 Ga0496114_0161716_14_445 139
79 3300049571 Ga0501034_0269692 Ga0501034_0269692_683_1102 139
80 3300049575 Ga0501039_1215657 Ga0501039_1215657_20_448 139
81 3300049581 Ga0501047_0004469 Ga0501047_0004469_11335_11754 139
82 3300049583 Ga0501067_0015446 Ga0501067_0015446_1501_1920 139
83 3300049584 Ga0501068_0150906 Ga0501068_0150906_142_561 139
84 3300049585 Ga0501069_0690773 Ga0501069_0690773_93_512 139
85 3300049586 Ga0501070_0078606 Ga0501070_0078606_770_1189 139
86 3300049588 Ga0501072_0016454 Ga0501072_0016454_1233_1652 139
87 3300049588 Ga0501072_0047312 Ga0501072_0047312_193_612 139
88 3300049589 Ga0501073_0015989 Ga0501073_0015989_1233_1652 139
89 3300049590 Ga0501074_0134159 Ga0501074_0134159_620_1039 139
90 3300049741 Ga0501079_0165513 Ga0501079_0165513_480_899 139
91 3300049742 Ga0501080_0151206 Ga0501080_0151206_905_1324 139
92 3300049742 Ga0501080_0319988 Ga0501080_0319988_705_1124 139
93 3300053088 Ga0500644_0008663 Ga0500644_0008663_29_466 139
94 3300053096 Ga0500641_0433445 Ga0500641_0433445_18_455 139
95 3300053098 Ga0500650_0002028 Ga0500650_0002028_4278_4715 139
96 3300053122 Ga0500608_009562 Ga0500608_009562_2549_2980 139
97 3300053125 Ga0500618_030662 Ga0500618_030662_511_951 139
98 3300053129 Ga0500628_002835 Ga0500628_002835_1576_2013 139
99 3300053139 Ga0500568_0180804 Ga0500568_0180804_172_609 139
100 3300054114 Ga0501084_0058502 Ga0501084_0058502_1682_2101 139
101 3300055283 Ga0500661_003730 Ga0500661_003730_733_1170 139
102 iso_pu_bacteria 2513237150 2513952230 139
103 iso_pu_bacteria 2513237165 2514044818 139
104 iso_pu_bacteria 2901300506 2901302997 139
105 iso_pu_bacteria 644736347 644751208 139
106 3300003187 JGI25151J46595_10003429 JGI25151J46595_100034296 140
107 3300003771 Ga0055526_1001853 Ga0055526_10018533 140
108 3300003771 Ga0055526_1001881 Ga0055526_10018813 140
109 3300003781 Ga0055536_1000942 Ga0055536_10009421 140
110 3300003784 Ga0055534_1004203 Ga0055534_10042035 140
111 3300005327 Ga0070658_10958988 Ga0070658_109589881 140
112 3300005337 Ga0070682_100002178 Ga0070682_1000021781 140
113 3300005337 Ga0070682_100045001 Ga0070682_1000450014 140
114 3300005338 Ga0068868_100381585 Ga0068868_1003815852 140
115 3300005340 Ga0070689_100635349 Ga0070689_1006353492 140
116 3300005340 Ga0070689_100740733 Ga0070689_1007407332 140
117 3300005345 Ga0070692_10852597 Ga0070692_108525971 140
118 3300005354 Ga0070675_100274328 Ga0070675_1002743281 140
119 3300005356 Ga0070674_100252205 Ga0070674_1002522052 140
120 3300005364 Ga0070673_100851502 Ga0070673_1008515022 140
121 3300005365 Ga0070688_100292489 Ga0070688_1002924891 140
122 3300005367 Ga0070667_100281590 Ga0070667_1002815902 140
123 3300005441 Ga0070700_100379524 Ga0070700_1003795241 140
124 3300005455 Ga0070663_100046775 Ga0070663_1000467751 140
125 3300005456 Ga0070678_100159500 Ga0070678_1001595002 140
126 3300005457 Ga0070662_100790977 Ga0070662_1007909771 140
127 3300005459 Ga0068867_100155915 Ga0068867_1001559152 140
128 3300005466 Ga0070685_11296879 Ga0070685_112968791 140
129 3300005468 Ga0070707_100854754 Ga0070707_1008547542 140
130 3300005543 Ga0070672_100671262 Ga0070672_1006712622 140
131 3300005547 Ga0070693_100205804 Ga0070693_1002058043 140
