F437900
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 412 | 286 | 402 | 142 |
Family's Representative Sequence
| Representative Sequence | 3300047445|Ga0495677_0337202|Ga0495677_0337202_73_585 |
| Length | 170 |
| Sequence | MRKRTWSTTADEHTSSKQASTFQRFLAEIFMQSIPLFHLAFPVRDLAEARRFYGDLLGCPEGRSSDEWVDFNFYGHQIVAHLAPDEVSAAPTNAVDGHNVPVRHFGAILPMEEWESLADKLRAADTRFVIEPHVRFKGQVGEQATMFFLDPSGNALEFKAFGDIGQVFAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 2 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 3 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 4 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 5 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 6 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 7 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 8 | 2901300506 | Cupriavidus sp. UYMSc13B | Isolate | Unclassified |
| 9 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 10 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 43 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 47 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 48 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 49 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 50 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 51 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 53 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 54 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 55 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 56 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 75 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 79 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 80 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 81 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 82 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 84 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 87 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 88 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 123 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 126 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 127 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 128 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 129 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 130 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 131 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 132 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 133 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 134 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 135 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 136 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 137 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 138 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 139 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 140 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 141 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 142 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 143 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 144 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 145 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 146 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 147 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 148 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 149 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 150 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 151 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 152 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 153 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 154 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 155 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 156 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 157 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 158 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 159 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 160 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 161 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 162 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 163 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 164 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 165 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 166 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 167 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 168 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 233 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 234 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 235 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 236 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 239 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 240 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 241 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 242 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 243 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 244 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 245 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 246 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 247 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 248 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 249 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 267 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 268 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 275 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 276 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 277 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 278 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 279 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 280 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 281 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 282 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 284 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 286 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.57 |
| Metatranscriptomes | 0 |
| Isolates | 2.43 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.19 |
| Nodule | 1.7 |
| Rhizoplane | 2.91 |
| Rhizosphere | 80.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.85 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10000065 | 3300003187 | Bacteria | 145136 |
| 2 | JGI25151J46595_10003429 | 3300003187 | Bacteria | 8764 |
| 3 | Ga0055526_1001853 | 3300003771 | Bacteria | 14643 |
| 4 | Ga0055526_1001881 | 3300003771 | Bacteria | 14544 |
| 5 | Ga0055526_1019875 | 3300003771 | Bacteria | 2423 |
| 6 | Ga0055524_1012514 | 3300003775 | Bacteria | 3254 |
| 7 | Ga0055536_1000942 | 3300003781 | Bacteria | 18723 |
| 8 | Ga0055534_1000135 | 3300003784 | Bacteria | 55272 |
| 9 | Ga0055534_1004203 | 3300003784 | Bacteria | 4247 |
| 10 | Ga0065714_10073033 | 3300005288 | Bacteria | 3256 |
| 11 | Ga0070658_10958988 | 3300005327 | Bacteria | 744 |
| 12 | Ga0070677_10175036 | 3300005333 | Bacteria | 1018 |
| 13 | Ga0070666_10161701 | 3300005335 | Bacteria | 1565 |
| 14 | Ga0070682_100002178 | 3300005337 | Bacteria | 10856 |
| 15 | Ga0070682_100045001 | 3300005337 | Bacteria | 2734 |
| 16 | Ga0068868_100381585 | 3300005338 | Bacteria | 1213 |
| 17 | Ga0068868_100694224 | 3300005338 | Bacteria | 910 |
| 18 | Ga0070689_100635349 | 3300005340 | Bacteria | 927 |
| 19 | Ga0070689_100740733 | 3300005340 | Bacteria | 861 |
| 20 | Ga0070692_10852597 | 3300005345 | Bacteria | 626 |
| 21 | Ga0070668_100080635 | 3300005347 | Bacteria | 2550 |
| 22 | Ga0070669_101015288 | 3300005353 | Bacteria | 712 |
| 23 | Ga0070675_100274328 | 3300005354 | Bacteria | 1481 |
