F437892

General Info

Members Datasets Scaffolds Average Seq Length
412 298 824 427

Family's Representative Sequence

Representative Sequence 3300046539|Ga0495621_0009285|Ga0495621_0009285_533_1918
Length 461
Sequence MRTASTPVASASIDLSLQSHFQRKQATMQRKTFIRTLAVQLMAAGGLFAGAASLLHAQTPVELQFYYPVAVGGPIAKTIDGFATGFMKENPGVKVTPIYAGTYQETIVKALTAHKSGTPPVTSVLLSTDMFTLIDEDAIVPFDDFVKTAEDKAWLNSFYKAFMMNSQTGGKTWGIPFQRSTVVMYWNKELFKEAGLDPNKPPTTWAELKDAATKLTKKDASGKVTQWGVQIPSSGFPYWLFQTLTTPNDTILANEAGTAVRFDDPKVVEALQYWVDLGKAGIHPPGVVEWGTTPKDFFEKKAAIIYTTTGNLTNIKANAKFDFGVGMIPGNKRKGSPTGGGNFYIFKKSTPAQQEAAFKFAKWVTQPERAAQWSMDTGYVAVSPAAYETDTLRKYGRDFPAALVARDQLPVSVAEFSTHDNQRVTKALNDGLQAALTGGKTPAQAMQDAQREADRILRSFK