132 3300005548 Ga0070665_100578658 Ga0070665_1005786582 140
133 3300005563 Ga0068855_100007211 Ga0068855_1000072119 140
134 3300005718 Ga0068866_10592608 Ga0068866_105926081 140
135 3300006051 Ga0075364_10007777 Ga0075364_100077772 140
136 3300006195 Ga0075366_10005689 Ga0075366_100056895 140
137 3300006881 Ga0068865_100199663 Ga0068865_1001996631 140
138 3300006914 Ga0075436_100330286 Ga0075436_1003302862 140
139 3300006948 Ga0099826_10000011 Ga0099826_1000001179 140
140 3300009011 Ga0105251_10158650 Ga0105251_101586502 140
141 3300009093 Ga0105240_10011877 Ga0105240_100118778 140
142 3300009098 Ga0105245_10238283 Ga0105245_102382832 140
143 3300009176 Ga0105242_10120170 Ga0105242_101201702 140
144 3300009176 Ga0105242_11684313 Ga0105242_116843132 140
145 3300009545 Ga0105237_10005304 Ga0105237_1000530412 140
146 3300009551 Ga0105238_10011049 Ga0105238_100110496 140
147 3300010375 Ga0105239_10005149 Ga0105239_1000514911 140
148 3300013104 Ga0157370_10001450 Ga0157370_1000145012 140
149 3300013104 Ga0157370_10007835 Ga0157370_1000783510 140
150 3300013306 Ga0163162_10005231 Ga0163162_100052317 140
151 3300013306 Ga0163162_10079907 Ga0163162_100799073 140
152 3300014326 Ga0157380_12603010 Ga0157380_126030101 140
153 3300021361 Ga0213872_10020302 Ga0213872_100203022 140
154 3300021377 Ga0213874_10011832 Ga0213874_100118324 140
155 3300025284 Ga0209130_1013179 Ga0209130_10131792 140
156 3300025291 Ga0209675_1000026 Ga0209675_1000026223 140
157 3300025292 Ga0209676_1000059 Ga0209676_100005983 140
158 3300025294 Ga0209025_1000066 Ga0209025_1000066246 140
159 3300025294 Ga0209025_1000071 Ga0209025_100007135 140
160 3300025295 Ga0209564_1000715 Ga0209564_100071537 140
161 3300025295 Ga0209564_1004238 Ga0209564_100423810 140
162 3300025303 Ga0209051_1082205 Ga0209051_10822052 140
163 3300025735 Ga0207713_1049446 Ga0207713_10494461 140
164 3300025899 Ga0207642_10722649 Ga0207642_107226492 140
165 3300025901 Ga0207688_10092887 Ga0207688_100928872 140
166 3300025913 Ga0207695_10010425 Ga0207695_100104257 140
167 3300025914 Ga0207671_10002510 Ga0207671_1000251011 140
168 3300025922 Ga0207646_11072032 Ga0207646_110720321 140
169 3300025924 Ga0207694_10018042 Ga0207694_100180425 140
170 3300025926 Ga0207659_10528190 Ga0207659_105281902 140
171 3300025927 Ga0207687_11214800 Ga0207687_112148002 140
172 3300025934 Ga0207686_10781981 Ga0207686_107819812 140
173 3300025936 Ga0207670_10608765 Ga0207670_106087652 140
174 3300025936 Ga0207670_10815329 Ga0207670_108153292 140
175 3300025937 Ga0207669_10393803 Ga0207669_103938032 140
176 3300025938 Ga0207704_10087508 Ga0207704_100875082 140
177 3300025938 Ga0207704_10308560 Ga0207704_103085602 140
178 3300025949 Ga0207667_10085155 Ga0207667_100851553 140
179 3300025960 Ga0207651_10279412 Ga0207651_102794122 140
180 3300025981 Ga0207640_11212101 Ga0207640_112121011 140
181 3300025986 Ga0207658_10288908 Ga0207658_102889082 140
182 3300026067 Ga0207678_10133086 Ga0207678_101330861 140
183 3300026075 Ga0207708_10803983 Ga0207708_108039832 140
184 3300026075 Ga0207708_12024406 Ga0207708_120244061 140
185 3300026089 Ga0207648_10183258 Ga0207648_101832582 140