| 24 | Ga0070674_100252205 | 3300005356 | Bacteria | 1386 |
| 25 | Ga0070673_100851502 | 3300005364 | Bacteria | 844 |
| 26 | Ga0070688_100292489 | 3300005365 | Bacteria | 1174 |
| 27 | Ga0070667_100281590 | 3300005367 | Bacteria | 1493 |
| 28 | Ga0070714_100004717 | 3300005435 | Bacteria | 10311 |
| 29 | Ga0070700_100379524 | 3300005441 | Bacteria | 1057 |
| 30 | Ga0070663_100046775 | 3300005455 | Bacteria | 3063 |
| 31 | Ga0070678_100159500 | 3300005456 | Bacteria | 1826 |
| 32 | Ga0070662_100269225 | 3300005457 | Bacteria | 1375 |
| 33 | Ga0070662_100790977 | 3300005457 | Bacteria | 806 |
| 34 | Ga0068867_100155915 | 3300005459 | Bacteria | 1797 |
| 35 | Ga0068867_100387136 | 3300005459 | Bacteria | 1176 |
| 36 | Ga0070685_11296879 | 3300005466 | Bacteria | 556 |
| 37 | Ga0070707_100854754 | 3300005468 | Bacteria | 874 |
| 38 | Ga0070672_100671262 | 3300005543 | Bacteria | 906 |
| 39 | Ga0070672_100781793 | 3300005543 | Bacteria | 839 |
| 40 | Ga0070693_100205804 | 3300005547 | Bacteria | 1281 |
| 41 | Ga0070693_100294426 | 3300005547 | Bacteria | 1091 |
| 42 | Ga0070693_101299234 | 3300005547 | Bacteria | 562 |
| 43 | Ga0070665_100578658 | 3300005548 | Bacteria | 1136 |
| 44 | Ga0068855_100007211 | 3300005563 | Bacteria | 13487 |
| 45 | Ga0068852_100046536 | 3300005616 | Bacteria | 3697 |
| 46 | Ga0068866_10592608 | 3300005718 | Bacteria | 747 |
| 47 | Ga0068866_10598251 | 3300005718 | Bacteria | 744 |
| 48 | Ga0068861_100015541 | 3300005719 | Bacteria | 5367 |
| 49 | Ga0068858_100000589 | 3300005842 | Bacteria | 38060 |
| 50 | Ga0070717_10402320 | 3300006028 | Bacteria | 1230 |
| 51 | Ga0075363_100159952 | 3300006048 | Bacteria | 1275 |
| 52 | Ga0075364_10007777 | 3300006051 | Bacteria | 6386 |
| 53 | Ga0075432_10093911 | 3300006058 | Bacteria | 1101 |
| 54 | Ga0075362_10005656 | 3300006177 | Bacteria | 4593 |
| 55 | Ga0075366_10005689 | 3300006195 | Bacteria | 6763 |
| 56 | Ga0075366_10043785 | 3300006195 | Bacteria | 2652 |
| 57 | Ga0075366_10635527 | 3300006195 | Bacteria | 662 |
| 58 | Ga0097621_100167966 | 3300006237 | Bacteria | 1889 |
| 59 | Ga0075370_10600230 | 3300006353 | Bacteria | 667 |
| 60 | Ga0068865_100199663 | 3300006881 | Bacteria | 1552 |
| 61 | Ga0075436_100099944 | 3300006914 | Bacteria | 2020 |
| 62 | Ga0075436_100330286 | 3300006914 | Bacteria | 1096 |
| 63 | Ga0099826_10000011 | 3300006948 | Bacteria | 287659 |
| 64 | Ga0105251_10158650 | 3300009011 | Bacteria | 1020 |
| 65 | Ga0105240_10011877 | 3300009093 | Bacteria | 12085 |
| 66 | Ga0105240_10523513 | 3300009093 | Bacteria | 1315 |
| 67 | Ga0111539_10050234 | 3300009094 | Bacteria | 4968 |
| 68 | Ga0105245_10238283 | 3300009098 | Bacteria | 1762 |
| 69 | Ga0105241_11290907 | 3300009174 | Bacteria | 695 |
| 70 | Ga0105242_10002633 | 3300009176 | Bacteria | 14068 |
| 71 | Ga0105242_10120170 | 3300009176 | Bacteria | 2253 |
| 72 | Ga0105242_10141099 | 3300009176 | Bacteria | 2091 |
| 73 | Ga0105242_11684313 | 3300009176 | Bacteria | 670 |
| 74 | Ga0105248_10350108 | 3300009177 | Bacteria | 1663 |
| 75 | Ga0105237_10005304 | 3300009545 | Bacteria | 14579 |
| 76 | Ga0105238_10011049 | 3300009551 | Bacteria | 9079 |
| 77 | Ga0105238_10586250 | 3300009551 | Bacteria | 1122 |
| 78 | Ga0105238_10942583 | 3300009551 | Bacteria | 883 |
| 79 | Ga0105239_10005149 | 3300010375 | Bacteria | 15440 |
| 80 | Ga0105246_10457305 | 3300011119 | Bacteria | 1074 |
| 81 | Ga0157371_10000060 | 3300013102 | Bacteria | 170456 |
| 82 | Ga0157370_10001450 | 3300013104 | Bacteria | 29357 |
| 83 | Ga0157370_10007835 | 3300013104 | Bacteria | 11576 |
| 84 | Ga0157378_10374872 | 3300013297 | Bacteria | 1396 |
| 85 | Ga0163162_10005231 | 3300013306 | Bacteria | 12511 |
| 86 | Ga0163162_10013170 | 3300013306 | Bacteria | 8077 |
| 87 | Ga0163162_10079907 | 3300013306 | Bacteria | 3337 |
| 88 | Ga0163162_10297440 | 3300013306 | Bacteria | 1746 |
| 89 | Ga0157375_10238690 | 3300013308 | Bacteria | 1977 |
| 90 | Ga0163163_10033520 | 3300014325 | Bacteria | 4968 |
| 91 | Ga0157380_10874889 | 3300014326 | Bacteria | 922 |
| 92 | Ga0157380_12603010 | 3300014326 | Bacteria | 572 |
| 93 | Ga0182008_10034088 | 3300014497 | Bacteria | 2553 |
| 94 | Ga0157379_10079514 | 3300014968 | Bacteria | 2936 |
| 95 | Ga0157379_10673824 | 3300014968 | Bacteria | 969 |
| 96 | Ga0157376_12035610 | 3300014969 | Bacteria | 612 |
| 97 | Ga0163161_10008518 | 3300017792 | Bacteria | 7099 |
| 98 | Ga0163161_10257129 | 3300017792 | Bacteria | 1363 |
| 99 | Ga0213872_10020302 | 3300021361 | Bacteria | 3061 |
| 100 | Ga0213874_10011832 | 3300021377 | Bacteria | 2222 |
| 101 | Ga0209565_1000109 | 3300025263 | Bacteria | 120345 |
| 102 | Ga0209673_1007883 | 3300025273 | Bacteria | 4817 |
| 103 | Ga0209130_1013179 | 3300025284 | Bacteria | 2128 |
| 104 | Ga0209675_1000026 | 3300025291 | Bacteria | 284716 |
| 105 | Ga0209675_1000118 | 3300025291 | Bacteria | 110507 |
| 106 | Ga0209676_1000059 | 3300025292 | Bacteria | 344882 |
| 107 | Ga0209025_1000066 | 3300025294 | Bacteria | 298742 |
| 108 | Ga0209025_1000071 | 3300025294 | Bacteria | 287297 |
| 109 | Ga0209025_1000159 | 3300025294 | Bacteria | 167081 |
| 110 | Ga0209564_1000663 | 3300025295 | Bacteria | 50906 |
| 111 | Ga0209564_1000715 | 3300025295 | Bacteria | 47835 |
| 112 | Ga0209564_1004238 | 3300025295 | Bacteria | 8915 |
| 113 | Ga0209256_1001659 | 3300025299 | Bacteria | 21633 |
| 114 | Ga0209051_1053957 | 3300025303 | Bacteria | 1316 |
| 115 | Ga0209051_1082205 | 3300025303 | Bacteria | 925 |
| 116 | Ga0207713_1049446 | 3300025735 | Bacteria | 1685 |
| 117 | Ga0207642_10722649 | 3300025899 | Bacteria | 629 |
| 118 | Ga0207688_10092887 | 3300025901 | Bacteria | 1734 |
| 119 | Ga0207680_10524822 | 3300025903 | Bacteria | 844 |
| 120 | Ga0207680_10529885 | 3300025903 | Bacteria | 840 |
| 121 | Ga0207705_10073220 | 3300025909 | Bacteria | 2485 |
| 122 | Ga0207705_10784312 | 3300025909 | Bacteria | 740 |
| 123 | Ga0207695_10010425 | 3300025913 | Bacteria | 11369 |
| 124 | Ga0207695_10282439 | 3300025913 | Bacteria | 1554 |
| 125 | Ga0207671_10002510 | 3300025914 | Bacteria | 19582 |
| 126 | Ga0207652_10264392 | 3300025921 | Bacteria | 1552 |
| 127 | Ga0207646_11072032 | 3300025922 | Bacteria | 710 |
| 128 | Ga0207694_10018042 | 3300025924 | Bacteria | 5335 |
| 129 | Ga0207694_10123985 | 3300025924 | Bacteria | 2065 |
| 130 | Ga0207694_10195274 | 3300025924 | Bacteria | 1645 |
| 131 | Ga0207694_10207505 | 3300025924 | Bacteria | 1595 |
| 132 | Ga0207659_10528190 | 3300025926 | Bacteria | 1001 |
| 133 | Ga0207687_11214800 | 3300025927 | Bacteria | 648 |
| 134 | Ga0207706_10120799 | 3300025933 | Bacteria | 2304 |
| 135 | Ga0207686_10024079 | 3300025934 | Bacteria | 3522 |
| 136 | Ga0207686_10085160 | 3300025934 | Bacteria | 2073 |
| 137 | Ga0207686_10781981 | 3300025934 | Bacteria | 764 |
| 138 | Ga0207670_10608765 | 3300025936 | Bacteria | 898 |
| 139 | Ga0207670_10815329 | 3300025936 | Bacteria | 778 |
| 140 | Ga0207669_10393803 | 3300025937 | Bacteria | 1083 |
| 141 | Ga0207704_10087508 | 3300025938 | Bacteria | 2035 |
| 142 | Ga0207704_10308560 | 3300025938 | Bacteria | 1215 |
| 143 | Ga0207691_10199050 | 3300025940 | Bacteria | 1744 |
| 144 | Ga0207711_10154430 | 3300025941 | Bacteria | 2073 |
| 145 | Ga0207667_10085155 | 3300025949 | Bacteria | 3272 |
| 146 | Ga0207651_10279412 | 3300025960 | Bacteria | 1379 |
| 147 | Ga0207712_10020533 | 3300025961 | Bacteria | 4326 |
| 148 | Ga0207668_10068017 | 3300025972 | Bacteria | 2531 |
| 149 | Ga0207640_11212101 | 3300025981 | Bacteria | 671 |
| 150 | Ga0207658_10288908 | 3300025986 | Bacteria | 1408 |
| 151 | Ga0207677_10604736 | 3300026023 | Bacteria | 962 |
| 152 | Ga0207703_10058588 | 3300026035 | Bacteria | 3144 |
| 153 | Ga0207678_10133086 | 3300026067 | Bacteria | 2121 |
| 154 | Ga0207708_10803983 | 3300026075 | Bacteria | 810 |