Samples

Sample ID Description Type Environment
1 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
98 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
99 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
100 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
102 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
155 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
171 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
172 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
173 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
174 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
176 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
177 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
178 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
179 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
180 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
181 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
186 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
187 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
188 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
189 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
190 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
191 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
192 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
193 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
194 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
198 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
199 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
200 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
201 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
202 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
203 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
204 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
205 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
206 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
207 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
208 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
209 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
210 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
211 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
212 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
213 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
214 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
215 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
216 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
217 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
218 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
219 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
220 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
221 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
222 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
223 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
224 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
225 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
226 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
227 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
228 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
229 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
230 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
231 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
232 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
233 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
239 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
240 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
243 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
244 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
250 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
251 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
252 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
253 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
254 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
255 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
256 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
257 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
258 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
261 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
262 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
263 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
264 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
265 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
266 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
267 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
268 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
269 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
270 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
271 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
272 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
273 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
274 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
275 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
276 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
277 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
278 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
279 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
280 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
281 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
282 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
283 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
284 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
285 2643221733 Bosea sp. Root381 Isolate Unclassified
286 2643221734 Bosea sp. Root670 Isolate Unclassified
287 2721755523 Delftia sp. HK171 Isolate Unclassified
288 2738543013 Variovorax sp. BT01 Isolate Unclassified
289 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified
290 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
291 2841760612 Bosea sp. Tri-49 Isolate Nodule
292 2842733646 Variovorax sp. R-72446 Isolate Unclassified
293 2842747753 Variovorax sp. R-72060 Isolate Unclassified
294 2844104063 Bosea sp. Tri-39 Isolate Nodule
295 2851246043 Bosea sp. Tri-54 Isolate Nodule
296 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
297 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
298 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.36
Metatranscriptomes 0
Isolates 3.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.98
Nodule 1.46
Rhizoplane 3.16
Rhizosphere 82.28
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495621_0009285 3300046539 Bacteria 2983
2 JGI25159J45721_1010956 3300002987 Bacteria 2260
3 JGI25159J45721_1017398 3300002987 Bacteria 1489
4 JGI25151J46595_10000015 3300003187 Bacteria 250420
5 Ga0055526_1000870 3300003771 Bacteria 22546
6 Ga0055526_1003308 3300003771 Bacteria 10320
7 Ga0055524_1000064 3300003775 Bacteria 133574
8 Ga0055524_1003410 3300003775 Bacteria 7722
9 Ga0055536_1007807 3300003781 Bacteria 4721
10 Ga0055534_1000991 3300003784 Bacteria 12493
11 Ga0065165_1000209 3300005262 Bacteria 101834
12 Ga0065704_10078731 3300005289 Bacteria 4348
13 Ga0065715_10173591 3300005293 Bacteria 1528
14 Ga0070676_10000037 3300005328 Bacteria 39444
15 Ga0070676_10020655 3300005328 Bacteria 3680
16 Ga0070683_100010763 3300005329 Bacteria 7870
17 Ga0070670_100001622 3300005331 Bacteria 18193
18 Ga0070670_100023868 3300005331 Bacteria 5262
19 Ga0068869_100000916 3300005334 Bacteria 16992
20 Ga0068869_100040067 3300005334 Bacteria 3348
21 Ga0070666_10099581 3300005335 Bacteria 2002
22 Ga0070680_100000611 3300005336 Bacteria 24734
23 Ga0070682_100000395 3300005337 Bacteria 29105
24 Ga0070682_100019992 3300005337 Bacteria 3934
25 Ga0068868_100040319 3300005338 Bacteria 3634
26 Ga0070660_100000167 3300005339 Bacteria 43059
27 Ga0070660_100029248 3300005339 Bacteria 4127
28 Ga0070689_100019447 3300005340 Bacteria 5023
29 Ga0070687_100060116 3300005343 Bacteria 2003
30 Ga0070661_100000190 3300005344 Bacteria 50874
31 Ga0070692_10000116 3300005345 Bacteria 18580
32 Ga0070668_100128079 3300005347 Bacteria 2035
33 Ga0070669_100013235 3300005353 Bacteria 5865
34 Ga0070659_100001211 3300005366 Bacteria 18742
35 Ga0070659_100055768 3300005366 Bacteria 3115
36 Ga0070703_10006072 3300005406 Bacteria 3382
37 Ga0070714_100010756 3300005435 Bacteria 7241
38 Ga0070713_100032057 3300005436 Bacteria 4193
39 Ga0070710_10042297 3300005437 Bacteria 2518
40 Ga0070710_10068321 3300005437 Bacteria 2041
41 Ga0070705_100000345 3300005440 Bacteria 27446
42 Ga0070694_100001040 3300005444 Bacteria 15832
43 Ga0070694_100009871 3300005444 Bacteria 5869
44 Ga0070694_100059675 3300005444 Bacteria 2599
45 Ga0070694_100120979 3300005444 Bacteria 1878
46 Ga0070708_100040446 3300005445 Bacteria 4082
47 Ga0070708_100049730 3300005445 Bacteria 3709
48 Ga0070708_100051866 3300005445 Bacteria 3635
49 Ga0070708_100153360 3300005445 Bacteria 2144
50 Ga0070663_100108457 3300005455 Bacteria 2083
51 Ga0070678_100006531 3300005456 Bacteria 6849
52 Ga0070662_100006150 3300005457 Bacteria 7718
53 Ga0070662_100051729 3300005457 Bacteria 2967
54 Ga0068867_100000544 3300005459 Bacteria 24792
55 Ga0070706_100005932 3300005467 Bacteria 11557
56 Ga0070706_100032962 3300005467 Bacteria 4779
57 Ga0070706_100144514 3300005467 Bacteria 2221
58 Ga0070706_100335531 3300005467 Bacteria 1410
59 Ga0070707_100063586 3300005468 Bacteria 3541
60 Ga0070707_100096486 3300005468 Bacteria 2864
61 Ga0070707_100183288 3300005468 Bacteria 2041
62 Ga0070707_100198001 3300005468 Bacteria 1958
63 Ga0070707_100203469 3300005468 Bacteria 1930
64 Ga0070707_100213554 3300005468 Bacteria 1880
65 Ga0070698_100004603 3300005471 Bacteria 15149
66 Ga0070698_100014307 3300005471 Bacteria 8386
67 Ga0070698_100096097 3300005471 Bacteria 2939
68 Ga0070698_100103924 3300005471 Bacteria 2810
69 Ga0070699_100004306 3300005518 Bacteria 12582
70 Ga0070679_100003345 3300005530 Bacteria 14686
71 Ga0070697_100055286 3300005536 Bacteria 3227
72 Ga0068853_100000310 3300005539 Bacteria 34272
73 Ga0068853_100093348 3300005539 Bacteria 2649
74 Ga0070672_100107862 3300005543 Bacteria 2267
75 Ga0070695_100004486 3300005545 Bacteria 8201
76 Ga0070695_100056120 3300005545 Bacteria 2541
77 Ga0070695_100066390 3300005545 Bacteria 2351
78 Ga0070696_100045281 3300005546 Bacteria 3048
79 Ga0070696_100056573 3300005546 Bacteria 2736
80 Ga0070696_100217425 3300005546 Bacteria 1432
81 Ga0070693_100000058 3300005547 Bacteria 43221
82 Ga0070665_100057270 3300005548 Bacteria 3907
83 Ga0070704_100000355 3300005549 Bacteria 20791
84 Ga0068855_100002540 3300005563 Bacteria 22481
85 Ga0068857_100004036 3300005577 Bacteria 12358
86 Ga0068854_100005049 3300005578 Bacteria 8314
87 Ga0068856_100001786 3300005614 Bacteria 22477
88 Ga0068852_100140995 3300005616 Bacteria 2231
89 Ga0068859_100018341 3300005617 Bacteria 7036
90 Ga0068864_100001002 3300005618 Bacteria 23625
91 Ga0068861_100002712 3300005719 Bacteria 11588
92 Ga0068861_100005839 3300005719 Bacteria 8361
93 Ga0068870_10000538 3300005840 Bacteria 14309
94 Ga0068863_100003230 3300005841 Bacteria 16139
95 Ga0068862_100023265 3300005844 Bacteria 5190
96 Ga0068862_100180603 3300005844 Bacteria 1894
97 Ga0081455_10003721 3300005937 Bacteria 17434
98 Ga0081455_10005475 3300005937 Bacteria 13920
99 Ga0081540_1006534 3300005983 Bacteria 8470
100 Ga0081539_10025705 3300005985 Bacteria 3779
101 Ga0070717_10026666 3300006028 Bacteria 4612
102 Ga0075365_10043683 3300006038 Bacteria 2934
103 Ga0075363_100003574 3300006048 Bacteria 6648
104 Ga0075364_10022623 3300006051 Bacteria 3972
105 Ga0070712_100020429 3300006175 Bacteria 4333
106 Ga0070712_100038802 3300006175 Bacteria 3256
107 Ga0075367_10000430 3300006178 Bacteria 15575
108 Ga0097621_100117445 3300006237 Bacteria 2254
109 Ga0068871_100285445 3300006358 Bacteria 1445
110 Ga0075428_100010752 3300006844 Bacteria 10172