186 3300026118 Ga0207675_101707517 Ga0207675_1017075172 140
187 3300026121 Ga0207683_10043524 Ga0207683_100435242 140
188 3300026121 Ga0207683_10086802 Ga0207683_100868022 140
189 3300027666 Ga0209282_1000056 Ga0209282_100005678 140
190 3300028379 Ga0268266_10551614 Ga0268266_105516142 140
191 3300028794 Ga0307515_10340672 Ga0307515_103406722 140
192 3300030735 Ga0316178_1011118 Ga0316178_10111188 140
193 3300031548 Ga0307408_100323472 Ga0307408_1003234722 140
194 3300031731 Ga0307405_10050322 Ga0307405_100503223 140
195 3300031824 Ga0307413_10604870 Ga0307413_106048702 140
196 3300031852 Ga0307410_10859961 Ga0307410_108599612 140
197 3300032005 Ga0307411_10919601 Ga0307411_109196011 140
198 3300035083 Ga0373926_0112955 Ga0373926_0112955_487_909 140
199 3300035086 Ga0373934_0000243 Ga0373934_0000243_2383_2805 140
200 3300035086 Ga0373934_0131859 Ga0373934_0131859_101_523 140
201 3300035089 Ga0373944_0277405 Ga0373944_0277405_23_445 140
202 3300035111 Ga0373923_0012284 Ga0373923_0012284_157_579 140
203 3300035117 Ga0373953_0010519 Ga0373953_0010519_474_896 140
204 3300035117 Ga0373953_0013942 Ga0373953_0013942_1728_2150 140
205 3300035118 Ga0373954_0006295 Ga0373954_0006295_4435_4857 140
206 3300035118 Ga0373954_0008365 Ga0373954_0008365_396_818 140
207 3300035118 Ga0373954_0030569 Ga0373954_0030569_1265_1687 140
208 3300035118 Ga0373954_0038102 Ga0373954_0038102_822_1244 140
209 3300035119 Ga0373956_0000029 Ga0373956_0000029_6113_6535 140
210 3300035120 Ga0373957_0001375 Ga0373957_0001375_5665_6087 140
211 3300035120 Ga0373957_0007067 Ga0373957_0007067_2762_3184 140
212 3300035172 Ga0373955_0033776 Ga0373955_0033776_1598_2020 140
213 3300035410 Ga0373924_0004115 Ga0373924_0004115_1646_2068 140
214 3300035692 Ga0373935_0015248 Ga0373935_0015248_2353_2775 140
215 3300035695 Ga0373927_0020808 Ga0373927_0020808_687_1109 140
216 3300035724 Ga0373933_0000579 Ga0373933_0000579_14054_14476 140
217 3300035724 Ga0373933_0015773 Ga0373933_0015773_1336_1758 140
218 3300035724 Ga0373933_0044031 Ga0373933_0044031_1866_2288 140
219 3300035725 Ga0373947_0299823 Ga0373947_0299823_413_835 140
220 3300036401 Ga0373937_0000441 Ga0373937_0000441_4357_4779 140
221 3300036401 Ga0373937_0018566 Ga0373937_0018566_4016_4438 140
222 3300036401 Ga0373937_0468726 Ga0373937_0468726_703_1125 140
223 3300037312 Ga0395899_0236231 Ga0395899_0236231_385_810 140
224 3300037418 Ga0395900_0133120 Ga0395900_0133120_1539_1964 140
225 3300037466 Ga0395898_0069437 Ga0395898_0069437_2466_2891 140
226 3300037853 Ga0436364_0776345 Ga0436364_0776345_225_671 140
227 3300039447 Ga0436361_0760266 Ga0436361_0760266_107_529 140
228 3300039447 Ga0436361_0959402 Ga0436361_0959402_107_529 140
229 3300039450 Ga0436363_1255904 Ga0436363_1255904_3530_3952 140
230 3300041512 Ga0451853_3763280 Ga0451853_3763280_11_472 140
231 3300042438 Ga0439459_0009584 Ga0439459_0009584_971_1411 140
232 3300045051 Ga0451576_1829366 Ga0451576_1829366_113_535 140
233 3300046454 Ga0495592_0001747 Ga0495592_0001747_4722_5144 140
234 3300046454 Ga0495592_0007755 Ga0495592_0007755_4426_4848 140
235 3300046454 Ga0495592_0029296 Ga0495592_0029296_20_442 140
236 3300046454 Ga0495592_0137208 Ga0495592_0137208_172_594 140