| 155 | Ga0207708_12024406 | 3300026075 | Bacteria | 504 |
| 156 | Ga0207648_10183258 | 3300026089 | Bacteria | 1854 |
| 157 | Ga0207648_10361934 | 3300026089 | Bacteria | 1309 |
| 158 | Ga0207675_100005476 | 3300026118 | Bacteria | 12159 |
| 159 | Ga0207675_101707517 | 3300026118 | Bacteria | 649 |
| 160 | Ga0207683_10043524 | 3300026121 | Bacteria | 3924 |
| 161 | Ga0207683_10086802 | 3300026121 | Bacteria | 2782 |
| 162 | Ga0207683_10107295 | 3300026121 | Bacteria | 2498 |
| 163 | Ga0207698_10121211 | 3300026142 | Bacteria | 2214 |
| 164 | Ga0207698_11619641 | 3300026142 | Bacteria | 663 |
| 165 | Ga0209282_1000056 | 3300027666 | Bacteria | 100584 |
| 166 | Ga0268266_10551614 | 3300028379 | Bacteria | 1104 |
| 167 | Ga0268265_11102005 | 3300028380 | Bacteria | 788 |
| 168 | Ga0307515_10340672 | 3300028794 | Bacteria | 1152 |
| 169 | Ga0316177_1213926 | 3300030731 | Bacteria | 3021 |
| 170 | Ga0316178_1011118 | 3300030735 | Bacteria | 9249 |
| 171 | Ga0265330_10065796 | 3300031235 | Bacteria | 1573 |
| 172 | Ga0265340_10000159 | 3300031247 | Bacteria | 34106 |
| 173 | Ga0307408_100182231 | 3300031548 | Bacteria | 1685 |
| 174 | Ga0307408_100323472 | 3300031548 | Bacteria | 1300 |
| 175 | Ga0307405_10050322 | 3300031731 | Bacteria | 2579 |
| 176 | Ga0307413_10604870 | 3300031824 | Bacteria | 898 |
| 177 | Ga0307410_10555179 | 3300031852 | Unclassified | 952 |
| 178 | Ga0307410_10859961 | 3300031852 | Bacteria | 775 |
| 179 | Ga0307406_10031411 | 3300031901 | Bacteria | 3234 |
| 180 | Ga0307409_100805384 | 3300031995 | Bacteria | 947 |
| 181 | Ga0307409_101675675 | 3300031995 | Bacteria | 664 |
| 182 | Ga0307414_10262012 | 3300032004 | Bacteria | 1443 |
| 183 | Ga0307411_10070409 | 3300032005 | Bacteria | 2367 |
| 184 | Ga0307411_10919601 | 3300032005 | Bacteria | 778 |
| 185 | Ga0307415_100011650 | 3300032126 | Bacteria | 5044 |
| 186 | Ga0373930_0005405 | 3300034816 | Bacteria | 2124 |
| 187 | Ga0373926_0112955 | 3300035083 | Bacteria | 1021 |
| 188 | Ga0373934_0000243 | 3300035086 | Bacteria | 19594 |
| 189 | Ga0373934_0131859 | 3300035086 | Bacteria | 1019 |
| 190 | Ga0373944_0277405 | 3300035089 | Bacteria | 624 |
| 191 | Ga0373923_0012284 | 3300035111 | Bacteria | 3160 |
| 192 | Ga0373953_0010519 | 3300035117 | Bacteria | 3222 |
| 193 | Ga0373953_0013942 | 3300035117 | Bacteria | 2881 |
| 194 | Ga0373954_0006295 | 3300035118 | Bacteria | 5174 |
| 195 | Ga0373954_0008365 | 3300035118 | Bacteria | 4538 |
| 196 | Ga0373954_0030569 | 3300035118 | Bacteria | 2483 |
| 197 | Ga0373954_0038102 | 3300035118 | Bacteria | 2235 |
| 198 | Ga0373956_0000029 | 3300035119 | Bacteria | 45843 |
| 199 | Ga0373957_0001375 | 3300035120 | Bacteria | 6556 |
| 200 | Ga0373957_0007067 | 3300035120 | Bacteria | 3571 |
| 201 | Ga0373955_0033776 | 3300035172 | Bacteria | 2696 |
| 202 | Ga0373924_0004115 | 3300035410 | Bacteria | 5061 |
| 203 | Ga0373931_0096157 | 3300035691 | Bacteria | 1659 |
| 204 | Ga0373931_0125821 | 3300035691 | Bacteria | 1470 |
| 205 | Ga0373935_0015248 | 3300035692 | Bacteria | 4643 |
| 206 | Ga0373927_0020808 | 3300035695 | Bacteria | 4300 |
| 207 | Ga0373933_0000579 | 3300035724 | Bacteria | 22962 |
| 208 | Ga0373933_0015773 | 3300035724 | Bacteria | 4214 |
| 209 | Ga0373933_0044031 | 3300035724 | Bacteria | 2642 |
| 210 | Ga0373947_0299823 | 3300035725 | Bacteria | 1071 |
| 211 | Ga0373937_0000441 | 3300036401 | Bacteria | 38394 |
| 212 | Ga0373937_0018566 | 3300036401 | Bacteria | 6212 |
| 213 | Ga0373937_0468726 | 3300036401 | Bacteria | 1196 |
| 214 | Ga0395899_0236231 | 3300037312 | Bacteria | 1260 |
| 215 | Ga0395900_0133120 | 3300037418 | Bacteria | 2547 |
| 216 | Ga0395898_0069437 | 3300037466 | Bacteria | 3409 |
| 217 | Ga0395905_0726998 | 3300037471 | Bacteria | 895 |
| 218 | Ga0436364_0776345 | 3300037853 | Bacteria | 922 |
| 219 | Ga0436365_0255624 | 3300039437 | Bacteria | 2215 |
| 220 | Ga0436361_0760266 | 3300039447 | Bacteria | 1114 |
| 221 | Ga0436361_0959402 | 3300039447 | Bacteria | 9187 |
| 222 | Ga0436363_1255904 | 3300039450 | Bacteria | 6631 |
| 223 | Ga0451793_1616509 | 3300041452 | Bacteria | 668 |
| 224 | Ga0451853_3763280 | 3300041512 | Bacteria | 559 |
| 225 | Ga0439459_0009584 | 3300042438 | Bacteria | 1676 |
| 226 | Ga0451576_1829366 | 3300045051 | Bacteria | 627 |
| 227 | Ga0495592_0001747 | 3300046454 | Bacteria | 15259 |
| 228 | Ga0495592_0007755 | 3300046454 | Bacteria | 8042 |
| 229 | Ga0495592_0029296 | 3300046454 | Bacteria | 4169 |
| 230 | Ga0495592_0137208 | 3300046454 | Bacteria | 1705 |
| 231 | Ga0495590_0046396 | 3300046457 | Bacteria | 1516 |
| 232 | Ga0495638_0092496 | 3300046460 | Bacteria | 1820 |
| 233 | Ga0495638_0121902 | 3300046460 | Bacteria | 1539 |
| 234 | Ga0495641_0007083 | 3300046461 | Bacteria | 7099 |
| 235 | Ga0495651_0000356 | 3300046462 | Bacteria | 35210 |
| 236 | Ga0495651_0022011 | 3300046462 | Bacteria | 4956 |
| 237 | Ga0495651_0356470 | 3300046462 | Bacteria | 965 |
| 238 | Ga0495580_0006213 | 3300046472 | Bacteria | 9759 |
| 239 | Ga0495580_0029055 | 3300046472 | Bacteria | 4015 |
| 240 | Ga0495580_0592106 | 3300046472 | Bacteria | 733 |
| 241 | Ga0495605_0002092 | 3300046474 | Bacteria | 12525 |
| 242 | Ga0495605_0041316 | 3300046474 | Bacteria | 2297 |
| 243 | Ga0495639_0010775 | 3300046475 | Bacteria | 3934 |
| 244 | Ga0495662_0009192 | 3300046476 | Bacteria | 4849 |
| 245 | Ga0495664_0314533 | 3300046477 | Bacteria | 944 |
| 246 | Ga0495584_0120744 | 3300046491 | Bacteria | 1327 |
| 247 | Ga0495594_0584208 | 3300046499 | Bacteria | 633 |
| 248 | Ga0495596_0000151 | 3300046500 | Bacteria | 48207 |
| 249 | Ga0495607_0020721 | 3300046501 | Bacteria | 4150 |
| 250 | Ga0495583_0000988 | 3300046506 | Bacteria | 32598 |
| 251 | Ga0495610_0000328 | 3300046512 | Bacteria | 50375 |
| 252 | Ga0495616_0000351 | 3300046513 | Bacteria | 36157 |
| 253 | Ga0495616_0005684 | 3300046513 | Bacteria | 7639 |
| 254 | Ga0495628_0004166 | 3300046516 | Bacteria | 12869 |
| 255 | Ga0495628_0014489 | 3300046516 | Bacteria | 6608 |
| 256 | Ga0495628_0018943 | 3300046516 | Bacteria | 5695 |
| 257 | Ga0495630_0011866 | 3300046517 | Bacteria | 6316 |
| 258 | Ga0495631_0266504 | 3300046518 | Bacteria | 730 |
| 259 | Ga0495643_0001603 | 3300046522 | Bacteria | 20026 |
| 260 | Ga0495644_0046931 | 3300046523 | Bacteria | 1623 |
| 261 | Ga0495648_0435498 | 3300046524 | Bacteria | 577 |
| 262 | Ga0495666_0064222 | 3300046526 | Bacteria | 1752 |
| 263 | Ga0495642_0028950 | 3300046528 | Bacteria | 2209 |
| 264 | Ga0495642_0044915 | 3300046528 | Bacteria | 1804 |
| 265 | Ga0495652_0004306 | 3300046529 | Bacteria | 13640 |
| 266 | Ga0495652_0089302 | 3300046529 | Bacteria | 2523 |
| 267 | Ga0495654_0088596 | 3300046530 | Bacteria | 1439 |
| 268 | Ga0495654_0089525 | 3300046530 | Bacteria | 1430 |
| 269 | Ga0495640_0076661 | 3300046533 | Bacteria | 2230 |
| 270 | Ga0495587_0021758 | 3300046536 | Bacteria | 3956 |
| 271 | Ga0495587_0286172 | 3300046536 | Bacteria | 923 |
| 272 | Ga0495609_0086049 | 3300046538 | Bacteria | 1370 |
| 273 | Ga0495597_0045707 | 3300046542 | Bacteria | 1942 |
| 274 | Ga0495645_0000609 | 3300046543 | Bacteria | 24694 |
| 275 | Ga0495633_0231400 | 3300046558 | Bacteria | 845 |
| 276 | Ga0495667_0006380 | 3300046559 | Bacteria | 7994 |
| 277 | Ga0495667_0317840 | 3300046559 | Bacteria | 985 |
| 278 | Ga0495656_0120605 | 3300046615 | Bacteria | 1237 |
| 279 | Ga0495656_0299563 | 3300046615 | Bacteria | 824 |
| 280 | Ga0495656_0396511 | 3300046615 | Bacteria | 721 |
| 281 | Ga0495634_0055888 | 3300046642 | Bacteria | 2638 |
| 282 | Ga0495635_0479360 | 3300046663 | Bacteria | 820 |
| 283 | Ga0495661_0023998 | 3300046665 | Bacteria | 3951 |
| 284 | Ga0495661_0074285 | 3300046665 | Bacteria | 1979 |
| 285 | Ga0495588_0703121 | 3300046674 | Bacteria | 529 |