111 Ga0075428_100012192 3300006844 Bacteria 9558
112 Ga0075428_100032233 3300006844 Bacteria 5788
113 Ga0075428_100240332 3300006844 Bacteria 1954
114 Ga0075430_100003068 3300006846 Bacteria 13958
115 Ga0075430_100037602 3300006846 Bacteria 4103
116 Ga0075430_100082796 3300006846 Bacteria 2689
117 Ga0075430_100088859 3300006846 Bacteria 2585
118 Ga0075431_100000637 3300006847 Bacteria 29659
119 Ga0075431_100004847 3300006847 Bacteria 13251
120 Ga0075431_100008959 3300006847 Bacteria 10032
121 Ga0075431_100262949 3300006847 Bacteria 1751
122 Ga0075433_10037197 3300006852 Bacteria 4197
123 Ga0075433_10275309 3300006852 Bacteria 1492
124 Ga0075434_100025253 3300006871 Bacteria 5813
125 Ga0075434_100189055 3300006871 Bacteria 2079
126 Ga0075429_100002426 3300006880 Bacteria 15697
127 Ga0097620_100018341 3300006931 Bacteria 7036
128 Ga0079104_1000002 3300006946 Bacteria 514469
129 Ga0075435_100009762 3300007076 Bacteria 6980
130 Ga0075435_100048889 3300007076 Bacteria 3399
131 Ga0075435_100057136 3300007076 Bacteria 3156
132 Ga0105250_10001468 3300009092 Bacteria 12750
133 Ga0105240_10051365 3300009093 Bacteria 5188
134 Ga0111539_10005255 3300009094 Bacteria 16767
135 Ga0111539_10213032 3300009094 Bacteria 2251
136 Ga0105245_10035266 3300009098 Bacteria 4439
137 Ga0114129_10008480 3300009147 Bacteria 14644
138 Ga0114129_10009966 3300009147 Bacteria 13544
139 Ga0114129_10018657 3300009147 Bacteria 9876
140 Ga0105243_10002140 3300009148 Bacteria 16691
141 Ga0105243_10113204 3300009148 Bacteria 2275
142 Ga0105243_10168062 3300009148 Bacteria 1897
143 Ga0105243_10214295 3300009148 Bacteria 1698
144 Ga0105241_10000843 3300009174 Bacteria 23221
145 Ga0105241_10099666 3300009174 Bacteria 2308
146 Ga0105237_10160838 3300009545 Bacteria 2244
147 Ga0157373_10000229 3300013100 Bacteria 45851
148 Ga0157370_10092794 3300013104 Bacteria 2833
149 Ga0157369_10024909 3300013105 Bacteria 6648
150 Ga0163162_10184843 3300013306 Bacteria 2211
151 Ga0157372_10000144 3300013307 Bacteria 78166
152 Ga0157372_10128871 3300013307 Bacteria 2910
153 Ga0182008_10001893 3300014497 Bacteria 13569
154 Ga0182008_10004208 3300014497 Bacteria 8456
155 Ga0157379_10106021 3300014968 Bacteria 2523
156 Ga0182005_1020929 3300015265 Bacteria 1797
157 Ga0183362_10001 3300015683 Bacteria 2046624
158 Ga0213875_10000003 3300021388 Bacteria 719367
159 Ga0209784_102533 3300025224 Bacteria 1798
160 Ga0209130_1000080 3300025284 Bacteria 166684
161 Ga0209130_1002907 3300025284 Bacteria 7878
162 Ga0209676_1001873 3300025292 Bacteria 17254
163 Ga0209025_1000010 3300025294 Bacteria 986612
164 Ga0209564_1000048 3300025295 Bacteria 364806
165 Ga0209564_1000191 3300025295 Bacteria 142504
166 Ga0209050_1025081 3300025298 Bacteria 2039
167 Ga0209256_1000041 3300025299 Bacteria 364827
168 Ga0209256_1000234 3300025299 Bacteria 99080
169 Ga0209051_1008540 3300025303 Bacteria 5411
170 Ga0209257_1015023 3300025304 Bacteria 3263
171 Ga0207696_1007288 3300025711 Bacteria 4345
172 Ga0207653_10007502 3300025885 Bacteria 3399
173 Ga0207688_10085104 3300025901 Bacteria 1811
174 Ga0207685_10027349 3300025905 Bacteria 1995
175 Ga0207699_10115836 3300025906 Bacteria 1725
176 Ga0207645_10004327 3300025907 Bacteria 10524
177 Ga0207643_10000315 3300025908 Bacteria 33469
178 Ga0207684_10010523 3300025910 Bacteria 8133
179 Ga0207684_10048560 3300025910 Bacteria 3600
180 Ga0207654_10001271 3300025911 Bacteria 13437
181 Ga0207654_10099015 3300025911 Bacteria 1793
182 Ga0207707_10000280 3300025912 Bacteria 54565
183 Ga0207707_10148107 3300025912 Bacteria 2052
184 Ga0207695_10201529 3300025913 Bacteria 1904
185 Ga0207671_10109597 3300025914 Bacteria 2099
186 Ga0207693_10000104 3300025915 Bacteria 76023
187 Ga0207693_10050061 3300025915 Bacteria 3281
188 Ga0207660_10000076 3300025917 Bacteria 51418
189 Ga0207660_10015053 3300025917 Bacteria 5099
190 Ga0207657_10000383 3300025919 Bacteria 46673
191 Ga0207657_10023741 3300025919 Bacteria 5702
192 Ga0207649_10000454 3300025920 Bacteria 29523
193 Ga0207652_10003560 3300025921 Bacteria 12852
194 Ga0207652_10161443 3300025921 Bacteria 2009
195 Ga0207646_10004960 3300025922 Bacteria 14219
196 Ga0207646_10018600 3300025922 Bacteria 6478
197 Ga0207681_10025519 3300025923 Bacteria 3802
198 Ga0207650_10065847 3300025925 Bacteria 2716
199 Ga0207687_10154233 3300025927 Bacteria 1756
200 Ga0207664_10000798 3300025929 Bacteria 21299
201 Ga0207690_10001025 3300025932 Bacteria 17884
202 Ga0207706_10001349 3300025933 Bacteria 24531
203 Ga0207709_10000015 3300025935 Bacteria 493221
204 Ga0207670_10081395 3300025936 Bacteria 2266
205 Ga0207665_10002820 3300025939 Bacteria 11651
206 Ga0207691_10066046 3300025940 Bacteria 3273
207 Ga0207689_10000127 3300025942 Bacteria 64217
208 Ga0207689_10010100 3300025942 Bacteria 8138
209 Ga0207679_10000422 3300025945 Bacteria 30232
210 Ga0207667_10002268 3300025949 Bacteria 24173
211 Ga0207651_10220388 3300025960 Bacteria 1533
212 Ga0207668_10102835 3300025972 Bacteria 2126
213 Ga0207640_10001946 3300025981 Bacteria 11119
214 Ga0207658_10094844 3300025986 Bacteria 2323
215 Ga0207677_10042343 3300026023 Bacteria 3019
216 Ga0207703_10332869 3300026035 Bacteria 1393
217 Ga0207639_10001450 3300026041 Bacteria 15974
218 Ga0207678_10027974 3300026067 Bacteria 4923
219 Ga0207678_10055020 3300026067 Bacteria 3427
220 Ga0207708_10209941 3300026075 Bacteria 1556
221 Ga0207702_10001524 3300026078 Bacteria 22928
222 Ga0207702_10254264 3300026078 Bacteria 1651
223 Ga0207648_10001136 3300026089 Bacteria 29916
224 Ga0207674_10000720 3300026116 Bacteria 43278
225 Ga0207675_100019870 3300026118 Bacteria 6269
226 Ga0207683_10050189 3300026121 Bacteria 3654
227 Ga0209281_1000007 3300027111 Bacteria 938265
228 Ga0209996_1005923 3300027395 Bacteria 1571
229 Ga0210000_1008766 3300027462 Bacteria 1485
230 Ga0209995_1004743 3300027471 Bacteria 2183
231 Ga0209968_1002594 3300027526 Bacteria 2724
232 Ga0209999_1000487 3300027543 Bacteria 6161
233 Ga0209982_1007514 3300027552 Bacteria 1592