237 3300046457 Ga0495590_0046396 Ga0495590_0046396_544_966 140
238 3300046460 Ga0495638_0092496 Ga0495638_0092496_1333_1758 140
239 3300046460 Ga0495638_0121902 Ga0495638_0121902_802_1224 140
240 3300046461 Ga0495641_0007083 Ga0495641_0007083_2935_3357 140
241 3300046462 Ga0495651_0000356 Ga0495651_0000356_30304_30726 140
242 3300046462 Ga0495651_0022011 Ga0495651_0022011_1237_1659 140
243 3300046462 Ga0495651_0356470 Ga0495651_0356470_283_705 140
244 3300046472 Ga0495580_0006213 Ga0495580_0006213_5528_5950 140
245 3300046472 Ga0495580_0029055 Ga0495580_0029055_1084_1506 140
246 3300046472 Ga0495580_0592106 Ga0495580_0592106_68_490 140
247 3300046474 Ga0495605_0002092 Ga0495605_0002092_5000_5422 140
248 3300046474 Ga0495605_0041316 Ga0495605_0041316_1813_2235 140
249 3300046475 Ga0495639_0010775 Ga0495639_0010775_2413_2835 140
250 3300046476 Ga0495662_0009192 Ga0495662_0009192_1002_1424 140
251 3300046477 Ga0495664_0314533 Ga0495664_0314533_473_895 140
252 3300046491 Ga0495584_0120744 Ga0495584_0120744_748_1170 140
253 3300046499 Ga0495594_0584208 Ga0495594_0584208_194_616 140
254 3300046501 Ga0495607_0020721 Ga0495607_0020721_2846_3268 140
255 3300046506 Ga0495583_0000988 Ga0495583_0000988_26666_27088 140
256 3300046513 Ga0495616_0000351 Ga0495616_0000351_21625_22047 140
257 3300046513 Ga0495616_0005684 Ga0495616_0005684_6511_6933 140
258 3300046516 Ga0495628_0004166 Ga0495628_0004166_10788_11210 140
259 3300046516 Ga0495628_0014489 Ga0495628_0014489_5919_6341 140
260 3300046516 Ga0495628_0018943 Ga0495628_0018943_3400_3825 140
261 3300046517 Ga0495630_0011866 Ga0495630_0011866_1176_1598 140
262 3300046518 Ga0495631_0266504 Ga0495631_0266504_38_460 140
263 3300046522 Ga0495643_0001603 Ga0495643_0001603_14085_14507 140
264 3300046523 Ga0495644_0046931 Ga0495644_0046931_1181_1603 140
265 3300046524 Ga0495648_0435498 Ga0495648_0435498_56_478 140
266 3300046526 Ga0495666_0064222 Ga0495666_0064222_205_627 140
267 3300046528 Ga0495642_0028950 Ga0495642_0028950_1747_2184 140
268 3300046528 Ga0495642_0044915 Ga0495642_0044915_845_1270 140
269 3300046529 Ga0495652_0004306 Ga0495652_0004306_1093_1515 140
270 3300046529 Ga0495652_0089302 Ga0495652_0089302_865_1287 140
271 3300046530 Ga0495654_0088596 Ga0495654_0088596_532_954 140
272 3300046530 Ga0495654_0089525 Ga0495654_0089525_168_590 140
273 3300046533 Ga0495640_0076661 Ga0495640_0076661_1208_1630 140
274 3300046536 Ga0495587_0021758 Ga0495587_0021758_1010_1432 140
275 3300046536 Ga0495587_0286172 Ga0495587_0286172_482_904 140
276 3300046538 Ga0495609_0086049 Ga0495609_0086049_346_768 140
277 3300046542 Ga0495597_0045707 Ga0495597_0045707_256_678 140
278 3300046543 Ga0495645_0000609 Ga0495645_0000609_10852_11274 140
279 3300046558 Ga0495633_0231400 Ga0495633_0231400_339_776 140
280 3300046559 Ga0495667_0006380 Ga0495667_0006380_83_505 140
281 3300046559 Ga0495667_0317840 Ga0495667_0317840_476_901 140
282 3300046615 Ga0495656_0299563 Ga0495656_0299563_358_783 140
283 3300046615 Ga0495656_0396511 Ga0495656_0396511_136_573 140
284 3300046642 Ga0495634_0055888 Ga0495634_0055888_2093_2515 140
285 3300046663 Ga0495635_0479360 Ga0495635_0479360_131_553 140