| 286 | Ga0495657_0013800 | 3300046675 | Bacteria | 5946 |
| 287 | Ga0495657_0088760 | 3300046675 | Bacteria | 1987 |
| 288 | Ga0495599_0001013 | 3300046678 | Bacteria | 15801 |
| 289 | Ga0495599_0036993 | 3300046678 | Bacteria | 3067 |
| 290 | Ga0495647_0002196 | 3300046681 | Bacteria | 6103 |
| 291 | Ga0495658_0129309 | 3300046683 | Bacteria | 1535 |
| 292 | Ga0495624_0442838 | 3300046690 | Bacteria | 778 |
| 293 | Ga0495670_0030248 | 3300046691 | Bacteria | 2690 |
| 294 | Ga0495671_0001007 | 3300046692 | Bacteria | 19605 |
| 295 | Ga0495649_0067323 | 3300046694 | Bacteria | 1921 |
| 296 | Ga0495649_0123914 | 3300046694 | Bacteria | 1365 |
| 297 | Ga0495589_0059671 | 3300046794 | Bacteria | 1874 |
| 298 | Ga0495589_0182441 | 3300046794 | Bacteria | 995 |
| 299 | Ga0495600_0000657 | 3300046809 | Bacteria | 17939 |
| 300 | Ga0495600_0239282 | 3300046809 | Bacteria | 1157 |
| 301 | Ga0495660_0384240 | 3300046810 | Bacteria | 618 |
| 302 | Ga0495660_0390797 | 3300046810 | Bacteria | 611 |
| 303 | Ga0495581_0060071 | 3300047315 | Bacteria | 2197 |
| 304 | Ga0495604_0005804 | 3300047317 | Bacteria | 9794 |
| 305 | Ga0495604_0074579 | 3300047317 | Bacteria | 2556 |
| 306 | Ga0495604_0126381 | 3300047317 | Bacteria | 1843 |
| 307 | Ga0495636_0110032 | 3300047318 | Bacteria | 1212 |
| 308 | Ga0495674_0052241 | 3300047319 | Bacteria | 3598 |
| 309 | Ga0495672_0275808 | 3300047320 | Bacteria | 805 |
| 310 | Ga0495680_0045682 | 3300047322 | Bacteria | 3457 |
| 311 | Ga0495680_0271562 | 3300047322 | Bacteria | 1197 |
| 312 | Ga0495680_0487619 | 3300047322 | Bacteria | 838 |
| 313 | Ga0495675_0073997 | 3300047444 | Bacteria | 2148 |
| 314 | Ga0495675_0133584 | 3300047444 | Bacteria | 1541 |
| 315 | Ga0495677_0117693 | 3300047445 | Bacteria | 1012 |
| 316 | Ga0495677_0337202 | 3300047445 | Bacteria | 595 |
| 317 | Ga0495685_101407 | 3300047447 | Bacteria | 950 |
| 318 | Ga0495684_0028949 | 3300047471 | Bacteria | 4250 |
| 319 | Ga0495686_0000012 | 3300047472 | Bacteria | 508428 |
| 320 | Ga0495602_0704380 | 3300048088 | Bacteria | 685 |
| 321 | Ga0495626_0000044 | 3300048091 | Bacteria | 165533 |
| 322 | Ga0495626_0002425 | 3300048091 | Bacteria | 12948 |
| 323 | Ga0495626_0014747 | 3300048091 | Bacteria | 4018 |
| 324 | Ga0496100_0202485 | 3300048903 | Bacteria | 1447 |
| 325 | Ga0496102_0044287 | 3300048905 | Bacteria | 4038 |
| 326 | Ga0496104_0027782 | 3300048907 | Bacteria | 5237 |
| 327 | Ga0496105_0063992 | 3300048908 | Bacteria | 3034 |
| 328 | Ga0496105_0990820 | 3300048908 | Bacteria | 629 |
| 329 | Ga0496106_0965088 | 3300048909 | Bacteria | 671 |
| 330 | Ga0496108_0631049 | 3300048911 | Bacteria | 932 |
| 331 | Ga0496109_0757090 | 3300048912 | Bacteria | 909 |
| 332 | Ga0496110_0065678 | 3300048913 | Bacteria | 3208 |
| 333 | Ga0496113_0194986 | 3300048916 | Bacteria | 1609 |
| 334 | Ga0496114_0161716 | 3300048917 | Bacteria | 1947 |
| 335 | Ga0496116_0002072 | 3300048919 | Bacteria | 21455 |
| 336 | Ga0496121_0021834 | 3300048924 | Bacteria | 6251 |
| 337 | Ga0496121_0085613 | 3300048924 | Bacteria | 2480 |
| 338 | Ga0496122_0001123 | 3300048925 | Bacteria | 46098 |
| 339 | Ga0496122_0143105 | 3300048925 | Bacteria | 1492 |
| 340 | Ga0496123_0000957 | 3300048926 | Bacteria | 44790 |
| 341 | Ga0496124_0000007 | 3300048927 | Bacteria | 883534 |
| 342 | Ga0496125_0102993 | 3300048928 | Bacteria | 2096 |
| 343 | Ga0496125_0194611 | 3300048928 | Bacteria | 1335 |
| 344 | Ga0496126_0197475 | 3300048929 | Bacteria | 1701 |
| 345 | Ga0501299_220476 | 3300049522 | Bacteria | 512 |
| 346 | Ga0501034_0269692 | 3300049571 | Bacteria | 1643 |
| 347 | Ga0501034_1074222 | 3300049571 | Bacteria | 687 |
| 348 | Ga0501039_1215657 | 3300049575 | Bacteria | 583 |
| 349 | Ga0501046_1024016 | 3300049580 | Bacteria | 572 |
| 350 | Ga0501047_0004029 | 3300049581 | Bacteria | 13816 |
| 351 | Ga0501047_0004469 | 3300049581 | Bacteria | 13159 |
| 352 | Ga0501047_0126604 | 3300049581 | Bacteria | 2435 |
| 353 | Ga0501067_0015446 | 3300049583 | Bacteria | 4227 |
| 354 | Ga0501067_0871008 | 3300049583 | Bacteria | 508 |
| 355 | Ga0501068_0063849 | 3300049584 | Bacteria | 2240 |
| 356 | Ga0501068_0150906 | 3300049584 | Bacteria | 1460 |
| 357 | Ga0501069_0690773 | 3300049585 | Bacteria | 615 |
| 358 | Ga0501070_0070247 | 3300049586 | Bacteria | 2900 |
| 359 | Ga0501070_0078606 | 3300049586 | Bacteria | 2730 |
| 360 | Ga0501072_0016454 | 3300049588 | Bacteria | 5678 |
| 361 | Ga0501072_0047312 | 3300049588 | Bacteria | 3387 |
| 362 | Ga0501073_0000686 | 3300049589 | Bacteria | 23798 |
| 363 | Ga0501073_0015989 | 3300049589 | Bacteria | 5438 |
| 364 | Ga0501073_0205693 | 3300049589 | Bacteria | 1361 |
| 365 | Ga0501074_0002270 | 3300049590 | Bacteria | 13365 |
| 366 | Ga0501074_0134159 | 3300049590 | Bacteria | 1771 |
| 367 | Ga0501074_1049741 | 3300049590 | Bacteria | 573 |
| 368 | Ga0501076_0343254 | 3300049592 | Bacteria | 1226 |
| 369 | Ga0501079_0003490 | 3300049741 | Bacteria | 11556 |
| 370 | Ga0501079_0165513 | 3300049741 | Bacteria | 1724 |
| 371 | Ga0501080_0025389 | 3300049742 | Bacteria | 5498 |
| 372 | Ga0501080_0151206 | 3300049742 | Bacteria | 2145 |
| 373 | Ga0501080_0278383 | 3300049742 | Bacteria | 1521 |
| 374 | Ga0501080_0282084 | 3300049742 | Bacteria | 1510 |
| 375 | Ga0501080_0319988 | 3300049742 | Bacteria | 1404 |
| 376 | Ga0501083_0028844 | 3300049744 | Bacteria | 3823 |
| 377 | Ga0501035_0893297 | 3300049822 | Bacteria | 704 |
| 378 | Ga0501035_1073553 | 3300049822 | Bacteria | 630 |
| 379 | Ga0501044_0094663 | 3300049823 | Bacteria | 3011 |
| 380 | Ga0501044_0406755 | 3300049823 | Bacteria | 1273 |
| 381 | Ga0501044_0571167 | 3300049823 | Unclassified | 1026 |
| 382 | nmdc:mga00v17_28553_c1 | 3300050491 | Bacteria | 3268 |
| 383 | nmdc:mga07m45_805716_c1 | 3300050496 | Bacteria | 538 |
| 384 | nmdc:mga08y16_367321_c1 | 3300050511 | Bacteria | 1476 |
| 385 | nmdc:mga08x19_354853_c1 | 3300050514 | Bacteria | 1024 |
| 386 | Ga0495601_0014358 | 3300053077 | Bacteria | 4771 |
| 387 | Ga0495601_0127247 | 3300053077 | Bacteria | 1657 |
| 388 | Ga0495601_0800105 | 3300053077 | Bacteria | 598 |
| 389 | Ga0495612_0144006 | 3300053078 | Bacteria | 1035 |
| 390 | Ga0495595_0004712 | 3300053084 | Bacteria | 5487 |
| 391 | Ga0495619_0202807 | 3300053085 | Bacteria | 1373 |
| 392 | Ga0500644_0008663 | 3300053088 | Bacteria | 2691 |
| 393 | Ga0500641_0433445 | 3300053096 | Bacteria | 510 |
| 394 | Ga0500650_0002028 | 3300053098 | Bacteria | 6487 |
| 395 | Ga0500608_009562 | 3300053122 | Bacteria | 4123 |
| 396 | Ga0500618_030662 | 3300053125 | Bacteria | 1264 |
| 397 | Ga0500628_002835 | 3300053129 | Bacteria | 2849 |
| 398 | Ga0500559_0086538 | 3300053136 | Bacteria | 1430 |
| 399 | Ga0500568_0180804 | 3300053139 | Bacteria | 775 |
| 400 | Ga0501084_0058502 | 3300054114 | Bacteria | 3225 |
| 401 | Ga0500661_003730 | 3300055283 | Bacteria | 2859 |
| 402 | Ga0501082_0016837 | 3300060353 | Bacteria | 6295 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005719 | Ga0068861_100015541 | Ga0068861_1000155415 | 128 |
| 2 | 3300014325 | Ga0163163_10033520 | Ga0163163_100335202 | 128 |
| 3 | 3300025961 | Ga0207712_10020533 | Ga0207712_100205334 | 128 |
| 4 | 3300026118 | Ga0207675_100005476 | Ga0207675_10000547614 | 128 |
| 5 | 3300028380 | Ga0268265_11102005 | Ga0268265_111020052 | 128 |
| 6 | iso_pu_bacteria | 2834641062 | 2834643676 | 136 |
| 7 | iso_pu_bacteria | 2855730933 | 2855735212 | 136 |
| 8 | iso_pu_bacteria | 2855767633 | 2855770996 | 136 |
| 9 | iso_pu_bacteria | 2881412998 | 2881418380 | 136 |
| 10 | iso_pu_bacteria | 8003400568 | 8003405062 | 136 |
| 11 | 3300046500 | Ga0495596_0000151 | Ga0495596_0000151_7930_8343 | 137 |
| 12 | 3300046512 | Ga0495610_0000328 | Ga0495610_0000328_39862_40275 | 137 |