234 Ga0209970_1001894 3300027614 Bacteria 3610
235 Ga0209983_1004494 3300027665 Bacteria 2929
236 Ga0209971_1000038 3300027682 Bacteria 44480
237 Ga0209966_1000239 3300027695 Bacteria 20394
238 Ga0209998_10000020 3300027717 Bacteria 77474
239 Ga0209974_10012237 3300027876 Bacteria 2871
240 Ga0207428_10006857 3300027907 Bacteria 10439
241 Ga0268266_10042707 3300028379 Bacteria 3873
242 Ga0268265_10030425 3300028380 Bacteria 3888
243 Ga0268265_10076271 3300028380 Bacteria 2629
244 Ga0268265_10147662 3300028380 Bacteria 1978
245 Ga0265331_10027618 3300031250 Bacteria 2844
246 Ga0307513_10063921 3300031456 Bacteria 3882
247 Ga0265314_10003499 3300031711 Bacteria 15157
248 Ga0265314_10141204 3300031711 Bacteria 1489
249 Ga0373944_0002791 3300035089 Bacteria 4469
250 Ga0373936_0020421 3300035113 Bacteria 2573
251 Ga0373945_0002496 3300035116 Bacteria 5763
252 Ga0373954_0004827 3300035118 Bacteria 5813
253 Ga0373943_0006526 3300035170 Bacteria 5241
254 Ga0373946_0004968 3300035171 Bacteria 4788
255 Ga0373935_0012453 3300035692 Bacteria 5116
256 Ga0373927_0014173 3300035695 Bacteria 5284
257 Ga0373947_0016803 3300035725 Bacteria 4204
258 Ga0373947_0022917 3300035725 Bacteria 3626
259 Ga0373937_0010417 3300036401 Bacteria 8119
260 Ga0373937_0012611 3300036401 Bacteria 7438
261 Ga0373937_0255107 3300036401 Bacteria 1653
262 Ga0373925_0019920 3300037068 Bacteria 4880
263 Ga0395905_0000352 3300037471 Bacteria 65434
264 Ga0395905_0059338 3300037471 Bacteria 3576
265 Ga0436364_0935612 3300037853 Bacteria 116078
266 Ga0436365_1912000 3300039437 Bacteria 1382
267 Ga0436360_0489178 3300039438 Bacteria 2313
268 Ga0439449_0046063 3300042007 Bacteria 1616
269 Ga0450889_000884 3300042144 Bacteria 3215
270 Ga0439458_0003800 3300042157 Bacteria 3495
271 Ga0439435_0003382 3300042436 Bacteria 3315
272 Ga0439459_0000291 3300042438 Bacteria 5974
273 Ga0451577_0015772 3300042876 Bacteria 7013
274 Ga0453683_0039876 3300044673 Bacteria 2951
275 Ga0451576_0024166 3300045051 Bacteria 6566
276 Ga0451576_0070344 3300045051 Bacteria 3642
277 Ga0451576_0213253 3300045051 Bacteria 2016
278 Ga0466967_0068527 3300045976 Bacteria 3169
279 Ga0495592_0033263 3300046454 Bacteria 3889
280 Ga0495603_0004975 3300046455 Bacteria 7953
281 Ga0495629_0034191 3300046459 Bacteria 3593
282 Ga0495638_0079649 3300046460 Bacteria 1991
283 Ga0495641_0006107 3300046461 Bacteria 7901
284 Ga0495653_0119089 3300046463 Bacteria 1885
285 Ga0495580_0017576 3300046472 Bacteria 5344
286 Ga0495580_0156713 3300046472 Bacteria 1577
287 Ga0495582_0005438 3300046473 Bacteria 7106
288 Ga0495639_0002541 3300046475 Bacteria 7961
289 Ga0495639_0015851 3300046475 Bacteria 3268
290 Ga0495664_0005370 3300046477 Bacteria 7030
291 Ga0495585_0009814 3300046492 Bacteria 5727
292 Ga0495594_0003707 3300046499 Bacteria 7839
293 Ga0495607_0000153 3300046501 Bacteria 72099
294 Ga0495607_0032166 3300046501 Bacteria 3205
295 Ga0495618_0010036 3300046514 Bacteria 5727
296 Ga0495666_0004646 3300046526 Bacteria 6947
297 Ga0495652_0042351 3300046529 Bacteria 3926
298 Ga0495665_0013698 3300046531 Bacteria 4380
299 Ga0495597_0000110 3300046542 Bacteria 72678
300 Ga0495645_0104441 3300046543 Bacteria 2012
301 Ga0495622_0010451 3300046557 Bacteria 4286
302 Ga0495656_0002279 3300046615 Bacteria 6332
303 Ga0495656_0004758 3300046615 Bacteria 4665
304 Ga0495634_0039267 3300046642 Bacteria 3223
305 Ga0495611_0021078 3300046648 Bacteria 2813
306 Ga0495635_0012174 3300046663 Bacteria 6031
307 Ga0495588_0014226 3300046674 Bacteria 3805
308 Ga0495599_0021230 3300046678 Bacteria 4050
309 Ga0495658_0003102 3300046683 Bacteria 8307
310 Ga0495624_0009297 3300046690 Bacteria 6809
311 Ga0495670_0022823 3300046691 Bacteria 3090
312 Ga0495600_0014898 3300046809 Bacteria 4907
313 Ga0495604_0055744 3300047317 Bacteria 3045
314 Ga0495604_0146711 3300047317 Bacteria 1681
315 Ga0495676_0083236 3300047321 Bacteria 2418
316 Ga0495680_0015829 3300047322 Bacteria 6493
317 Ga0495684_0049499 3300047471 Bacteria 3210
318 Ga0495614_0051696 3300048089 Bacteria 1761
319 Ga0496101_0018330 3300048904 Bacteria 4758
320 Ga0496103_0086250 3300048906 Bacteria 1979
321 Ga0496104_0001619 3300048907 Bacteria 19424
322 Ga0496104_0003856 3300048907 Bacteria 12972
323 Ga0496105_0005900 3300048908 Bacteria 9340
324 Ga0496107_0076043 3300048910 Bacteria 2445
325 Ga0496110_0173539 3300048913 Bacteria 1956
326 Ga0496111_0047949 3300048914 Bacteria 3077
327 Ga0496112_0017316 3300048915 Bacteria 6768
328 Ga0496112_0110951 3300048915 Bacteria 2713
329 Ga0496113_0171168 3300048916 Bacteria 1720
330 Ga0496113_0205909 3300048916 Bacteria 1565
331 Ga0496114_0014683 3300048917 Bacteria 6294
332 Ga0496122_0000103 3300048925 Bacteria 196819
333 Ga0496122_0175115 3300048925 Bacteria 1287
334 Ga0496123_0000331 3300048926 Bacteria 89734
335 Ga0501039_0187066 3300049575 Bacteria 1629
336 Ga0501040_0004097 3300049576 Bacteria 9477
337 Ga0501040_0028333 3300049576 Bacteria 3775
338 Ga0501042_0000578 3300049578 Bacteria 19366
339 Ga0501046_0000300 3300049580 Bacteria 49836
340 Ga0501047_0014284 3300049581 Bacteria 7550
341 Ga0501047_0044476 3300049581 Bacteria 4291
342 Ga0501068_0011763 3300049584 Bacteria 4947
343 Ga0501071_0043571 3300049587 Bacteria 3218
344 Ga0501072_0012209 3300049588 Bacteria 6565
345 Ga0501072_0111141 3300049588 Bacteria 2181
346 Ga0501074_0017165 3300049590 Bacteria 5251
347 Ga0501075_0090130 3300049591 Bacteria 2326
348 Ga0501076_0035557 3300049592 Bacteria 3897
349 Ga0501079_0004471 3300049741 Bacteria 10372
350 Ga0501079_0005968 3300049741 Bacteria 9118
351 Ga0501081_0001630 3300049743 Bacteria 13882
352 Ga0501081_0017372 3300049743 Bacteria 4761
353 Ga0501083_0011945 3300049744 Bacteria 6084
354 Ga0501035_0073220 3300049822 Bacteria 3031
355 Ga0501044_0068927 3300049823 Bacteria 3602
356 Ga0501045_0012085 3300049824 Bacteria 6074
357 nmdc:mga00v17_11406_c1 3300050491 Bacteria 4885
358 nmdc:mga0yw44_42237_c1 3300050492 Bacteria 2718
359 nmdc:mga0k408_1129_c1 3300050493 Bacteria 14642