286 3300046665 Ga0495661_0074285 Ga0495661_0074285_1113_1535 140
287 3300046674 Ga0495588_0703121 Ga0495588_0703121_18_455 140
288 3300046675 Ga0495657_0013800 Ga0495657_0013800_14_436 140
289 3300046675 Ga0495657_0088760 Ga0495657_0088760_321_743 140
290 3300046678 Ga0495599_0001013 Ga0495599_0001013_9053_9475 140
291 3300046678 Ga0495599_0036993 Ga0495599_0036993_2449_2871 140
292 3300046681 Ga0495647_0002196 Ga0495647_0002196_802_1224 140
293 3300046683 Ga0495658_0129309 Ga0495658_0129309_888_1310 140
294 3300046690 Ga0495624_0442838 Ga0495624_0442838_83_505 140
295 3300046691 Ga0495670_0030248 Ga0495670_0030248_202_624 140
296 3300046692 Ga0495671_0001007 Ga0495671_0001007_7309_7731 140
297 3300046694 Ga0495649_0067323 Ga0495649_0067323_707_1132 140
298 3300046794 Ga0495589_0059671 Ga0495589_0059671_1244_1669 140
299 3300046794 Ga0495589_0182441 Ga0495589_0182441_176_598 140
300 3300046809 Ga0495600_0000657 Ga0495600_0000657_16182_16604 140
301 3300046809 Ga0495600_0239282 Ga0495600_0239282_37_462 140
302 3300046810 Ga0495660_0390797 Ga0495660_0390797_66_488 140
303 3300047315 Ga0495581_0060071 Ga0495581_0060071_1588_2010 140
304 3300047317 Ga0495604_0005804 Ga0495604_0005804_5253_5675 140
305 3300047317 Ga0495604_0074579 Ga0495604_0074579_1590_2012 140
306 3300047317 Ga0495604_0126381 Ga0495604_0126381_863_1285 140
307 3300047318 Ga0495636_0110032 Ga0495636_0110032_349_774 140
308 3300047319 Ga0495674_0052241 Ga0495674_0052241_1091_1513 140
309 3300047320 Ga0495672_0275808 Ga0495672_0275808_349_771 140
310 3300047322 Ga0495680_0045682 Ga0495680_0045682_799_1221 140
311 3300047322 Ga0495680_0271562 Ga0495680_0271562_506_928 140
312 3300047322 Ga0495680_0487619 Ga0495680_0487619_244_666 140
313 3300047444 Ga0495675_0073997 Ga0495675_0073997_1317_1739 140
314 3300047444 Ga0495675_0133584 Ga0495675_0133584_739_1161 140
315 3300047445 Ga0495677_0117693 Ga0495677_0117693_16_453 140
316 3300047447 Ga0495685_101407 Ga0495685_101407_116_538 140
317 3300047471 Ga0495684_0028949 Ga0495684_0028949_2617_3039 140
318 3300047472 Ga0495686_0000012 Ga0495686_0000012_364764_365189 140
319 3300048088 Ga0495602_0704380 Ga0495602_0704380_237_659 140
320 3300048091 Ga0495626_0000044 Ga0495626_0000044_140496_140921 140
321 3300048091 Ga0495626_0002425 Ga0495626_0002425_6879_7301 140
322 3300048091 Ga0495626_0014747 Ga0495626_0014747_904_1326 140
323 3300048919 Ga0496116_0002072 Ga0496116_0002072_167_589 140
324 3300048924 Ga0496121_0085613 Ga0496121_0085613_1323_1745 140
325 3300048925 Ga0496122_0001123 Ga0496122_0001123_7791_8213 140
326 3300048926 Ga0496123_0000957 Ga0496123_0000957_37001_37423 140
327 3300048928 Ga0496125_0102993 Ga0496125_0102993_1153_1575 140
328 3300048928 Ga0496125_0194611 Ga0496125_0194611_194_616 140
329 3300048929 Ga0496126_0197475 Ga0496126_0197475_406_828 140
330 3300049571 Ga0501034_1074222 Ga0501034_1074222_212_637 140
331 3300049580 Ga0501046_1024016 Ga0501046_1024016_58_483 140
332 3300049581 Ga0501047_0004029 Ga0501047_0004029_5410_5835 140
333 3300049581 Ga0501047_0126604 Ga0501047_0126604_1106_1531 140
334 3300049584 Ga0501068_0063849 Ga0501068_0063849_745_1170 140
335 3300049586 Ga0501070_0070247 Ga0501070_0070247_2191_2616 140