| 13 | 3300046665 | Ga0495661_0023998 | Ga0495661_0023998_3415_3828 | 137 |
| 14 | 3300046694 | Ga0495649_0123914 | Ga0495649_0123914_367_780 | 137 |
| 15 | 3300005435 | Ga0070714_100004717 | Ga0070714_10000471711 | 138 |
| 16 | 3300005457 | Ga0070662_100269225 | Ga0070662_1002692252 | 138 |
| 17 | 3300005543 | Ga0070672_100781793 | Ga0070672_1007817931 | 138 |
| 18 | 3300005547 | Ga0070693_101299234 | Ga0070693_1012992341 | 138 |
| 19 | 3300006028 | Ga0070717_10402320 | Ga0070717_104023202 | 138 |
| 20 | 3300006058 | Ga0075432_10093911 | Ga0075432_100939112 | 138 |
| 21 | 3300006914 | Ga0075436_100099944 | Ga0075436_1000999442 | 138 |
| 22 | 3300009094 | Ga0111539_10050234 | Ga0111539_100502343 | 138 |
| 23 | 3300025933 | Ga0207706_10120799 | Ga0207706_101207992 | 138 |
| 24 | 3300031235 | Ga0265330_10065796 | Ga0265330_100657962 | 138 |
| 25 | 3300031247 | Ga0265340_10000159 | Ga0265340_1000015913 | 138 |
| 26 | 3300031548 | Ga0307408_100182231 | Ga0307408_1001822312 | 138 |
| 27 | 3300031852 | Ga0307410_10555179 | Ga0307410_105551792 | 138 |
| 28 | 3300031901 | Ga0307406_10031411 | Ga0307406_100314112 | 138 |
| 29 | 3300031995 | Ga0307409_100805384 | Ga0307409_1008053841 | 138 |
| 30 | 3300031995 | Ga0307409_101675675 | Ga0307409_1016756751 | 138 |
| 31 | 3300032004 | Ga0307414_10262012 | Ga0307414_102620122 | 138 |
| 32 | 3300032005 | Ga0307411_10070409 | Ga0307411_100704092 | 138 |
| 33 | 3300032126 | Ga0307415_100011650 | Ga0307415_1000116501 | 138 |
| 34 | 3300049522 | Ga0501299_220476 | Ga0501299_220476_35_454 | 138 |
| 35 | 3300050511 | nmdc:mga08y16_367321_c1 | nmdc:mga08y16_367321_c1_801_1232 | 138 |
| 36 | 3300005288 | Ga0065714_10073033 | Ga0065714_100730333 | 139 |
| 37 | 3300005333 | Ga0070677_10175036 | Ga0070677_101750361 | 139 |
| 38 | 3300005335 | Ga0070666_10161701 | Ga0070666_101617012 | 139 |
| 39 | 3300005338 | Ga0068868_100694224 | Ga0068868_1006942241 | 139 |
| 40 | 3300005347 | Ga0070668_100080635 | Ga0070668_1000806353 | 139 |
| 41 | 3300005353 | Ga0070669_101015288 | Ga0070669_1010152881 | 139 |
| 42 | 3300005718 | Ga0068866_10598251 | Ga0068866_105982511 | 139 |
| 43 | 3300006048 | Ga0075363_100159952 | Ga0075363_1001599523 | 139 |
| 44 | 3300006177 | Ga0075362_10005656 | Ga0075362_100056564 | 139 |
| 45 | 3300006195 | Ga0075366_10635527 | Ga0075366_106355272 | 139 |
| 46 | 3300006237 | Ga0097621_100167966 | Ga0097621_1001679663 | 139 |
| 47 | 3300009174 | Ga0105241_11290907 | Ga0105241_112909071 | 139 |
| 48 | 3300009176 | Ga0105242_10141099 | Ga0105242_101410992 | 139 |
| 49 | 3300009551 | Ga0105238_10586250 | Ga0105238_105862501 | 139 |
| 50 | 3300011119 | Ga0105246_10457305 | Ga0105246_104573052 | 139 |
| 51 | 3300013306 | Ga0163162_10013170 | Ga0163162_100131707 | 139 |
| 52 | 3300013308 | Ga0157375_10238690 | Ga0157375_102386903 | 139 |
| 53 | 3300014497 | Ga0182008_10034088 | Ga0182008_100340882 | 139 |
| 54 | 3300014968 | Ga0157379_10673824 | Ga0157379_106738242 | 139 |
| 55 | 3300014969 | Ga0157376_12035610 | Ga0157376_120356101 | 139 |
| 56 | 3300017792 | Ga0163161_10008518 | Ga0163161_1000851810 | 139 |
| 57 | 3300025903 | Ga0207680_10529885 | Ga0207680_105298852 | 139 |
| 58 | 3300025924 | Ga0207694_10207505 | Ga0207694_102075053 | 139 |
| 59 | 3300025934 | Ga0207686_10085160 | Ga0207686_100851603 | 139 |
| 60 | 3300025940 | Ga0207691_10199050 | Ga0207691_101990503 | 139 |
| 61 | 3300025972 | Ga0207668_10068017 | Ga0207668_100680172 | 139 |
| 62 | 3300026023 | Ga0207677_10604736 | Ga0207677_106047362 | 139 |
| 63 | 3300026121 | Ga0207683_10107295 | Ga0207683_101072952 | 139 |
| 64 | 3300030731 | Ga0316177_1213926 | Ga0316177_12139262 | 139 |
| 65 | 3300041452 | Ga0451793_1616509 | Ga0451793_1616509_207_638 | 139 |
| 66 | 3300046615 | Ga0495656_0120605 | Ga0495656_0120605_52_483 | 139 |
| 67 | 3300046810 | Ga0495660_0384240 | Ga0495660_0384240_131_562 | 139 |
| 68 | 3300048903 | Ga0496100_0202485 | Ga0496100_0202485_949_1380 | 139 |
| 69 | 3300048905 | Ga0496102_0044287 | Ga0496102_0044287_2123_2554 | 139 |
| 70 | 3300048907 | Ga0496104_0027782 | Ga0496104_0027782_2980_3411 | 139 |
| 71 | 3300048908 | Ga0496105_0063992 | Ga0496105_0063992_1029_1460 | 139 |
| 72 | 3300048908 | Ga0496105_0990820 | Ga0496105_0990820_188_619 | 139 |
| 73 | 3300048909 | Ga0496106_0965088 | Ga0496106_0965088_25_456 | 139 |
| 74 | 3300048911 | Ga0496108_0631049 | Ga0496108_0631049_247_678 | 139 |
| 75 | 3300048912 | Ga0496109_0757090 | Ga0496109_0757090_128_559 | 139 |
| 76 | 3300048913 | Ga0496110_0065678 | Ga0496110_0065678_1705_2136 | 139 |
| 77 | 3300048916 | Ga0496113_0194986 | Ga0496113_0194986_751_1182 | 139 |
| 78 | 3300048917 | Ga0496114_0161716 | Ga0496114_0161716_14_445 | 139 |
| 79 | 3300049571 | Ga0501034_0269692 | Ga0501034_0269692_683_1102 | 139 |
| 80 | 3300049575 | Ga0501039_1215657 | Ga0501039_1215657_20_448 | 139 |
| 81 | 3300049581 | Ga0501047_0004469 | Ga0501047_0004469_11335_11754 | 139 |
| 82 | 3300049583 | Ga0501067_0015446 | Ga0501067_0015446_1501_1920 | 139 |
| 83 | 3300049584 | Ga0501068_0150906 | Ga0501068_0150906_142_561 | 139 |
| 84 | 3300049585 | Ga0501069_0690773 | Ga0501069_0690773_93_512 | 139 |
| 85 | 3300049586 | Ga0501070_0078606 | Ga0501070_0078606_770_1189 | 139 |
| 86 | 3300049588 | Ga0501072_0016454 | Ga0501072_0016454_1233_1652 | 139 |
| 87 | 3300049588 | Ga0501072_0047312 | Ga0501072_0047312_193_612 | 139 |
| 88 | 3300049589 | Ga0501073_0015989 | Ga0501073_0015989_1233_1652 | 139 |
| 89 | 3300049590 | Ga0501074_0134159 | Ga0501074_0134159_620_1039 | 139 |
| 90 | 3300049741 | Ga0501079_0165513 | Ga0501079_0165513_480_899 | 139 |
| 91 | 3300049742 | Ga0501080_0151206 | Ga0501080_0151206_905_1324 | 139 |
| 92 | 3300049742 | Ga0501080_0319988 | Ga0501080_0319988_705_1124 | 139 |
| 93 | 3300053088 | Ga0500644_0008663 | Ga0500644_0008663_29_466 | 139 |
| 94 | 3300053096 | Ga0500641_0433445 | Ga0500641_0433445_18_455 | 139 |
| 95 | 3300053098 | Ga0500650_0002028 | Ga0500650_0002028_4278_4715 | 139 |
| 96 | 3300053122 | Ga0500608_009562 | Ga0500608_009562_2549_2980 | 139 |
| 97 | 3300053125 | Ga0500618_030662 | Ga0500618_030662_511_951 | 139 |
| 98 | 3300053129 | Ga0500628_002835 | Ga0500628_002835_1576_2013 | 139 |
| 99 | 3300053139 | Ga0500568_0180804 | Ga0500568_0180804_172_609 | 139 |
| 100 | 3300054114 | Ga0501084_0058502 | Ga0501084_0058502_1682_2101 | 139 |
| 101 | 3300055283 | Ga0500661_003730 | Ga0500661_003730_733_1170 | 139 |
| 102 | iso_pu_bacteria | 2513237150 | 2513952230 | 139 |
| 103 | iso_pu_bacteria | 2513237165 | 2514044818 | 139 |
| 104 | iso_pu_bacteria | 2901300506 | 2901302997 | 139 |
| 105 | iso_pu_bacteria | 644736347 | 644751208 | 139 |
| 106 | 3300003187 | JGI25151J46595_10003429 | JGI25151J46595_100034296 | 140 |
| 107 | 3300003771 | Ga0055526_1001853 | Ga0055526_10018533 | 140 |
| 108 | 3300003771 | Ga0055526_1001881 | Ga0055526_10018813 | 140 |
| 109 | 3300003781 | Ga0055536_1000942 | Ga0055536_10009421 | 140 |
| 110 | 3300003784 | Ga0055534_1004203 | Ga0055534_10042035 | 140 |
| 111 | 3300005327 | Ga0070658_10958988 | Ga0070658_109589881 | 140 |
| 112 | 3300005337 | Ga0070682_100002178 | Ga0070682_1000021781 | 140 |
| 113 | 3300005337 | Ga0070682_100045001 | Ga0070682_1000450014 | 140 |
| 114 | 3300005338 | Ga0068868_100381585 | Ga0068868_1003815852 | 140 |
| 115 | 3300005340 | Ga0070689_100635349 | Ga0070689_1006353492 | 140 |
| 116 | 3300005340 | Ga0070689_100740733 | Ga0070689_1007407332 | 140 |
| 117 | 3300005345 | Ga0070692_10852597 | Ga0070692_108525971 | 140 |
| 118 | 3300005354 | Ga0070675_100274328 | Ga0070675_1002743281 | 140 |
| 119 | 3300005356 | Ga0070674_100252205 | Ga0070674_1002522052 | 140 |
| 120 | 3300005364 | Ga0070673_100851502 | Ga0070673_1008515022 | 140 |
| 121 | 3300005365 | Ga0070688_100292489 | Ga0070688_1002924891 | 140 |