360 nmdc:mga0k408_96647_c1 3300050493 Bacteria 1739
361 nmdc:mga06z11_163_c1 3300050494 Bacteria 26255
362 nmdc:mga06z11_8037_c1 3300050494 Bacteria 4374
363 nmdc:mga04h51_327_c1 3300050495 Bacteria 11929
364 nmdc:mga05p37_102355_c1 3300050507 Bacteria 3527
365 nmdc:mga05p37_275973_c1 3300050507 Bacteria 2007
366 nmdc:mga05p37_355755_c1 3300050507 Bacteria 1723
367 nmdc:mga05p37_62933_c1 3300050507 Bacteria 4566
368 nmdc:mga09592_15968_c1 3300050508 Bacteria 6135
369 nmdc:mga09592_268387_c1 3300050508 Bacteria 1480
370 nmdc:mga0qj67_21039_c1 3300050509 Bacteria 5001
371 nmdc:mga0qj67_6306_c1 3300050509 Bacteria 8705
372 nmdc:mga06r32_243947_c1 3300050510 Bacteria 1784
373 nmdc:mga06r32_2658_c1 3300050510 Bacteria 15973
374 nmdc:mga06r32_3596_c1 3300050510 Bacteria 13833
375 nmdc:mga06r32_86240_c1 3300050510 Bacteria 3062
376 nmdc:mga08y16_69146_c1 3300050511 Bacteria 3682
377 nmdc:mga0n895_242673_c1 3300050512 Bacteria 1828
378 nmdc:mga0n895_26383_c1 3300050512 Bacteria 5501
379 nmdc:mga0rr50_140757_c1 3300050513 Bacteria 1941
380 nmdc:mga0rr50_252656_c1 3300050513 Bacteria 1465
381 nmdc:mga0rr50_8657_c1 3300050513 Bacteria 6343
382 nmdc:mga08x19_141679_c1 3300050514 Bacteria 1624
383 nmdc:mga0a205_136173_c1 3300050515 Bacteria 2357
384 nmdc:mga0a205_271614_c1 3300050515 Bacteria 1572
385 Ga0495601_0011711 3300053077 Bacteria 5256
386 Ga0495601_0013701 3300053077 Bacteria 4878
387 Ga0495612_0008435 3300053078 Bacteria 4180
388 Ga0500641_0007281 3300053096 Bacteria 3945
389 Ga0500642_0019827 3300053130 Bacteria 2631
390 Ga0500616_0037576 3300053153 Bacteria 2621
391 Ga0500636_0004884 3300053177 Bacteria 7611
392 Ga0501084_0006461 3300054114 Bacteria 9640
393 Ga0501084_0017302 3300054114 Bacteria 5991
394 Ga0501082_0000498 3300060353 Bacteria 34785
395 Ga0501082_0155830 3300060353 Bacteria 1985
396 Ga0530510_0022927 3300061734 Bacteria 4449
397 Ga0530510_0059229 3300061734 Bacteria 2770
398 2523104150 2522572158 Bacteria 6514390
399 2644732657 2643221733 Bacteria 5690728
400 2644734557 2643221734 Bacteria 5365412
401 2722882167 2721755523 Bacteria 6430384
402 2739248755 2738543013 Bacteria 5618633
403 2837183952 2837183177 Bacteria 4637169
404 2839142685 2839138175 Bacteria 6549354
405 2841765872 2841760612 Bacteria 6454112
406 2842735868 2842733646 Bacteria 5716726
407 2842748414 2842747753 Bacteria 5578255
408 2844107482 2844104063 Bacteria 6440972
409 2851249522 2851246043 Bacteria 6439203
410 2857578680 2857576091 Bacteria 5465855
411 2929208025 2929206907 Bacteria 5918291
412 8057531887 8057529695 Bacteria 6306553
413 Ga0495621_0009285
414 JGI25159J45721_1010956
415 JGI25159J45721_1017398
416 JGI25151J46595_10000015
417 Ga0055526_1000870
418 Ga0055526_1003308
419 Ga0055524_1000064
420 Ga0055524_1003410
421 Ga0055536_1007807
422 Ga0055534_1000991
423 Ga0065165_1000209
424 Ga0065704_10078731
425 Ga0065715_10173591
426 Ga0070676_10000037
427 Ga0070676_10020655
428 Ga0070683_100010763
429 Ga0070670_100001622
430 Ga0070670_100023868
431 Ga0068869_100000916
432 Ga0068869_100040067
433 Ga0070666_10099581
434 Ga0070680_100000611
435 Ga0070682_100000395
436 Ga0070682_100019992
437 Ga0068868_100040319
438 Ga0070660_100000167
439 Ga0070660_100029248
440 Ga0070689_100019447
441 Ga0070687_100060116
442 Ga0070661_100000190
443 Ga0070692_10000116
444 Ga0070668_100128079
445 Ga0070669_100013235
446 Ga0070659_100001211
447 Ga0070659_100055768
448 Ga0070703_10006072
449 Ga0070714_100010756
450 Ga0070713_100032057
451 Ga0070710_10042297
452 Ga0070710_10068321
453 Ga0070705_100000345
454 Ga0070694_100001040
455 Ga0070694_100009871
456 Ga0070694_100059675
457 Ga0070694_100120979
458 Ga0070708_100040446
459 Ga0070708_100049730
460 Ga0070708_100051866
461 Ga0070708_100153360
462 Ga0070663_100108457
463 Ga0070678_100006531
464 Ga0070662_100006150
465 Ga0070662_100051729
466 Ga0068867_100000544
467 Ga0070706_100005932
468 Ga0070706_100032962
469 Ga0070706_100144514
470 Ga0070706_100335531
471 Ga0070707_100063586
472 Ga0070707_100096486
473 Ga0070707_100183288
474 Ga0070707_100198001
475 Ga0070707_100203469
476 Ga0070707_100213554
477 Ga0070698_100004603
478 Ga0070698_100014307
479 Ga0070698_100096097
480 Ga0070698_100103924
481 Ga0070699_100004306
482 Ga0070679_100003345
483 Ga0070697_100055286
484 Ga0068853_100000310
485 Ga0068853_100093348
486 Ga0070672_100107862
487 Ga0070695_100004486
488 Ga0070695_100056120
489 Ga0070695_100066390
490 Ga0070696_100045281
491 Ga0070696_100056573
492 Ga0070696_100217425
493 Ga0070693_100000058
494 Ga0070665_100057270
495 Ga0070704_100000355
496 Ga0068855_100002540
497 Ga0068857_100004036
498 Ga0068854_100005049
499 Ga0068856_100001786
500 Ga0068852_100140995
501 Ga0068859_100018341
502 Ga0068864_100001002
503 Ga0068861_100002712
504 Ga0068861_100005839
505 Ga0068870_10000538
506 Ga0068863_100003230
507 Ga0068862_100023265
508 Ga0068862_100180603
509 Ga0081455_10003721
510 Ga0081455_10005475
511 Ga0081540_1006534
512 Ga0081539_10025705
513 Ga0070717_10026666
514 Ga0075365_10043683
515 Ga0075363_100003574
516 Ga0075364_10022623
517 Ga0070712_100020429
518 Ga0070712_100038802
519 Ga0075367_10000430
520 Ga0097621_100117445
521 Ga0068871_100285445
522 Ga0075428_100010752
523 Ga0075428_100012192
524 Ga0075428_100032233
525 Ga0075428_100240332
526 Ga0075430_100003068
527 Ga0075430_100037602
528 Ga0075430_100082796
529 Ga0075430_100088859
530 Ga0075431_100000637
531 Ga0075431_100004847
532 Ga0075431_100008959
533 Ga0075431_100262949
534 Ga0075433_10037197
535 Ga0075433_10275309
536 Ga0075434_100025253
537 Ga0075434_100189055
538 Ga0075429_100002426
539 Ga0097620_100018341
540 Ga0079104_1000002
541 Ga0075435_100009762
542 Ga0075435_100048889
543 Ga0075435_100057136
544 Ga0105250_10001468
545 Ga0105240_10051365
546 Ga0111539_10005255
547 Ga0111539_10213032
548 Ga0105245_10035266
549 Ga0114129_10008480
550 Ga0114129_10009966
551 Ga0114129_10018657
552 Ga0105243_10002140
553 Ga0105243_10113204
554 Ga0105243_10168062
555 Ga0105243_10214295
556 Ga0105241_10000843
557 Ga0105241_10099666
558 Ga0105237_10160838
559 Ga0157373_10000229
560 Ga0157370_10092794
561 Ga0157369_10024909
562 Ga0163162_10184843
563 Ga0157372_10000144
564 Ga0157372_10128871
565 Ga0182008_10001893
566 Ga0182008_10004208
567 Ga0157379_10106021
568 Ga0182005_1020929
569 Ga0183362_10001
570 Ga0213875_10000003
571 Ga0209784_102533
572 Ga0209130_1000080
573 Ga0209130_1002907
574 Ga0209676_1001873
575 Ga0209025_1000010
576 Ga0209564_1000048
577 Ga0209564_1000191
578 Ga0209050_1025081
579 Ga0209256_1000041
580 Ga0209256_1000234
581 Ga0209051_1008540
582 Ga0209257_1015023
583 Ga0207696_1007288
584 Ga0207653_10007502
585 Ga0207688_10085104
586 Ga0207685_10027349
587 Ga0207699_10115836
588 Ga0207645_10004327
589 Ga0207643_10000315
590 Ga0207684_10010523
591 Ga0207684_10048560
592 Ga0207654_10001271
593 Ga0207654_10099015
594 Ga0207707_10000280
595 Ga0207707_10148107
596 Ga0207695_10201529
597 Ga0207671_10109597
598 Ga0207693_10000104
599 Ga0207693_10050061
600 Ga0207660_10000076
601 Ga0207660_10015053
602 Ga0207657_10000383
603 Ga0207657_10023741
604 Ga0207649_10000454
605 Ga0207652_10003560
606 Ga0207652_10161443
607 Ga0207646_10004960
608 Ga0207646_10018600
609 Ga0207681_10025519
610 Ga0207650_10065847
611 Ga0207687_10154233
612 Ga0207664_10000798
613 Ga0207690_10001025
614 Ga0207706_10001349
615 Ga0207709_10000015
616 Ga0207670_10081395
617 Ga0207665_10002820
618 Ga0207691_10066046
619 Ga0207689_10000127
620 Ga0207689_10010100
621 Ga0207679_10000422
622 Ga0207667_10002268
623 Ga0207651_10220388
624 Ga0207668_10102835
625 Ga0207640_10001946
626 Ga0207658_10094844
627 Ga0207677_10042343
628 Ga0207703_10332869
629 Ga0207639_10001450
630 Ga0207678_10027974
631 Ga0207678_10055020
632 Ga0207708_10209941
633 Ga0207702_10001524
634 Ga0207702_10254264
635 Ga0207648_10001136
636 Ga0207674_10000720
637 Ga0207675_100019870
638 Ga0207683_10050189
639 Ga0209281_1000007
640 Ga0209996_1005923
641 Ga0210000_1008766
642 Ga0209995_1004743
643 Ga0209968_1002594
644 Ga0209999_1000487
645 Ga0209982_1007514
646 Ga0209970_1001894
647 Ga0209983_1004494
648 Ga0209971_1000038
649 Ga0209966_1000239
650 Ga0209998_10000020
651 Ga0209974_10012237
652 Ga0207428_10006857
653 Ga0268266_10042707
654 Ga0268265_10030425
655 Ga0268265_10076271
656 Ga0268265_10147662
657 Ga0265331_10027618
658 Ga0307513_10063921
659 Ga0265314_10003499
660 Ga0265314_10141204
661 Ga0373944_0002791
662 Ga0373936_0020421
663 Ga0373945_0002496
664 Ga0373954_0004827
665 Ga0373943_0006526
666 Ga0373946_0004968
667 Ga0373935_0012453
668 Ga0373927_0014173
669 Ga0373947_0016803
670 Ga0373947_0022917
671 Ga0373937_0010417
672 Ga0373937_0012611
673 Ga0373937_0255107
674 Ga0373925_0019920
675 Ga0395905_0000352
676 Ga0395905_0059338
677 Ga0436364_0935612
678 Ga0436365_1912000
679 Ga0436360_0489178
680 Ga0439449_0046063
681 Ga0450889_000884
682 Ga0439458_0003800
683 Ga0439435_0003382
684 Ga0439459_0000291
685 Ga0451577_0015772
686 Ga0453683_0039876
687 Ga0451576_0024166
688 Ga0451576_0070344
689 Ga0451576_0213253
690 Ga0466967_0068527
691 Ga0495592_0033263
692 Ga0495603_0004975
693 Ga0495629_0034191
694 Ga0495638_0079649
695 Ga0495641_0006107
696 Ga0495653_0119089
697 Ga0495580_0017576
698 Ga0495580_0156713
699 Ga0495582_0005438
700 Ga0495639_0002541
701 Ga0495639_0015851
702 Ga0495664_0005370
703 Ga0495585_0009814
704 Ga0495594_0003707
705 Ga0495607_0000153
706 Ga0495607_0032166
707 Ga0495618_0010036
708 Ga0495666_0004646
709 Ga0495652_0042351
710 Ga0495665_0013698
711 Ga0495597_0000110
712 Ga0495645_0104441
713 Ga0495622_0010451
714 Ga0495656_0002279
715 Ga0495656_0004758
716 Ga0495634_0039267
717 Ga0495611_0021078
718 Ga0495635_0012174
719 Ga0495588_0014226
720 Ga0495599_0021230
721 Ga0495658_0003102
722 Ga0495624_0009297
723 Ga0495670_0022823
724 Ga0495600_0014898
725 Ga0495604_0055744
726 Ga0495604_0146711
727 Ga0495676_0083236
728 Ga0495680_0015829
729 Ga0495684_0049499
730 Ga0495614_0051696
731 Ga0496101_0018330
732 Ga0496103_0086250
733 Ga0496104_0001619
734 Ga0496104_0003856
735 Ga0496105_0005900
736 Ga0496107_0076043
737 Ga0496110_0173539
738 Ga0496111_0047949
739 Ga0496112_0017316
740 Ga0496112_0110951
741 Ga0496113_0171168
742 Ga0496113_0205909
743 Ga0496114_0014683
744 Ga0496122_0000103
745 Ga0496122_0175115
746 Ga0496123_0000331
747 Ga0501039_0187066
748 Ga0501040_0004097
749 Ga0501040_0028333
750 Ga0501042_0000578
751 Ga0501046_0000300
752 Ga0501047_0014284
753 Ga0501047_0044476
754 Ga0501068_0011763
755 Ga0501071_0043571
756 Ga0501072_0012209
757 Ga0501072_0111141
758 Ga0501074_0017165
759 Ga0501075_0090130
760 Ga0501076_0035557
761 Ga0501079_0004471
762 Ga0501079_0005968
763 Ga0501081_0001630
764 Ga0501081_0017372
765 Ga0501083_0011945
766 Ga0501035_0073220
767 Ga0501044_0068927
768 Ga0501045_0012085
769 nmdc:mga00v17_11406_c1
770 nmdc:mga0yw44_42237_c1
771 nmdc:mga0k408_1129_c1
772 nmdc:mga0k408_96647_c1
773 nmdc:mga06z11_163_c1
774 nmdc:mga06z11_8037_c1
775 nmdc:mga04h51_327_c1
776 nmdc:mga05p37_102355_c1
777 nmdc:mga05p37_275973_c1
778 nmdc:mga05p37_355755_c1
779 nmdc:mga05p37_62933_c1
780 nmdc:mga09592_15968_c1
781 nmdc:mga09592_268387_c1
782 nmdc:mga0qj67_21039_c1
783 nmdc:mga0qj67_6306_c1
784 nmdc:mga06r32_243947_c1
785 nmdc:mga06r32_2658_c1
786 nmdc:mga06r32_3596_c1
787 nmdc:mga06r32_86240_c1
788 nmdc:mga08y16_69146_c1
789 nmdc:mga0n895_242673_c1
790 nmdc:mga0n895_26383_c1
791 nmdc:mga0rr50_140757_c1
792 nmdc:mga0rr50_252656_c1
793 nmdc:mga0rr50_8657_c1
794 nmdc:mga08x19_141679_c1
795 nmdc:mga0a205_136173_c1
796 nmdc:mga0a205_271614_c1
797 Ga0495601_0011711
798 Ga0495601_0013701
799 Ga0495612_0008435
800 Ga0500641_0007281
801 Ga0500642_0019827
802 Ga0500616_0037576
803 Ga0500636_0004884
804 Ga0501084_0006461
805 Ga0501084_0017302
806 Ga0501082_0000498
807 Ga0501082_0155830
808 Ga0530510_0022927
809 Ga0530510_0059229
810 2523104150
811 2644732657
812 2644734557
813 2722882167
814 2739248755
815 2837183952
816 2839142685
817 2841765872
818 2842735868
819 2842748414
820 2844107482
821 2851249522
822 2857578680
823 2929208025
824 8057531887

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

72

371

0.87

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

82

401

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
7c0t-assembly2.cif.gz_B crystal structure of a dinucleotide-binding protein (n81a) of abc transporter endogenously bound to uridylyl-3'-5'-phospho-guanosine 0.893 24 426
7c0s-assembly1.cif.gz_A crystal structure of a dinucleotide-binding protein (f79a) of abc transporter endogenously bound to uridylyl-3'-5'-phospho-guanosine (form ii) 0.8929 24 426
7c0x-assembly2.cif.gz_B crystal structure of a dinucleotide-binding protein (t240a) of abc transporter endogenously bound to uridylyl-3'-5'-phospho-guanosine 0.8916 24 426
7c15-assembly2.cif.gz_B crystal structure of a dinucleotide-binding protein (q274a) of abc transporter endogenously bound to uridylyl-3'-5'-phospho-guanosine (form ii) 0.8908 24 425
7c0u-assembly2.cif.gz_B crystal structure of a dinucleotide-binding protein (s127a) of abc transporter endogenously bound to uridylyl-3'-5'-phospho-guanosine 0.8899 24 426
ID Description Score Start End Superfamily
af_O53485_33_438_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8788 29 426 3.40.190.10
2ghaA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8758 27 147 3.40.190.10
5f7vA00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8731 29 426 3.40.190.10
3k02A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8629 27 383 3.40.190.10
5f7vA00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8605 29 426 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A4Q5QHE1-F1-model_v4 ABC transporter substrate-binding protein 0.9612 132 428 GO:0042597
AF-A0A7C2EUL3-F1-model_v4 ABC transporter substrate-binding protein 0.951 13 429
AF-A0A4S3LGP6-F1-model_v4 Extracellular solute-binding protein 0.9473 208 428 GO:0015768
GO:0030288
GO:0042956
GO:0055052
GO:1901982
AF-A0A1G3RVS3-F1-model_v4 ABC transporter substrate-binding protein 0.9468 8 429 GO:0030313
AF-A0A496QW86-F1-model_v4 ABC transporter substrate-binding protein 0.9441 26 428

Map