336 3300049589 Ga0501073_0000686 Ga0501073_0000686_13008_13433 140
337 3300049589 Ga0501073_0205693 Ga0501073_0205693_655_1077 140
338 3300049590 Ga0501074_0002270 Ga0501074_0002270_3857_4282 140
339 3300049590 Ga0501074_1049741 Ga0501074_1049741_136_558 140
340 3300049592 Ga0501076_0343254 Ga0501076_0343254_30_455 140
341 3300049741 Ga0501079_0003490 Ga0501079_0003490_9935_10360 140
342 3300049742 Ga0501080_0025389 Ga0501080_0025389_2010_2435 140
343 3300049742 Ga0501080_0278383 Ga0501080_0278383_972_1397 140
344 3300049742 Ga0501080_0282084 Ga0501080_0282084_690_1112 140
345 3300049744 Ga0501083_0028844 Ga0501083_0028844_3178_3603 140
346 3300049822 Ga0501035_0893297 Ga0501035_0893297_103_528 140
347 3300049822 Ga0501035_1073553 Ga0501035_1073553_197_619 140
348 3300049823 Ga0501044_0094663 Ga0501044_0094663_1538_1963 140
349 3300049823 Ga0501044_0406755 Ga0501044_0406755_691_1113 140
350 3300049823 Ga0501044_0571167 Ga0501044_0571167_222_647 140
351 3300050491 nmdc:mga00v17_28553_c1 nmdc:mga00v17_28553_c1_1945_2379 140
352 3300050514 nmdc:mga08x19_354853_c1 nmdc:mga08x19_354853_c1_278_700 140
353 3300053077 Ga0495601_0014358 Ga0495601_0014358_621_1043 140
354 3300053077 Ga0495601_0127247 Ga0495601_0127247_1149_1571 140
355 3300053077 Ga0495601_0800105 Ga0495601_0800105_162_584 140
356 3300053078 Ga0495612_0144006 Ga0495612_0144006_483_905 140
357 3300053084 Ga0495595_0004712 Ga0495595_0004712_2973_3395 140
358 3300053085 Ga0495619_0202807 Ga0495619_0202807_514_936 140
359 3300053136 Ga0500559_0086538 Ga0500559_0086538_767_1189 140
360 3300060353 Ga0501082_0016837 Ga0501082_0016837_1130_1555 140
361 3300006195 Ga0075366_10043785 Ga0075366_100437852 141
362 3300006353 Ga0075370_10600230 Ga0075370_106002301 141
363 3300014326 Ga0157380_10874889 Ga0157380_108748892 141
364 3300050496 nmdc:mga07m45_805716_c1 nmdc:mga07m45_805716_c1_41_469 141
365 iso_pu_bacteria 2857542790 2857544020 141
366 3300017792 Ga0163161_10257129 Ga0163161_102571292 143
367 3300025303 Ga0209051_1053957 Ga0209051_10539573 143
368 3300037471 Ga0395905_0726998 Ga0395905_0726998_179_610 143
369 3300048924 Ga0496121_0021834 Ga0496121_0021834_135_605 143
370 3300048925 Ga0496122_0143105 Ga0496122_0143105_790_1260 143
371 3300048927 Ga0496124_0000007 Ga0496124_0000007_349154_349624 143
372 3300003187 JGI25151J46595_10000065 JGI25151J46595_1000006595 148
373 3300003771 Ga0055526_1019875 Ga0055526_10198752 148
374 3300003775 Ga0055524_1012514 Ga0055524_10125142 148
375 3300003784 Ga0055534_1000135 Ga0055534_100013542 148
376 3300005459 Ga0068867_100387136 Ga0068867_1003871362 148
377 3300005547 Ga0070693_100294426 Ga0070693_1002944262 148
378 3300005616 Ga0068852_100046536 Ga0068852_1000465364 148
379 3300005842 Ga0068858_100000589 Ga0068858_10000058931 148
380 3300009093 Ga0105240_10523513 Ga0105240_105235132 148
381 3300009176 Ga0105242_10002633 Ga0105242_1000263313 148
382 3300009177 Ga0105248_10350108 Ga0105248_103501082 148
383 3300009551 Ga0105238_10942583 Ga0105238_109425832 148
384 3300013102 Ga0157371_10000060 Ga0157371_10000060127 148
385 3300013297 Ga0157378_10374872 Ga0157378_103748722 148
386 3300013306 Ga0163162_10297440 Ga0163162_102974403 148
387 3300014968 Ga0157379_10079514 Ga0157379_100795142 148
388 3300025263 Ga0209565_1000109 Ga0209565_100010954 148
389 3300025273 Ga0209673_1007883 Ga0209673_10078834 148
390 3300025291 Ga0209675_1000118 Ga0209675_100011859 148
391 3300025294 Ga0209025_1000159 Ga0209025_1000159105 148
392 3300025295 Ga0209564_1000663 Ga0209564_100066314 148
393 3300025299 Ga0209256_1001659 Ga0209256_10016597 148
394 3300025903 Ga0207680_10524822 Ga0207680_105248222 148
395 3300025909 Ga0207705_10073220 Ga0207705_100732202 148
396 3300025909 Ga0207705_10784312 Ga0207705_107843122 148
397 3300025913 Ga0207695_10282439 Ga0207695_102824392 148
398 3300025921 Ga0207652_10264392 Ga0207652_102643922 148
399 3300025924 Ga0207694_10123985 Ga0207694_101239852 148
400 3300025924 Ga0207694_10195274 Ga0207694_101952741 148
401 3300025934 Ga0207686_10024079 Ga0207686_100240794 148
402 3300025941 Ga0207711_10154430 Ga0207711_101544302 148
403 3300026035 Ga0207703_10058588 Ga0207703_100585883 148
404 3300026089 Ga0207648_10361934 Ga0207648_103619342 148
405 3300026142 Ga0207698_10121211 Ga0207698_101212113 148
406 3300026142 Ga0207698_11619641 Ga0207698_116196411 148
407 3300034816 Ga0373930_0005405 Ga0373930_0005405_687_1142 148
408 3300035691 Ga0373931_0096157 Ga0373931_0096157_839_1294 148
409 3300035691 Ga0373931_0125821 Ga0373931_0125821_689_1141 148
410 3300039437 Ga0436365_0255624 Ga0436365_0255624_393_848 148
411 3300047445 Ga0495677_0337202 Ga0495677_0337202_73_585 148
412 3300049583 Ga0501067_0871008 Ga0501067_0871008_14_469 148

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

36

158

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nb0-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution 0.8678 12 144
3rri-assembly1.cif.gz_A crystal structure of glyoxalase/bleomycin resistance protein/dioxygenase from alicyclobacillus acidocaldarius 0.839 13 146
4nb2-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.89 angstrom resolution - apo structure 0.8372 12 144
4nb1-assembly1.cif.gz_B crystal structure of fosb from staphylococcus aureus at 1.80 angstrom resolution with l-cysteine-cys9 disulfide 0.8329 12 144
4nb2-assembly1.cif.gz_B crystal structure of fosb from staphylococcus aureus at 1.89 angstrom resolution - apo structure 0.8292 12 144
ID Description Score Start End Superfamily
3rriB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8431 13 142 3.10.180.10
2p7kA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8242 12 144 3.10.180.10
4nazA01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8067 12 144 3.10.180.10
3rriB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.802 13 142 3.10.180.10
2p7kA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7942 12 144 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A0C4YJM0-F1-model_v4 Putative dioxygenase 0.9965 14 148 GO:0051213
AF-A0A7C4E557-F1-model_v4 Glyoxalase 0.9899 9 148
AF-A0A0C4YJM0-F1-model_v4 Putative dioxygenase 0.9892 14 148 GO:0051213
AF-A0A357EZN1-F1-model_v4 Glyoxalase 0.9834 14 63
AF-A0A522RSE7-F1-model_v4 DUF1543 domain-containing protein 0.9805 12 148

Feature Viewer

pLDDT pTM Quality
91.25 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map