| 122 | 3300005367 | Ga0070667_100281590 | Ga0070667_1002815902 | 140 |
| 123 | 3300005441 | Ga0070700_100379524 | Ga0070700_1003795241 | 140 |
| 124 | 3300005455 | Ga0070663_100046775 | Ga0070663_1000467751 | 140 |
| 125 | 3300005456 | Ga0070678_100159500 | Ga0070678_1001595002 | 140 |
| 126 | 3300005457 | Ga0070662_100790977 | Ga0070662_1007909771 | 140 |
| 127 | 3300005459 | Ga0068867_100155915 | Ga0068867_1001559152 | 140 |
| 128 | 3300005466 | Ga0070685_11296879 | Ga0070685_112968791 | 140 |
| 129 | 3300005468 | Ga0070707_100854754 | Ga0070707_1008547542 | 140 |
| 130 | 3300005543 | Ga0070672_100671262 | Ga0070672_1006712622 | 140 |
| 131 | 3300005547 | Ga0070693_100205804 | Ga0070693_1002058043 | 140 |
| 132 | 3300005548 | Ga0070665_100578658 | Ga0070665_1005786582 | 140 |
| 133 | 3300005563 | Ga0068855_100007211 | Ga0068855_1000072119 | 140 |
| 134 | 3300005718 | Ga0068866_10592608 | Ga0068866_105926081 | 140 |
| 135 | 3300006051 | Ga0075364_10007777 | Ga0075364_100077772 | 140 |
| 136 | 3300006195 | Ga0075366_10005689 | Ga0075366_100056895 | 140 |
| 137 | 3300006881 | Ga0068865_100199663 | Ga0068865_1001996631 | 140 |
| 138 | 3300006914 | Ga0075436_100330286 | Ga0075436_1003302862 | 140 |
| 139 | 3300006948 | Ga0099826_10000011 | Ga0099826_1000001179 | 140 |
| 140 | 3300009011 | Ga0105251_10158650 | Ga0105251_101586502 | 140 |
| 141 | 3300009093 | Ga0105240_10011877 | Ga0105240_100118778 | 140 |
| 142 | 3300009098 | Ga0105245_10238283 | Ga0105245_102382832 | 140 |
| 143 | 3300009176 | Ga0105242_10120170 | Ga0105242_101201702 | 140 |
| 144 | 3300009176 | Ga0105242_11684313 | Ga0105242_116843132 | 140 |
| 145 | 3300009545 | Ga0105237_10005304 | Ga0105237_1000530412 | 140 |
| 146 | 3300009551 | Ga0105238_10011049 | Ga0105238_100110496 | 140 |
| 147 | 3300010375 | Ga0105239_10005149 | Ga0105239_1000514911 | 140 |
| 148 | 3300013104 | Ga0157370_10001450 | Ga0157370_1000145012 | 140 |
| 149 | 3300013104 | Ga0157370_10007835 | Ga0157370_1000783510 | 140 |
| 150 | 3300013306 | Ga0163162_10005231 | Ga0163162_100052317 | 140 |
| 151 | 3300013306 | Ga0163162_10079907 | Ga0163162_100799073 | 140 |
| 152 | 3300014326 | Ga0157380_12603010 | Ga0157380_126030101 | 140 |
| 153 | 3300021361 | Ga0213872_10020302 | Ga0213872_100203022 | 140 |
| 154 | 3300021377 | Ga0213874_10011832 | Ga0213874_100118324 | 140 |
| 155 | 3300025284 | Ga0209130_1013179 | Ga0209130_10131792 | 140 |
| 156 | 3300025291 | Ga0209675_1000026 | Ga0209675_1000026223 | 140 |
| 157 | 3300025292 | Ga0209676_1000059 | Ga0209676_100005983 | 140 |
| 158 | 3300025294 | Ga0209025_1000066 | Ga0209025_1000066246 | 140 |
| 159 | 3300025294 | Ga0209025_1000071 | Ga0209025_100007135 | 140 |
| 160 | 3300025295 | Ga0209564_1000715 | Ga0209564_100071537 | 140 |
| 161 | 3300025295 | Ga0209564_1004238 | Ga0209564_100423810 | 140 |
| 162 | 3300025303 | Ga0209051_1082205 | Ga0209051_10822052 | 140 |
| 163 | 3300025735 | Ga0207713_1049446 | Ga0207713_10494461 | 140 |
| 164 | 3300025899 | Ga0207642_10722649 | Ga0207642_107226492 | 140 |
| 165 | 3300025901 | Ga0207688_10092887 | Ga0207688_100928872 | 140 |
| 166 | 3300025913 | Ga0207695_10010425 | Ga0207695_100104257 | 140 |
| 167 | 3300025914 | Ga0207671_10002510 | Ga0207671_1000251011 | 140 |
| 168 | 3300025922 | Ga0207646_11072032 | Ga0207646_110720321 | 140 |
| 169 | 3300025924 | Ga0207694_10018042 | Ga0207694_100180425 | 140 |
| 170 | 3300025926 | Ga0207659_10528190 | Ga0207659_105281902 | 140 |
| 171 | 3300025927 | Ga0207687_11214800 | Ga0207687_112148002 | 140 |
| 172 | 3300025934 | Ga0207686_10781981 | Ga0207686_107819812 | 140 |
| 173 | 3300025936 | Ga0207670_10608765 | Ga0207670_106087652 | 140 |
| 174 | 3300025936 | Ga0207670_10815329 | Ga0207670_108153292 | 140 |
| 175 | 3300025937 | Ga0207669_10393803 | Ga0207669_103938032 | 140 |
| 176 | 3300025938 | Ga0207704_10087508 | Ga0207704_100875082 | 140 |
| 177 | 3300025938 | Ga0207704_10308560 | Ga0207704_103085602 | 140 |
| 178 | 3300025949 | Ga0207667_10085155 | Ga0207667_100851553 | 140 |
| 179 | 3300025960 | Ga0207651_10279412 | Ga0207651_102794122 | 140 |
| 180 | 3300025981 | Ga0207640_11212101 | Ga0207640_112121011 | 140 |
| 181 | 3300025986 | Ga0207658_10288908 | Ga0207658_102889082 | 140 |
| 182 | 3300026067 | Ga0207678_10133086 | Ga0207678_101330861 | 140 |
| 183 | 3300026075 | Ga0207708_10803983 | Ga0207708_108039832 | 140 |
| 184 | 3300026075 | Ga0207708_12024406 | Ga0207708_120244061 | 140 |
| 185 | 3300026089 | Ga0207648_10183258 | Ga0207648_101832582 | 140 |
| 186 | 3300026118 | Ga0207675_101707517 | Ga0207675_1017075172 | 140 |
| 187 | 3300026121 | Ga0207683_10043524 | Ga0207683_100435242 | 140 |
| 188 | 3300026121 | Ga0207683_10086802 | Ga0207683_100868022 | 140 |
| 189 | 3300027666 | Ga0209282_1000056 | Ga0209282_100005678 | 140 |
| 190 | 3300028379 | Ga0268266_10551614 | Ga0268266_105516142 | 140 |
| 191 | 3300028794 | Ga0307515_10340672 | Ga0307515_103406722 | 140 |
| 192 | 3300030735 | Ga0316178_1011118 | Ga0316178_10111188 | 140 |
| 193 | 3300031548 | Ga0307408_100323472 | Ga0307408_1003234722 | 140 |
| 194 | 3300031731 | Ga0307405_10050322 | Ga0307405_100503223 | 140 |
| 195 | 3300031824 | Ga0307413_10604870 | Ga0307413_106048702 | 140 |
| 196 | 3300031852 | Ga0307410_10859961 | Ga0307410_108599612 | 140 |
| 197 | 3300032005 | Ga0307411_10919601 | Ga0307411_109196011 | 140 |
| 198 | 3300035083 | Ga0373926_0112955 | Ga0373926_0112955_487_909 | 140 |
| 199 | 3300035086 | Ga0373934_0000243 | Ga0373934_0000243_2383_2805 | 140 |
| 200 | 3300035086 | Ga0373934_0131859 | Ga0373934_0131859_101_523 | 140 |
| 201 | 3300035089 | Ga0373944_0277405 | Ga0373944_0277405_23_445 | 140 |
| 202 | 3300035111 | Ga0373923_0012284 | Ga0373923_0012284_157_579 | 140 |
| 203 | 3300035117 | Ga0373953_0010519 | Ga0373953_0010519_474_896 | 140 |
| 204 | 3300035117 | Ga0373953_0013942 | Ga0373953_0013942_1728_2150 | 140 |
| 205 | 3300035118 | Ga0373954_0006295 | Ga0373954_0006295_4435_4857 | 140 |
| 206 | 3300035118 | Ga0373954_0008365 | Ga0373954_0008365_396_818 | 140 |
| 207 | 3300035118 | Ga0373954_0030569 | Ga0373954_0030569_1265_1687 | 140 |
| 208 | 3300035118 | Ga0373954_0038102 | Ga0373954_0038102_822_1244 | 140 |
| 209 | 3300035119 | Ga0373956_0000029 | Ga0373956_0000029_6113_6535 | 140 |
| 210 | 3300035120 | Ga0373957_0001375 | Ga0373957_0001375_5665_6087 | 140 |
| 211 | 3300035120 | Ga0373957_0007067 | Ga0373957_0007067_2762_3184 | 140 |
| 212 | 3300035172 | Ga0373955_0033776 | Ga0373955_0033776_1598_2020 | 140 |
| 213 | 3300035410 | Ga0373924_0004115 | Ga0373924_0004115_1646_2068 | 140 |
| 214 | 3300035692 | Ga0373935_0015248 | Ga0373935_0015248_2353_2775 | 140 |
| 215 | 3300035695 | Ga0373927_0020808 | Ga0373927_0020808_687_1109 | 140 |
| 216 | 3300035724 | Ga0373933_0000579 | Ga0373933_0000579_14054_14476 | 140 |
| 217 | 3300035724 | Ga0373933_0015773 | Ga0373933_0015773_1336_1758 | 140 |
| 218 | 3300035724 | Ga0373933_0044031 | Ga0373933_0044031_1866_2288 | 140 |
| 219 | 3300035725 | Ga0373947_0299823 | Ga0373947_0299823_413_835 | 140 |
| 220 | 3300036401 | Ga0373937_0000441 | Ga0373937_0000441_4357_4779 | 140 |
| 221 | 3300036401 | Ga0373937_0018566 | Ga0373937_0018566_4016_4438 | 140 |
| 222 | 3300036401 | Ga0373937_0468726 | Ga0373937_0468726_703_1125 | 140 |
| 223 | 3300037312 | Ga0395899_0236231 | Ga0395899_0236231_385_810 | 140 |
| 224 | 3300037418 | Ga0395900_0133120 | Ga0395900_0133120_1539_1964 | 140 |
| 225 | 3300037466 | Ga0395898_0069437 | Ga0395898_0069437_2466_2891 | 140 |
| 226 | 3300037853 | Ga0436364_0776345 | Ga0436364_0776345_225_671 | 140 |
| 227 | 3300039447 | Ga0436361_0760266 | Ga0436361_0760266_107_529 | 140 |
| 228 | 3300039447 | Ga0436361_0959402 | Ga0436361_0959402_107_529 | 140 |
| 229 | 3300039450 | Ga0436363_1255904 | Ga0436363_1255904_3530_3952 | 140 |
| 230 | 3300041512 | Ga0451853_3763280 | Ga0451853_3763280_11_472 | 140 |
| 231 | 3300042438 | Ga0439459_0009584 | Ga0439459_0009584_971_1411 | 140 |
| 232 | 3300045051 | Ga0451576_1829366 | Ga0451576_1829366_113_535 | 140 |
| 233 | 3300046454 | Ga0495592_0001747 | Ga0495592_0001747_4722_5144 | 140 |
| 234 | 3300046454 | Ga0495592_0007755 | Ga0495592_0007755_4426_4848 | 140 |
| 235 | 3300046454 | Ga0495592_0029296 | Ga0495592_0029296_20_442 | 140 |
| 236 | 3300046454 | Ga0495592_0137208 | Ga0495592_0137208_172_594 | 140 |
| 237 | 3300046457 | Ga0495590_0046396 | Ga0495590_0046396_544_966 | 140 |
| 238 | 3300046460 | Ga0495638_0092496 | Ga0495638_0092496_1333_1758 | 140 |
| 239 | 3300046460 | Ga0495638_0121902 | Ga0495638_0121902_802_1224 | 140 |
| 240 | 3300046461 | Ga0495641_0007083 | Ga0495641_0007083_2935_3357 | 140 |
| 241 | 3300046462 | Ga0495651_0000356 | Ga0495651_0000356_30304_30726 | 140 |
| 242 | 3300046462 | Ga0495651_0022011 | Ga0495651_0022011_1237_1659 | 140 |
| 243 | 3300046462 | Ga0495651_0356470 | Ga0495651_0356470_283_705 | 140 |
| 244 | 3300046472 | Ga0495580_0006213 | Ga0495580_0006213_5528_5950 | 140 |
| 245 | 3300046472 | Ga0495580_0029055 | Ga0495580_0029055_1084_1506 | 140 |
| 246 | 3300046472 | Ga0495580_0592106 | Ga0495580_0592106_68_490 | 140 |
| 247 | 3300046474 | Ga0495605_0002092 | Ga0495605_0002092_5000_5422 | 140 |
| 248 | 3300046474 | Ga0495605_0041316 | Ga0495605_0041316_1813_2235 | 140 |
| 249 | 3300046475 | Ga0495639_0010775 | Ga0495639_0010775_2413_2835 | 140 |
| 250 | 3300046476 | Ga0495662_0009192 | Ga0495662_0009192_1002_1424 | 140 |
| 251 | 3300046477 | Ga0495664_0314533 | Ga0495664_0314533_473_895 | 140 |
| 252 | 3300046491 | Ga0495584_0120744 | Ga0495584_0120744_748_1170 | 140 |
| 253 | 3300046499 | Ga0495594_0584208 | Ga0495594_0584208_194_616 | 140 |
| 254 | 3300046501 | Ga0495607_0020721 | Ga0495607_0020721_2846_3268 | 140 |
| 255 | 3300046506 | Ga0495583_0000988 | Ga0495583_0000988_26666_27088 | 140 |
| 256 | 3300046513 | Ga0495616_0000351 | Ga0495616_0000351_21625_22047 | 140 |
| 257 | 3300046513 | Ga0495616_0005684 | Ga0495616_0005684_6511_6933 | 140 |
| 258 | 3300046516 | Ga0495628_0004166 | Ga0495628_0004166_10788_11210 | 140 |
| 259 | 3300046516 | Ga0495628_0014489 | Ga0495628_0014489_5919_6341 | 140 |
| 260 | 3300046516 | Ga0495628_0018943 | Ga0495628_0018943_3400_3825 | 140 |
| 261 | 3300046517 | Ga0495630_0011866 | Ga0495630_0011866_1176_1598 | 140 |
| 262 | 3300046518 | Ga0495631_0266504 | Ga0495631_0266504_38_460 | 140 |
| 263 | 3300046522 | Ga0495643_0001603 | Ga0495643_0001603_14085_14507 | 140 |
| 264 | 3300046523 | Ga0495644_0046931 | Ga0495644_0046931_1181_1603 | 140 |
| 265 | 3300046524 | Ga0495648_0435498 | Ga0495648_0435498_56_478 | 140 |
| 266 | 3300046526 | Ga0495666_0064222 | Ga0495666_0064222_205_627 | 140 |
| 267 | 3300046528 | Ga0495642_0028950 | Ga0495642_0028950_1747_2184 | 140 |
| 268 | 3300046528 | Ga0495642_0044915 | Ga0495642_0044915_845_1270 | 140 |
| 269 | 3300046529 | Ga0495652_0004306 | Ga0495652_0004306_1093_1515 | 140 |
| 270 | 3300046529 | Ga0495652_0089302 | Ga0495652_0089302_865_1287 | 140 |
| 271 | 3300046530 | Ga0495654_0088596 | Ga0495654_0088596_532_954 | 140 |
| 272 | 3300046530 | Ga0495654_0089525 | Ga0495654_0089525_168_590 | 140 |
| 273 | 3300046533 | Ga0495640_0076661 | Ga0495640_0076661_1208_1630 | 140 |
| 274 | 3300046536 | Ga0495587_0021758 | Ga0495587_0021758_1010_1432 | 140 |
| 275 | 3300046536 | Ga0495587_0286172 | Ga0495587_0286172_482_904 | 140 |
| 276 | 3300046538 | Ga0495609_0086049 | Ga0495609_0086049_346_768 | 140 |
| 277 | 3300046542 | Ga0495597_0045707 | Ga0495597_0045707_256_678 | 140 |
| 278 | 3300046543 | Ga0495645_0000609 | Ga0495645_0000609_10852_11274 | 140 |
| 279 | 3300046558 | Ga0495633_0231400 | Ga0495633_0231400_339_776 | 140 |
| 280 | 3300046559 | Ga0495667_0006380 | Ga0495667_0006380_83_505 | 140 |
| 281 | 3300046559 | Ga0495667_0317840 | Ga0495667_0317840_476_901 | 140 |
| 282 | 3300046615 | Ga0495656_0299563 | Ga0495656_0299563_358_783 | 140 |
| 283 | 3300046615 | Ga0495656_0396511 | Ga0495656_0396511_136_573 | 140 |
| 284 | 3300046642 | Ga0495634_0055888 | Ga0495634_0055888_2093_2515 | 140 |
| 285 | 3300046663 | Ga0495635_0479360 | Ga0495635_0479360_131_553 | 140 |
| 286 | 3300046665 | Ga0495661_0074285 | Ga0495661_0074285_1113_1535 | 140 |
| 287 | 3300046674 | Ga0495588_0703121 | Ga0495588_0703121_18_455 | 140 |
| 288 | 3300046675 | Ga0495657_0013800 | Ga0495657_0013800_14_436 | 140 |
| 289 | 3300046675 | Ga0495657_0088760 | Ga0495657_0088760_321_743 | 140 |
| 290 | 3300046678 | Ga0495599_0001013 | Ga0495599_0001013_9053_9475 | 140 |
| 291 | 3300046678 | Ga0495599_0036993 | Ga0495599_0036993_2449_2871 | 140 |
| 292 | 3300046681 | Ga0495647_0002196 | Ga0495647_0002196_802_1224 | 140 |
| 293 | 3300046683 | Ga0495658_0129309 | Ga0495658_0129309_888_1310 | 140 |
| 294 | 3300046690 | Ga0495624_0442838 | Ga0495624_0442838_83_505 | 140 |
| 295 | 3300046691 | Ga0495670_0030248 | Ga0495670_0030248_202_624 | 140 |
| 296 | 3300046692 | Ga0495671_0001007 | Ga0495671_0001007_7309_7731 | 140 |
| 297 | 3300046694 | Ga0495649_0067323 | Ga0495649_0067323_707_1132 | 140 |
| 298 | 3300046794 | Ga0495589_0059671 | Ga0495589_0059671_1244_1669 | 140 |
| 299 | 3300046794 | Ga0495589_0182441 | Ga0495589_0182441_176_598 | 140 |
| 300 | 3300046809 | Ga0495600_0000657 | Ga0495600_0000657_16182_16604 | 140 |
| 301 | 3300046809 | Ga0495600_0239282 | Ga0495600_0239282_37_462 | 140 |
| 302 | 3300046810 | Ga0495660_0390797 | Ga0495660_0390797_66_488 | 140 |
| 303 | 3300047315 | Ga0495581_0060071 | Ga0495581_0060071_1588_2010 | 140 |
| 304 | 3300047317 | Ga0495604_0005804 | Ga0495604_0005804_5253_5675 | 140 |
| 305 | 3300047317 | Ga0495604_0074579 | Ga0495604_0074579_1590_2012 | 140 |
| 306 | 3300047317 | Ga0495604_0126381 | Ga0495604_0126381_863_1285 | 140 |
| 307 | 3300047318 | Ga0495636_0110032 | Ga0495636_0110032_349_774 | 140 |
| 308 | 3300047319 | Ga0495674_0052241 | Ga0495674_0052241_1091_1513 | 140 |
| 309 | 3300047320 | Ga0495672_0275808 | Ga0495672_0275808_349_771 | 140 |
| 310 | 3300047322 | Ga0495680_0045682 | Ga0495680_0045682_799_1221 | 140 |
| 311 | 3300047322 | Ga0495680_0271562 | Ga0495680_0271562_506_928 | 140 |
| 312 | 3300047322 | Ga0495680_0487619 | Ga0495680_0487619_244_666 | 140 |
| 313 | 3300047444 | Ga0495675_0073997 | Ga0495675_0073997_1317_1739 | 140 |
| 314 | 3300047444 | Ga0495675_0133584 | Ga0495675_0133584_739_1161 | 140 |
| 315 | 3300047445 | Ga0495677_0117693 | Ga0495677_0117693_16_453 | 140 |
| 316 | 3300047447 | Ga0495685_101407 | Ga0495685_101407_116_538 | 140 |
| 317 | 3300047471 | Ga0495684_0028949 | Ga0495684_0028949_2617_3039 | 140 |
| 318 | 3300047472 | Ga0495686_0000012 | Ga0495686_0000012_364764_365189 | 140 |
| 319 | 3300048088 | Ga0495602_0704380 | Ga0495602_0704380_237_659 | 140 |
| 320 | 3300048091 | Ga0495626_0000044 | Ga0495626_0000044_140496_140921 | 140 |
| 321 | 3300048091 | Ga0495626_0002425 | Ga0495626_0002425_6879_7301 | 140 |
| 322 | 3300048091 | Ga0495626_0014747 | Ga0495626_0014747_904_1326 | 140 |
| 323 | 3300048919 | Ga0496116_0002072 | Ga0496116_0002072_167_589 | 140 |
| 324 | 3300048924 | Ga0496121_0085613 | Ga0496121_0085613_1323_1745 | 140 |
| 325 | 3300048925 | Ga0496122_0001123 | Ga0496122_0001123_7791_8213 | 140 |
| 326 | 3300048926 | Ga0496123_0000957 | Ga0496123_0000957_37001_37423 | 140 |
| 327 | 3300048928 | Ga0496125_0102993 | Ga0496125_0102993_1153_1575 | 140 |
| 328 | 3300048928 | Ga0496125_0194611 | Ga0496125_0194611_194_616 | 140 |
| 329 | 3300048929 | Ga0496126_0197475 | Ga0496126_0197475_406_828 | 140 |
| 330 | 3300049571 | Ga0501034_1074222 | Ga0501034_1074222_212_637 | 140 |
| 331 | 3300049580 | Ga0501046_1024016 | Ga0501046_1024016_58_483 | 140 |
| 332 | 3300049581 | Ga0501047_0004029 | Ga0501047_0004029_5410_5835 | 140 |
| 333 | 3300049581 | Ga0501047_0126604 | Ga0501047_0126604_1106_1531 | 140 |
| 334 | 3300049584 | Ga0501068_0063849 | Ga0501068_0063849_745_1170 | 140 |
| 335 | 3300049586 | Ga0501070_0070247 | Ga0501070_0070247_2191_2616 | 140 |
| 336 | 3300049589 | Ga0501073_0000686 | Ga0501073_0000686_13008_13433 | 140 |
| 337 | 3300049589 | Ga0501073_0205693 | Ga0501073_0205693_655_1077 | 140 |
| 338 | 3300049590 | Ga0501074_0002270 | Ga0501074_0002270_3857_4282 | 140 |
| 339 | 3300049590 | Ga0501074_1049741 | Ga0501074_1049741_136_558 | 140 |
| 340 | 3300049592 | Ga0501076_0343254 | Ga0501076_0343254_30_455 | 140 |
| 341 | 3300049741 | Ga0501079_0003490 | Ga0501079_0003490_9935_10360 | 140 |
| 342 | 3300049742 | Ga0501080_0025389 | Ga0501080_0025389_2010_2435 | 140 |
| 343 | 3300049742 | Ga0501080_0278383 | Ga0501080_0278383_972_1397 | 140 |
| 344 | 3300049742 | Ga0501080_0282084 | Ga0501080_0282084_690_1112 | 140 |
| 345 | 3300049744 | Ga0501083_0028844 | Ga0501083_0028844_3178_3603 | 140 |
| 346 | 3300049822 | Ga0501035_0893297 | Ga0501035_0893297_103_528 | 140 |
| 347 | 3300049822 | Ga0501035_1073553 | Ga0501035_1073553_197_619 | 140 |
| 348 | 3300049823 | Ga0501044_0094663 | Ga0501044_0094663_1538_1963 | 140 |
| 349 | 3300049823 | Ga0501044_0406755 | Ga0501044_0406755_691_1113 | 140 |
| 350 | 3300049823 | Ga0501044_0571167 | Ga0501044_0571167_222_647 | 140 |
| 351 | 3300050491 | nmdc:mga00v17_28553_c1 | nmdc:mga00v17_28553_c1_1945_2379 | 140 |
| 352 | 3300050514 | nmdc:mga08x19_354853_c1 | nmdc:mga08x19_354853_c1_278_700 | 140 |
| 353 | 3300053077 | Ga0495601_0014358 | Ga0495601_0014358_621_1043 | 140 |
| 354 | 3300053077 | Ga0495601_0127247 | Ga0495601_0127247_1149_1571 | 140 |
| 355 | 3300053077 | Ga0495601_0800105 | Ga0495601_0800105_162_584 | 140 |
| 356 | 3300053078 | Ga0495612_0144006 | Ga0495612_0144006_483_905 | 140 |
| 357 | 3300053084 | Ga0495595_0004712 | Ga0495595_0004712_2973_3395 | 140 |
| 358 | 3300053085 | Ga0495619_0202807 | Ga0495619_0202807_514_936 | 140 |
| 359 | 3300053136 | Ga0500559_0086538 | Ga0500559_0086538_767_1189 | 140 |
| 360 | 3300060353 | Ga0501082_0016837 | Ga0501082_0016837_1130_1555 | 140 |
| 361 | 3300006195 | Ga0075366_10043785 | Ga0075366_100437852 | 141 |
| 362 | 3300006353 | Ga0075370_10600230 | Ga0075370_106002301 | 141 |
| 363 | 3300014326 | Ga0157380_10874889 | Ga0157380_108748892 | 141 |
| 364 | 3300050496 | nmdc:mga07m45_805716_c1 | nmdc:mga07m45_805716_c1_41_469 | 141 |
| 365 | iso_pu_bacteria | 2857542790 | 2857544020 | 141 |
| 366 | 3300017792 | Ga0163161_10257129 | Ga0163161_102571292 | 143 |
| 367 | 3300025303 | Ga0209051_1053957 | Ga0209051_10539573 | 143 |
| 368 | 3300037471 | Ga0395905_0726998 | Ga0395905_0726998_179_610 | 143 |
| 369 | 3300048924 | Ga0496121_0021834 | Ga0496121_0021834_135_605 | 143 |
| 370 | 3300048925 | Ga0496122_0143105 | Ga0496122_0143105_790_1260 | 143 |
| 371 | 3300048927 | Ga0496124_0000007 | Ga0496124_0000007_349154_349624 | 143 |
| 372 | 3300003187 | JGI25151J46595_10000065 | JGI25151J46595_1000006595 | 148 |
| 373 | 3300003771 | Ga0055526_1019875 | Ga0055526_10198752 | 148 |
| 374 | 3300003775 | Ga0055524_1012514 | Ga0055524_10125142 | 148 |
| 375 | 3300003784 | Ga0055534_1000135 | Ga0055534_100013542 | 148 |
| 376 | 3300005459 | Ga0068867_100387136 | Ga0068867_1003871362 | 148 |
| 377 | 3300005547 | Ga0070693_100294426 | Ga0070693_1002944262 | 148 |
| 378 | 3300005616 | Ga0068852_100046536 | Ga0068852_1000465364 | 148 |
| 379 | 3300005842 | Ga0068858_100000589 | Ga0068858_10000058931 | 148 |
| 380 | 3300009093 | Ga0105240_10523513 | Ga0105240_105235132 | 148 |
| 381 | 3300009176 | Ga0105242_10002633 | Ga0105242_1000263313 | 148 |
| 382 | 3300009177 | Ga0105248_10350108 | Ga0105248_103501082 | 148 |
| 383 | 3300009551 | Ga0105238_10942583 | Ga0105238_109425832 | 148 |
| 384 | 3300013102 | Ga0157371_10000060 | Ga0157371_10000060127 | 148 |
| 385 | 3300013297 | Ga0157378_10374872 | Ga0157378_103748722 | 148 |
| 386 | 3300013306 | Ga0163162_10297440 | Ga0163162_102974403 | 148 |
| 387 | 3300014968 | Ga0157379_10079514 | Ga0157379_100795142 | 148 |
| 388 | 3300025263 | Ga0209565_1000109 | Ga0209565_100010954 | 148 |
| 389 | 3300025273 | Ga0209673_1007883 | Ga0209673_10078834 | 148 |
| 390 | 3300025291 | Ga0209675_1000118 | Ga0209675_100011859 | 148 |
| 391 | 3300025294 | Ga0209025_1000159 | Ga0209025_1000159105 | 148 |
| 392 | 3300025295 | Ga0209564_1000663 | Ga0209564_100066314 | 148 |
| 393 | 3300025299 | Ga0209256_1001659 | Ga0209256_10016597 | 148 |
| 394 | 3300025903 | Ga0207680_10524822 | Ga0207680_105248222 | 148 |
| 395 | 3300025909 | Ga0207705_10073220 | Ga0207705_100732202 | 148 |
| 396 | 3300025909 | Ga0207705_10784312 | Ga0207705_107843122 | 148 |
| 397 | 3300025913 | Ga0207695_10282439 | Ga0207695_102824392 | 148 |
| 398 | 3300025921 | Ga0207652_10264392 | Ga0207652_102643922 | 148 |
| 399 | 3300025924 | Ga0207694_10123985 | Ga0207694_101239852 | 148 |
| 400 | 3300025924 | Ga0207694_10195274 | Ga0207694_101952741 | 148 |
| 401 | 3300025934 | Ga0207686_10024079 | Ga0207686_100240794 | 148 |
| 402 | 3300025941 | Ga0207711_10154430 | Ga0207711_101544302 | 148 |
| 403 | 3300026035 | Ga0207703_10058588 | Ga0207703_100585883 | 148 |
| 404 | 3300026089 | Ga0207648_10361934 | Ga0207648_103619342 | 148 |
| 405 | 3300026142 | Ga0207698_10121211 | Ga0207698_101212113 | 148 |
| 406 | 3300026142 | Ga0207698_11619641 | Ga0207698_116196411 | 148 |
| 407 | 3300034816 | Ga0373930_0005405 | Ga0373930_0005405_687_1142 | 148 |
| 408 | 3300035691 | Ga0373931_0096157 | Ga0373931_0096157_839_1294 | 148 |
| 409 | 3300035691 | Ga0373931_0125821 | Ga0373931_0125821_689_1141 | 148 |
| 410 | 3300039437 | Ga0436365_0255624 | Ga0436365_0255624_393_848 | 148 |
| 411 | 3300047445 | Ga0495677_0337202 | Ga0495677_0337202_73_585 | 148 |
| 412 | 3300049583 | Ga0501067_0871008 | Ga0501067_0871008_14_469 | 148 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4nb0-assembly1.cif.gz_A | crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution | 0.8678 | 12 | 144 |
| 3rri-assembly1.cif.gz_A | crystal structure of glyoxalase/bleomycin resistance protein/dioxygenase from alicyclobacillus acidocaldarius | 0.839 | 13 | 146 |
| 4nb2-assembly1.cif.gz_A | crystal structure of fosb from staphylococcus aureus at 1.89 angstrom resolution - apo structure | 0.8372 | 12 | 144 |
| 4nb1-assembly1.cif.gz_B | crystal structure of fosb from staphylococcus aureus at 1.80 angstrom resolution with l-cysteine-cys9 disulfide | 0.8329 | 12 | 144 |
| 4nb2-assembly1.cif.gz_B | crystal structure of fosb from staphylococcus aureus at 1.89 angstrom resolution - apo structure | 0.8292 | 12 | 144 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3rriB00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8431 | 13 | 142 | 3.10.180.10 |
| 2p7kA00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8242 | 12 | 144 | 3.10.180.10 |
| 4nazA01 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8067 | 12 | 144 | 3.10.180.10 |
| 3rriB00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.802 | 13 | 142 | 3.10.180.10 |
| 2p7kA00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.7942 | 12 | 144 | 3.10.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0C4YJM0-F1-model_v4 | Putative dioxygenase | 0.9965 | 14 | 148 |
GO:0051213
|
| AF-A0A7C4E557-F1-model_v4 | Glyoxalase | 0.9899 | 9 | 148 |
|
| AF-A0A0C4YJM0-F1-model_v4 | Putative dioxygenase | 0.9892 | 14 | 148 |
GO:0051213
|
| AF-A0A357EZN1-F1-model_v4 | Glyoxalase | 0.9834 | 14 | 63 |
|
| AF-A0A522RSE7-F1-model_v4 | DUF1543 domain-containing protein | 0.9805 | 12 | 148 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar