F437881

General Info

Members Datasets Scaffolds Average Seq Length
412 204 824 167

Family's Representative Sequence

Representative Sequence 3300046461|Ga0495641_0182500|Ga0495641_0182500_60_680
Length 206
Sequence VLAGRRLVGAHPRAEAHRPPVPAERPLCRSGSALADRLGVLTLQEAAARADAFAEAGDERAIADLRREWEDTVEADARSADYRERAVAYRAIGQFRFRQKIELLARGLDDESPACRGSALISLELLSRDAPGVINSNRSMLHRLATVDDNQAVRRLAIVCLKNGSATRDTIVLLEGLAEDDRQEKDLAETAAKVAATLKKKAGPKA

Samples

Sample ID Description Type Environment
1 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
85 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
86 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
87 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
88 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
89 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
90 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
91 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
92 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
93 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
94 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
95 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
96 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
97 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
98 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
99 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
100 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
101 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
102 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
103 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
104 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
105 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
106 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
107 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
108 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
109 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
110 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
111 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
112 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
120 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
121 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
122 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
123 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
126 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
127 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
128 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
129 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
130 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
131 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
132 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
133 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
134 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
135 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
136 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
139 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
140 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
141 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
144 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
145 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
146 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
147 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
148 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
149 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
150 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
151 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
152 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
153 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
154 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
155 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
160 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
161 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
181 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
182 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
183 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
184 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
185 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
186 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
187 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
196 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
199 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
200 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
201 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
202 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
203 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
204 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 13.59
Rhizosphere 85.68
Stem 0
Stem Tuber 0
Unclassified 4.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495641_0182500 3300046461 Bacteria 939
2 Ga0070658_10009178 3300005327 Bacteria 7950
3 Ga0070658_10049064 3300005327 Bacteria 3419
4 Ga0070683_100041259 3300005329 Bacteria 4244
5 Ga0070680_100023527 3300005336 Bacteria 4914
6 Ga0070680_100218938 3300005336 Bacteria 1607
7 Ga0070680_100737981 3300005336 Bacteria 848
8 Ga0070682_100041100 3300005337 Bacteria 2848
9 Ga0070660_100013847 3300005339 Bacteria 5801
10 Ga0070660_100018493 3300005339 Bacteria 5092
11 Ga0070687_100536466 3300005343 Bacteria 794
12 Ga0070661_100013282 3300005344 Bacteria 5780
13 Ga0070661_100132832 3300005344 Bacteria 1871
14 Ga0070674_100131275 3300005356 Bacteria 1868
15 Ga0070659_100012161 3300005366 Bacteria 6377
16 Ga0070709_10253204 3300005434 Bacteria 1269
17 Ga0070709_10878104 3300005434 Bacteria 708
18 Ga0070714_100108510 3300005435 Bacteria 2454
19 Ga0070714_100116365 3300005435 Bacteria 2373
20 Ga0070713_100053134 3300005436 Bacteria 3356
21 Ga0070713_101190395 3300005436 Bacteria 737
22 Ga0070710_10853743 3300005437 Unclassified 654
23 Ga0070711_100566787 3300005439 Bacteria 944
24 Ga0070711_101193352 3300005439 Bacteria 658
25 Ga0070681_10720494 3300005458 Unclassified 914
26 Ga0070706_100177164 3300005467 Bacteria 1991
27 Ga0070707_100478413 3300005468 Bacteria 1207
28 Ga0070707_100865601 3300005468 Bacteria 868
29 Ga0070698_100017810 3300005471 Bacteria 7482
30 Ga0070698_100050423 3300005471 Bacteria 4244
31 Ga0070698_100082911 3300005471 Bacteria 3197
32 Ga0070698_100114612 3300005471 Bacteria 2660
33 Ga0070699_100467637 3300005518 Bacteria 1144
34 Ga0070679_100200351 3300005530 Bacteria 1963
35 Ga0068853_100082060 3300005539 Bacteria 2823
36 Ga0070696_100002785 3300005546 Bacteria 11605
37 Ga0070665_100035429 3300005548 Bacteria 5018
38 Ga0068855_100062417 3300005563 Bacteria 4350
39 Ga0068857_100011021 3300005577 Bacteria 7870
40 Ga0068857_100155195 3300005577 Unclassified 2075
41 Ga0068856_100031343 3300005614 Bacteria 5201
42 Ga0081538_10022321 3300005981 Bacteria 4588
43 Ga0081539_10015964 3300005985 Bacteria 5409
44 Ga0081539_10209567 3300005985 Bacteria 894
45 Ga0070717_10038010 3300006028 Bacteria 3911
46 Ga0070717_10940821 3300006028 Bacteria 787
47 Ga0070716_100118364 3300006173 Bacteria 1654
48 Ga0070716_100190154 3300006173 Bacteria 1356
49 Ga0070712_100026117 3300006175 Bacteria 3887
50 Ga0070712_101236391 3300006175 Bacteria 650
51 Ga0070712_101328332 3300006175 Unclassified 627
52 Ga0075367_10448022 3300006178 Bacteria 818
53 Ga0075431_100219478 3300006847 Bacteria 1940
54 Ga0075431_101089259 3300006847 Bacteria 764
55 Ga0075433_10001966 3300006852 Bacteria 15447
56 Ga0075433_10118786 3300006852 Bacteria 2347
57 Ga0075433_10405827 3300006852 Bacteria 1202
58 Ga0075434_100005587 3300006871 Bacteria 11454
59 Ga0075434_100263038 3300006871 Bacteria 1744
60 Ga0075434_100322755 3300006871 Bacteria 1565
61 Ga0075436_100013891 3300006914 Bacteria 5515
62 Ga0075436_100779465 3300006914 Unclassified 711
63 Ga0075435_100021058 3300007076 Bacteria 5009
64 Ga0075435_100072457 3300007076 Bacteria 2814
65 Ga0105240_10014006 3300009093 Bacteria 10971
66 Ga0105240_10628301 3300009093 Bacteria 1179
67 Ga0111539_10018625 3300009094 Bacteria 8602
68 Ga0111539_10068282 3300009094 Bacteria 4197
69 Ga0114129_10001802 3300009147 Bacteria 29182
70 Ga0114129_10009886 3300009147 Bacteria 13601
71 Ga0114129_10108876 3300009147 Bacteria 3825
72 Ga0114129_11659880 3300009147 Unclassified 781
73 Ga0105243_11054455 3300009148 Bacteria 819
74 Ga0105241_10205731 3300009174 Bacteria 1647
75 Ga0105237_10087732 3300009545 Bacteria 3100
76 Ga0105238_10043559 3300009551 Bacteria 4541
77 Ga0157370_10027945 3300013104 Bacteria 5557
78 Ga0157370_10595000 3300013104 Bacteria 1013
79 Ga0157369_10082285 3300013105 Bacteria 3444
80 Ga0157374_10058427 3300013296 Bacteria 3604
81 Ga0163162_11121246 3300013306 Bacteria 892
82 Ga0157372_10138773 3300013307 Bacteria 2800
83 Ga0157375_10182696 3300013308 Bacteria 2249
84 Ga0157379_10378084 3300014968 Bacteria 1299
85 Ga0157376_10941049 3300014969 Bacteria 884
86 Ga0206353_10445112 3300020082 Bacteria 1836
87 Ga0207705_10039055 3300025909 Bacteria 3401
88 Ga0207705_10292162 3300025909 Bacteria 1249
89 Ga0207707_10041505 3300025912 Bacteria 4018
90 Ga0207707_10447915 3300025912 Bacteria 1105
91 Ga0207707_10512100 3300025912 Unclassified 1022
92 Ga0207695_10111539 3300025913 Bacteria 2714
93 Ga0207671_10271950 3300025914 Bacteria 1335
94 Ga0207693_10030640 3300025915 Bacteria 4250
95 Ga0207693_10120428 3300025915 Bacteria 2061
96 Ga0207693_10279525 3300025915 Bacteria 1308
97 Ga0207693_10897739 3300025915 Bacteria 680
98 Ga0207663_10346064 3300025916 Bacteria 1124
99 Ga0207663_10907623 3300025916 Bacteria 705
100 Ga0207660_10598916 3300025917 Bacteria 898
101 Ga0207657_10003747 3300025919 Bacteria 16158
102 Ga0207657_10009496 3300025919 Bacteria 9771
103 Ga0207649_10006151 3300025920 Bacteria 6516
104 Ga0207652_10499602 3300025921 Bacteria 1095
105 Ga0207646_10608769 3300025922 Bacteria 980
106 Ga0207646_10764094 3300025922 Unclassified 862
107 Ga0207694_10019505 3300025924 Bacteria 5126
108 Ga0207700_10000004 3300025928 Bacteria 443409
109 Ga0207700_10279399 3300025928 Bacteria 1436
110 Ga0207664_10057630 3300025929 Bacteria 3088
111 Ga0207690_10025455 3300025932 Bacteria 3716
112 Ga0207706_10161702 3300025933 Bacteria 1968
113 Ga0207669_10050493 3300025937 Bacteria 2487
114 Ga0207665_10113596 3300025939 Bacteria 1906
115 Ga0207691_10204640 3300025940 Bacteria 1717
116 Ga0207661_10476530 3300025944 Bacteria 1139
117 Ga0207667_10008780 3300025949 Bacteria 11969
118 Ga0207668_10811642 3300025972 Bacteria 829
119 Ga0207640_10773422 3300025981 Bacteria 830
120 Ga0207677_10368595 3300026023 Bacteria 1209
121 Ga0207702_10018689 3300026078 Bacteria 5733
122 Ga0207641_11314143 3300026088 Bacteria 724
123 Ga0207648_10505488 3300026089 Bacteria 1106
124 Ga0207676_11166655 3300026095 Unclassified 763
125 Ga0207674_10109428 3300026116 Bacteria 2739
126 Ga0207428_10035891 3300027907 Bacteria 4049
127 Ga0207428_10050395 3300027907 Bacteria 3331
128 Ga0265319_1003081 3300028563 Bacteria 8827
129 Ga0265334_10003824 3300028573 Bacteria 6805
130 Ga0265334_10031938 3300028573 Bacteria 2102
131 Ga0265334_10086194 3300028573 Bacteria 1152
132 Ga0265318_10002284 3300028577 Bacteria 10309
133 Ga0265318_10006540 3300028577 Bacteria 5353
134 Ga0265323_10021714 3300028653 Bacteria 2458
135 Ga0265322_10008456 3300028654 Bacteria 2997
136 Ga0265322_10010249 3300028654 Bacteria 2717
137 Ga0265336_10194291 3300028666 Bacteria 603
138 Ga0265338_10002622 3300028800 Bacteria 26550
139 Ga0265338_10008194 3300028800 Bacteria 12736
140 Ga0265338_10077378 3300028800 Bacteria 2812
141 Ga0265338_10107737 3300028800 Bacteria 2253
142 Ga0265330_10000883 3300031235 Bacteria 18661
143 Ga0265330_10014284 3300031235 Bacteria 3687
144 Ga0265332_10004977 3300031238 Bacteria 6178
145 Ga0265328_10008075 3300031239 Bacteria 4361
146 Ga0265320_10092089 3300031240 Bacteria 1403
147 Ga0265325_10003180 3300031241 Bacteria 10802
148 Ga0265329_10009740 3300031242 Bacteria 3562
149 Ga0265340_10003294 3300031247 Bacteria 9150
150 Ga0265340_10049056 3300031247 Bacteria 2051
151 Ga0265339_10020902 3300031249 Bacteria 3817
152 Ga0265339_10162588 3300031249 Bacteria 1122
153 Ga0265339_10210419 3300031249 Bacteria 955
154 Ga0265331_10092655 3300031250 Bacteria 1395
155 Ga0265331_10106866 3300031250 Bacteria 1285
156 Ga0265327_10003960 3300031251 Bacteria 13528
157 Ga0265327_10008077 3300031251 Bacteria 7926
158 Ga0265327_10047891 3300031251 Bacteria 2251
159 Ga0265327_10291665 3300031251 Bacteria 719
160 Ga0265316_10047257 3300031344 Bacteria 3405
161 Ga0265316_10078050 3300031344 Bacteria 2542
162 Ga0265313_10004970 3300031595 Bacteria 9946
163 Ga0265314_10008459 3300031711 Bacteria 8811
164 Ga0265314_10034513 3300031711 Bacteria 3697
165 Ga0265342_10007027 3300031712 Bacteria 8304
166 Ga0373934_0094940 3300035086 Bacteria 1204
167 Ga0373946_0373382 3300035171 Bacteria 716
168 Ga0373955_0117813 3300035172 Bacteria 1541
169 Ga0373924_0083553 3300035410 Bacteria 1360
170 Ga0373931_0536337 3300035691 Bacteria 759
171 Ga0373933_0530794 3300035724 Bacteria 772
172 Ga0373947_0016596 3300035725 Bacteria 4232
173 Ga0373937_0042407 3300036401 Bacteria 4151
174 Ga0395899_0017012 3300037312 Bacteria 5541
175 Ga0395899_0231587 3300037312 Bacteria 1275
176 Ga0395899_0300524 3300037312 Bacteria 1086
177 Ga0395899_0489667 3300037312 Bacteria 799
178 Ga0395900_0024975 3300037418 Bacteria 6115
179 Ga0395900_0029365 3300037418 Bacteria 5641
180 Ga0395900_0081412 3300037418 Bacteria 3326
181 Ga0395900_0154152 3300037418 Bacteria 2347
182 Ga0395900_0311446 3300037418 Bacteria 1557
183 Ga0395900_0546046 3300037418 Bacteria 1104
184 Ga0395900_0701197 3300037418 Bacteria 946
185 Ga0395900_0872550 3300037418 Unclassified 824
186 Ga0395898_0035072 3300037466 Bacteria 4992
187 Ga0395898_0070398 3300037466 Bacteria 3381
188 Ga0395898_0128139 3300037466 Bacteria 2431
189 Ga0395898_0247994 3300037466 Bacteria 1698
190 Ga0395898_0355178 3300037466 Bacteria 1398
191 Ga0395898_0598189 3300037466 Bacteria 1045
192 Ga0395898_0866832 3300037466 Bacteria 842
193 Ga0395905_0016315 3300037471 Bacteria 7058
194 Ga0395905_0021328 3300037471 Bacteria 6128
195 Ga0395905_0032050 3300037471 Bacteria 4943
196 Ga0395905_0053389 3300037471 Bacteria 3782
197 Ga0395905_0447135 3300037471 Bacteria 1190
198 Ga0395905_0476194 3300037471 Bacteria 1148
199 Ga0395905_0698796 3300037471 Bacteria 916
200 Ga0395905_0810528 3300037471 Bacteria 839
201 Ga0395901_0033523 3300038443 Bacteria 5301
202 Ga0395901_0052153 3300038443 Bacteria 4252
203 Ga0395901_0095211 3300038443 Bacteria 3120
204 Ga0395901_0112971 3300038443 Bacteria 2852
205 Ga0395901_0173914 3300038443 Bacteria 2259
206 Ga0395901_0182500 3300038443 Bacteria 2201
207 Ga0395901_0183060 3300038443 Bacteria 2197
208 Ga0395901_0271840 3300038443 Bacteria 1762
209 Ga0395901_0388505 3300038443 Bacteria 1435
210 Ga0395901_1072342 3300038443 Bacteria 777
211 Ga0451853_2148675 3300041512 Bacteria 969
212 Ga0451853_2667456 3300041512 Bacteria 4158
213 Ga0466966_0014352 3300044684 Bacteria 5244
214 Ga0466961_0119279 3300044693 Bacteria 1657
215 Ga0466963_0001952 3300044694 Bacteria 11311
216 Ga0466963_0172769 3300044694 Bacteria 1507
217 Ga0466963_0238440 3300044694 Bacteria 1275
218 Ga0466957_0174391 3300044842 Bacteria 1402
219 Ga0466967_0001251 3300045976 Bacteria 14371
220 Ga0466967_0034529 3300045976 Bacteria 4294
221 Ga0466967_0076491 3300045976 Bacteria 3011
222 Ga0466967_0085607 3300045976 Bacteria 2854
223 Ga0466967_0163834 3300045976 Bacteria 2089
224 Ga0466967_0308794 3300045976 Bacteria 1523
225 Ga0466967_0417050 3300045976 Bacteria 1308
226 Ga0466967_0911842 3300045976 Bacteria 874
227 Ga0495592_0098600 3300046454 Bacteria 2085
228 Ga0495592_0201525 3300046454 Bacteria 1343
229 Ga0495592_0221609 3300046454 Bacteria 1264
230 Ga0495603_0029504 3300046455 Bacteria 3307
231 Ga0495629_0041611 3300046459 Bacteria 3233
232 Ga0495629_0085827 3300046459 Bacteria 2196
233 Ga0495641_0023900 3300046461 Bacteria 3027
234 Ga0495651_0127172 3300046462 Bacteria 1865
235 Ga0495653_0005100 3300046463 Bacteria 10658
236 Ga0495653_0083466 3300046463 Bacteria 2356
237 Ga0495582_0101386 3300046473 Bacteria 1612
238 Ga0495664_0063697 3300046477 Bacteria 2198
239 Ga0495664_0244404 3300046477 Bacteria 1085
240 Ga0495664_0573557 3300046477 Bacteria 671
241 Ga0495584_0026873 3300046491 Bacteria 2917
242 Ga0495608_0017110 3300046511 Bacteria 5018
243 Ga0495608_0035308 3300046511 Bacteria 3373
244 Ga0495608_0133011 3300046511 Bacteria 1591
245 Ga0495608_0751891 3300046511 Bacteria 578
246 Ga0495616_0349454 3300046513 Bacteria 616
247 Ga0495618_0040525 3300046514 Bacteria 2932
248 Ga0495618_0111937 3300046514 Bacteria 1748
249 Ga0495618_0299487 3300046514 Bacteria 999
250 Ga0495618_0316748 3300046514 Bacteria 967
251 Ga0495628_0411591 3300046516 Bacteria 986
252 Ga0495628_0456494 3300046516 Bacteria 927
253 Ga0495628_0596575 3300046516 Bacteria 789
254 Ga0495630_0625634 3300046517 Bacteria 825
255 Ga0495630_0912501 3300046517 Bacteria 669
256 Ga0495642_0382624 3300046528 Bacteria 620
257 Ga0495652_0065382 3300046529 Bacteria 3056
258 Ga0495652_0315174 3300046529 Bacteria 1132
259 Ga0495652_0557094 3300046529 Bacteria 787
260 Ga0495652_0569082 3300046529 Unclassified 777
261 Ga0495640_0241516 3300046533 Bacteria 1134
262 Ga0495640_0409446 3300046533 Bacteria 832
263 Ga0495640_0694032 3300046533 Bacteria 611
264 Ga0495587_0083652 3300046536 Bacteria 1849
265 Ga0495587_0139372 3300046536 Bacteria 1385
266 Ga0495587_0417921 3300046536 Bacteria 744
267 Ga0495645_0515029 3300046543 Unclassified 746
268 Ga0495667_0023722 3300046559 Bacteria 4133
269 Ga0495667_0046721 3300046559 Bacteria 2862
270 Ga0495667_0319553 3300046559 Bacteria 982
271 Ga0495667_0378032 3300046559 Bacteria 893
272 Ga0495634_0033451 3300046642 Bacteria 3533
273 Ga0495634_0068475 3300046642 Bacteria 2345
274 Ga0495634_0101992 3300046642 Bacteria 1853
275 Ga0495634_0140424 3300046642 Bacteria 1534
276 Ga0495635_0039135 3300046663 Bacteria 3282
277 Ga0495635_0101152 3300046663 Bacteria 1970
278 Ga0495635_0663715 3300046663 Bacteria 678
279 Ga0495659_0014052 3300046664 Bacteria 2615
280 Ga0495657_0062449 3300046675 Bacteria 2461
281 Ga0495657_0085539 3300046675 Bacteria 2032
282 Ga0495657_0192703 3300046675 Bacteria 1245
283 Ga0495657_0201550 3300046675 Bacteria 1212
284 Ga0495599_0133717 3300046678 Bacteria 1540
285 Ga0495599_0225730 3300046678 Bacteria 1145
286 Ga0495647_0057833 3300046681 Bacteria 1523
287 Ga0495658_0162389 3300046683 Bacteria 1378
288 Ga0495613_0069394 3300046689 Bacteria 2569
289 Ga0495613_0108799 3300046689 Bacteria 1999
290 Ga0495613_0202393 3300046689 Bacteria 1399
291 Ga0495589_0065980 3300046794 Bacteria 1774
292 Ga0495600_0503905 3300046809 Bacteria 744
293 Ga0495581_0405310 3300047315 Bacteria 795
294 Ga0495604_0260669 3300047317 Bacteria 1178
295 Ga0495604_0303636 3300047317 Bacteria 1071
296 Ga0495604_0652252 3300047317 Bacteria 671
297 Ga0495674_0036564 3300047319 Bacteria 4419
298 Ga0495676_0212090 3300047321 Bacteria 1339
299 Ga0495680_0062032 3300047322 Bacteria 2875
300 Ga0495680_0102604 3300047322 Bacteria 2129
301 Ga0495680_0130093 3300047322 Bacteria 1851
302 Ga0495680_0272444 3300047322 Bacteria 1195
303 Ga0495675_0222780 3300047444 Bacteria 1141
304 Ga0495675_0314759 3300047444 Bacteria 927
305 Ga0495684_0013030 3300047471 Bacteria 6418
306 Ga0495684_0037856 3300047471 Bacteria 3700
307 Ga0495602_0108258 3300048088 Bacteria 2263
308 Ga0495602_0365333 3300048088 Bacteria 1038
309 Ga0495602_0589460 3300048088 Bacteria 766
310 Ga0496101_0094007 3300048904 Bacteria 2234
311 Ga0496101_0383755 3300048904 Bacteria 1105
312 Ga0496101_0424565 3300048904 Bacteria 1048
313 Ga0496101_0499043 3300048904 Bacteria 961
314 Ga0496101_1358841 3300048904 Unclassified 555
315 Ga0496102_0020627 3300048905 Bacteria 5824
316 Ga0496102_0385523 3300048905 Bacteria 1319
317 Ga0496103_0010910 3300048906 Bacteria 5378
318 Ga0496103_0749306 3300048906 Bacteria 617
319 Ga0496104_0003363 3300048907 Bacteria 13814
320 Ga0496104_0007092 3300048907 Bacteria 9879
321 Ga0496104_0494632 3300048907 Bacteria 1134
322 Ga0496104_0570518 3300048907 Bacteria 1042
323 Ga0496104_0764163 3300048907 Unclassified 873
324 Ga0496104_0811247 3300048907 Bacteria 842
325 Ga0496105_0000946 3300048908 Bacteria 19869
326 Ga0496105_0434571 3300048908 Unclassified 1038
327 Ga0496106_0632807 3300048909 Bacteria 856
328 Ga0496107_0176833 3300048910 Bacteria 1585
329 Ga0496108_0036398 3300048911 Bacteria 4095
330 Ga0496108_0299042 3300048911 Bacteria 1402
331 Ga0496108_0713784 3300048911 Bacteria 869
332 Ga0496109_0007476 3300048912 Bacteria 9256
333 Ga0496109_0028947 3300048912 Bacteria 4959
334 Ga0496109_0080336 3300048912 Bacteria 3004
335 Ga0496109_0399065 3300048912 Unclassified 1299
336 Ga0496109_0638337 3300048912 Bacteria 1002
337 Ga0496109_0703619 3300048912 Bacteria 948
338 Ga0496109_0760086 3300048912 Bacteria 907
339 Ga0496109_1092869 3300048912 Bacteria 735
340 Ga0496110_0007000 3300048913 Bacteria 8972
341 Ga0496110_0071045 3300048913 Bacteria 3085
342 Ga0496110_0352040 3300048913 Bacteria 1341
343 Ga0496110_0878013 3300048913 Bacteria 802
344 Ga0496110_0981513 3300048913 Unclassified 752
345 Ga0496111_0018710 3300048914 Bacteria 4802
346 Ga0496111_0031149 3300048914 Bacteria 3798
347 Ga0496111_0056923 3300048914 Bacteria 2830
348 Ga0496111_0416492 3300048914 Bacteria 992
349 Ga0496111_0573364 3300048914 Bacteria 827
350 Ga0496112_0047676 3300048915 Bacteria 4203
351 Ga0496112_0049654 3300048915 Bacteria 4112
352 Ga0496112_0178252 3300048915 Bacteria 2089
353 Ga0496112_0232333 3300048915 Bacteria 1799
354 Ga0496112_0238114 3300048915 Bacteria 1773
355 Ga0496112_0349832 3300048915 Bacteria 1420
356 Ga0496113_0111401 3300048916 Bacteria 2131
357 Ga0496113_0167798 3300048916 Bacteria 1738
358 Ga0496113_0194789 3300048916 Bacteria 1609
359 Ga0496114_0040331 3300048917 Bacteria 3865
360 Ga0496114_0094680 3300048917 Bacteria 2541
361 Ga0496114_0096642 3300048917 Bacteria 2515
362 Ga0496114_0167155 3300048917 Bacteria 1916
363 Ga0496114_0254124 3300048917 Bacteria 1547
364 Ga0496114_0900916 3300048917 Bacteria 766
365 Ga0496115_0145501 3300048918 Bacteria 1956
366 Ga0501034_0140614 3300049571 Bacteria 2394
367 Ga0501039_0880502 3300049575 Unclassified 697
368 Ga0501047_0464823 3300049581 Bacteria 1094
369 Ga0501067_0251036 3300049583 Bacteria 985
370 Ga0501069_0267440 3300049585 Bacteria 999
371 Ga0501070_0074008 3300049586 Bacteria 2819
372 Ga0501071_0927082 3300049587 Bacteria 672
373 Ga0501072_0001031 3300049588 Bacteria 20648
374 Ga0501072_0219887 3300049588 Bacteria 1514
375 Ga0501074_0079802 3300049590 Bacteria 2348
376 Ga0501074_0734033 3300049590 Bacteria 697
377 Ga0501075_0540959 3300049591 Bacteria 889
378 Ga0501075_0972071 3300049591 Bacteria 645
379 Ga0501079_0041474 3300049741 Bacteria 3553
380 Ga0501080_0013314 3300049742 Bacteria 7559
381 Ga0501083_0002484 3300049744 Bacteria 12650
382 Ga0501045_0448869 3300049824 Bacteria 959
383 nmdc:mga05p37_4378_c1 3300050507 Bacteria 16493
384 nmdc:mga05p37_64192_c1 3300050507 Bacteria 3088
385 nmdc:mga06r32_634853_c1 3300050510 Bacteria 1037
386 nmdc:mga08y16_255617_c1 3300050511 Bacteria 1810
387 nmdc:mga0n895_136939_c1 3300050512 Bacteria 2475
388 nmdc:mga0rr50_18763_c1 3300050513 Bacteria 4654
389 nmdc:mga0rr50_19987_c1 3300050513 Bacteria 4536
390 nmdc:mga08x19_50200_c1 3300050514 Bacteria 2677
391 nmdc:mga0a205_1109147_c1 3300050515 Bacteria 639
392 nmdc:mga0a205_203001_c1 3300050515 Bacteria 1872
393 nmdc:mga0a205_22018_c1 3300050515 Bacteria 6032
394 nmdc:mga0a205_222774_c1 3300050515 Bacteria 1771
395 nmdc:mga0a205_33734_c1 3300050515 Bacteria 4909
396 Ga0495601_0111703 3300053077 Bacteria 1770
397 Ga0495601_0176968 3300053077 Bacteria 1395
398 Ga0495601_0470090 3300053077 Bacteria 812
399 Ga0495612_0123778 3300053078 Bacteria 1114
400 Ga0495612_0199282 3300053078 Bacteria 883
401 Ga0495595_0071437 3300053084 Bacteria 1641
402 Ga0495595_0105648 3300053084 Bacteria 1362
403 Ga0495595_0286680 3300053084 Bacteria 827
404 Ga0495619_0009263 3300053085 Bacteria 6220
405 Ga0495619_0046592 3300053085 Bacteria 2851
406 Ga0495619_0108206 3300053085 Bacteria 1897
407 Ga0495619_0150176 3300053085 Bacteria 1607
408 Ga0495619_0643651 3300053085 Bacteria 723
409 Ga0501084_1184525 3300054114 Bacteria 641
410 Ga0501082_0079221 3300060353 Bacteria 2834
411 Ga0530510_0211538 3300061734 Bacteria 1441
412 Ga0530510_0312634 3300061734 Bacteria 1177
413 Ga0495641_0182500
414 Ga0070658_10009178
415 Ga0070658_10049064
416 Ga0070683_100041259
417 Ga0070680_100023527
418 Ga0070680_100218938
419 Ga0070680_100737981
420 Ga0070682_100041100
421 Ga0070660_100013847
422 Ga0070660_100018493
423 Ga0070687_100536466
424 Ga0070661_100013282
425 Ga0070661_100132832
426 Ga0070674_100131275
427 Ga0070659_100012161
428 Ga0070709_10253204
429 Ga0070709_10878104
430 Ga0070714_100108510
431 Ga0070714_100116365
432 Ga0070713_100053134
433 Ga0070713_101190395
434 Ga0070710_10853743
435 Ga0070711_100566787
436 Ga0070711_101193352
437 Ga0070681_10720494
438 Ga0070706_100177164
439 Ga0070707_100478413
440 Ga0070707_100865601
441 Ga0070698_100017810
442 Ga0070698_100050423
443 Ga0070698_100082911
444 Ga0070698_100114612
445 Ga0070699_100467637
446 Ga0070679_100200351
447 Ga0068853_100082060
448 Ga0070696_100002785
449 Ga0070665_100035429
450 Ga0068855_100062417
451 Ga0068857_100011021
452 Ga0068857_100155195
453 Ga0068856_100031343
454 Ga0081538_10022321
455 Ga0081539_10015964
456 Ga0081539_10209567
457 Ga0070717_10038010
458 Ga0070717_10940821
459 Ga0070716_100118364
460 Ga0070716_100190154
461 Ga0070712_100026117
462 Ga0070712_101236391
463 Ga0070712_101328332
464 Ga0075367_10448022
465 Ga0075431_100219478
466 Ga0075431_101089259
467 Ga0075433_10001966
468 Ga0075433_10118786
469 Ga0075433_10405827
470 Ga0075434_100005587
471 Ga0075434_100263038
472 Ga0075434_100322755
473 Ga0075436_100013891
474 Ga0075436_100779465
475 Ga0075435_100021058
476 Ga0075435_100072457
477 Ga0105240_10014006
478 Ga0105240_10628301
479 Ga0111539_10018625
480 Ga0111539_10068282
481 Ga0114129_10001802
482 Ga0114129_10009886
483 Ga0114129_10108876
484 Ga0114129_11659880
485 Ga0105243_11054455
486 Ga0105241_10205731
487 Ga0105237_10087732
488 Ga0105238_10043559
489 Ga0157370_10027945
490 Ga0157370_10595000
491 Ga0157369_10082285
492 Ga0157374_10058427
493 Ga0163162_11121246
494 Ga0157372_10138773
495 Ga0157375_10182696
496 Ga0157379_10378084
497 Ga0157376_10941049
498 Ga0206353_10445112
499 Ga0207705_10039055
500 Ga0207705_10292162
501 Ga0207707_10041505
502 Ga0207707_10447915
503 Ga0207707_10512100
504 Ga0207695_10111539
505 Ga0207671_10271950
506 Ga0207693_10030640
507 Ga0207693_10120428
508 Ga0207693_10279525
509 Ga0207693_10897739
510 Ga0207663_10346064
511 Ga0207663_10907623
512 Ga0207660_10598916
513 Ga0207657_10003747
514 Ga0207657_10009496
515 Ga0207649_10006151
516 Ga0207652_10499602
517 Ga0207646_10608769
518 Ga0207646_10764094
519 Ga0207694_10019505
520 Ga0207700_10000004
521 Ga0207700_10279399
522 Ga0207664_10057630
523 Ga0207690_10025455
524 Ga0207706_10161702
525 Ga0207669_10050493
526 Ga0207665_10113596
527 Ga0207691_10204640
528 Ga0207661_10476530
529 Ga0207667_10008780
530 Ga0207668_10811642
531 Ga0207640_10773422
532 Ga0207677_10368595
533 Ga0207702_10018689
534 Ga0207641_11314143
535 Ga0207648_10505488
536 Ga0207676_11166655
537 Ga0207674_10109428
538 Ga0207428_10035891
539 Ga0207428_10050395
540 Ga0265319_1003081
541 Ga0265334_10003824
542 Ga0265334_10031938
543 Ga0265334_10086194
544 Ga0265318_10002284
545 Ga0265318_10006540
546 Ga0265323_10021714
547 Ga0265322_10008456
548 Ga0265322_10010249
549 Ga0265336_10194291
550 Ga0265338_10002622
551 Ga0265338_10008194
552 Ga0265338_10077378
553 Ga0265338_10107737
554 Ga0265330_10000883
555 Ga0265330_10014284
556 Ga0265332_10004977
557 Ga0265328_10008075
558 Ga0265320_10092089
559 Ga0265325_10003180
560 Ga0265329_10009740
561 Ga0265340_10003294
562 Ga0265340_10049056
563 Ga0265339_10020902
564 Ga0265339_10162588
565 Ga0265339_10210419
566 Ga0265331_10092655
567 Ga0265331_10106866
568 Ga0265327_10003960
569 Ga0265327_10008077
570 Ga0265327_10047891
571 Ga0265327_10291665
572 Ga0265316_10047257
573 Ga0265316_10078050
574 Ga0265313_10004970
575 Ga0265314_10008459
576 Ga0265314_10034513
577 Ga0265342_10007027
578 Ga0373934_0094940
579 Ga0373946_0373382
580 Ga0373955_0117813
581 Ga0373924_0083553
582 Ga0373931_0536337
583 Ga0373933_0530794
584 Ga0373947_0016596
585 Ga0373937_0042407
586 Ga0395899_0017012
587 Ga0395899_0231587
588 Ga0395899_0300524
589 Ga0395899_0489667
590 Ga0395900_0024975
591 Ga0395900_0029365
592 Ga0395900_0081412
593 Ga0395900_0154152
594 Ga0395900_0311446
595 Ga0395900_0546046
596 Ga0395900_0701197
597 Ga0395900_0872550
598 Ga0395898_0035072
599 Ga0395898_0070398
600 Ga0395898_0128139
601 Ga0395898_0247994
602 Ga0395898_0355178
603 Ga0395898_0598189
604 Ga0395898_0866832
605 Ga0395905_0016315
606 Ga0395905_0021328
607 Ga0395905_0032050
608 Ga0395905_0053389
609 Ga0395905_0447135
610 Ga0395905_0476194
611 Ga0395905_0698796
612 Ga0395905_0810528
613 Ga0395901_0033523
614 Ga0395901_0052153
615 Ga0395901_0095211
616 Ga0395901_0112971
617 Ga0395901_0173914
618 Ga0395901_0182500
619 Ga0395901_0183060
620 Ga0395901_0271840
621 Ga0395901_0388505
622 Ga0395901_1072342
623 Ga0451853_2148675
624 Ga0451853_2667456
625 Ga0466966_0014352
626 Ga0466961_0119279
627 Ga0466963_0001952
628 Ga0466963_0172769
629 Ga0466963_0238440
630 Ga0466957_0174391
631 Ga0466967_0001251
632 Ga0466967_0034529
633 Ga0466967_0076491
634 Ga0466967_0085607
635 Ga0466967_0163834
636 Ga0466967_0308794
637 Ga0466967_0417050
638 Ga0466967_0911842
639 Ga0495592_0098600
640 Ga0495592_0201525
641 Ga0495592_0221609
642 Ga0495603_0029504
643 Ga0495629_0041611
644 Ga0495629_0085827
645 Ga0495641_0023900
646 Ga0495651_0127172
647 Ga0495653_0005100
648 Ga0495653_0083466
649 Ga0495582_0101386
650 Ga0495664_0063697
651 Ga0495664_0244404
652 Ga0495664_0573557
653 Ga0495584_0026873
654 Ga0495608_0017110
655 Ga0495608_0035308
656 Ga0495608_0133011
657 Ga0495608_0751891
658 Ga0495616_0349454
659 Ga0495618_0040525
660 Ga0495618_0111937
661 Ga0495618_0299487
662 Ga0495618_0316748
663 Ga0495628_0411591
664 Ga0495628_0456494
665 Ga0495628_0596575
666 Ga0495630_0625634
667 Ga0495630_0912501
668 Ga0495642_0382624
669 Ga0495652_0065382
670 Ga0495652_0315174
671 Ga0495652_0557094
672 Ga0495652_0569082
673 Ga0495640_0241516
674 Ga0495640_0409446
675 Ga0495640_0694032
676 Ga0495587_0083652
677 Ga0495587_0139372
678 Ga0495587_0417921
679 Ga0495645_0515029
680 Ga0495667_0023722
681 Ga0495667_0046721
682 Ga0495667_0319553
683 Ga0495667_0378032
684 Ga0495634_0033451
685 Ga0495634_0068475
686 Ga0495634_0101992
687 Ga0495634_0140424
688 Ga0495635_0039135
689 Ga0495635_0101152
690 Ga0495635_0663715
691 Ga0495659_0014052
692 Ga0495657_0062449
693 Ga0495657_0085539
694 Ga0495657_0192703
695 Ga0495657_0201550
696 Ga0495599_0133717
697 Ga0495599_0225730
698 Ga0495647_0057833
699 Ga0495658_0162389
700 Ga0495613_0069394
701 Ga0495613_0108799
702 Ga0495613_0202393
703 Ga0495589_0065980
704 Ga0495600_0503905
705 Ga0495581_0405310
706 Ga0495604_0260669
707 Ga0495604_0303636
708 Ga0495604_0652252
709 Ga0495674_0036564
710 Ga0495676_0212090
711 Ga0495680_0062032
712 Ga0495680_0102604
713 Ga0495680_0130093
714 Ga0495680_0272444
715 Ga0495675_0222780
716 Ga0495675_0314759
717 Ga0495684_0013030
718 Ga0495684_0037856
719 Ga0495602_0108258
720 Ga0495602_0365333
721 Ga0495602_0589460
722 Ga0496101_0094007
723 Ga0496101_0383755
724 Ga0496101_0424565
725 Ga0496101_0499043
726 Ga0496101_1358841
727 Ga0496102_0020627
728 Ga0496102_0385523
729 Ga0496103_0010910
730 Ga0496103_0749306
731 Ga0496104_0003363
732 Ga0496104_0007092
733 Ga0496104_0494632
734 Ga0496104_0570518
735 Ga0496104_0764163
736 Ga0496104_0811247
737 Ga0496105_0000946
738 Ga0496105_0434571
739 Ga0496106_0632807
740 Ga0496107_0176833
741 Ga0496108_0036398
742 Ga0496108_0299042
743 Ga0496108_0713784
744 Ga0496109_0007476
745 Ga0496109_0028947
746 Ga0496109_0080336
747 Ga0496109_0399065
748 Ga0496109_0638337
749 Ga0496109_0703619
750 Ga0496109_0760086
751 Ga0496109_1092869
752 Ga0496110_0007000
753 Ga0496110_0071045
754 Ga0496110_0352040
755 Ga0496110_0878013
756 Ga0496110_0981513
757 Ga0496111_0018710
758 Ga0496111_0031149
759 Ga0496111_0056923
760 Ga0496111_0416492
761 Ga0496111_0573364
762 Ga0496112_0047676
763 Ga0496112_0049654
764 Ga0496112_0178252
765 Ga0496112_0232333
766 Ga0496112_0238114
767 Ga0496112_0349832
768 Ga0496113_0111401
769 Ga0496113_0167798
770 Ga0496113_0194789
771 Ga0496114_0040331
772 Ga0496114_0094680
773 Ga0496114_0096642
774 Ga0496114_0167155
775 Ga0496114_0254124
776 Ga0496114_0900916
777 Ga0496115_0145501
778 Ga0501034_0140614
779 Ga0501039_0880502
780 Ga0501047_0464823
781 Ga0501067_0251036
782 Ga0501069_0267440
783 Ga0501070_0074008
784 Ga0501071_0927082
785 Ga0501072_0001031
786 Ga0501072_0219887
787 Ga0501074_0079802
788 Ga0501074_0734033
789 Ga0501075_0540959
790 Ga0501075_0972071
791 Ga0501079_0041474
792 Ga0501080_0013314
793 Ga0501083_0002484
794 Ga0501045_0448869
795 nmdc:mga05p37_4378_c1
796 nmdc:mga05p37_64192_c1
797 nmdc:mga06r32_634853_c1
798 nmdc:mga08y16_255617_c1
799 nmdc:mga0n895_136939_c1
800 nmdc:mga0rr50_18763_c1
801 nmdc:mga0rr50_19987_c1
802 nmdc:mga08x19_50200_c1
803 nmdc:mga0a205_1109147_c1
804 nmdc:mga0a205_203001_c1
805 nmdc:mga0a205_22018_c1
806 nmdc:mga0a205_222774_c1
807 nmdc:mga0a205_33734_c1
808 Ga0495601_0111703
809 Ga0495601_0176968
810 Ga0495601_0470090
811 Ga0495612_0123778
812 Ga0495612_0199282
813 Ga0495595_0071437
814 Ga0495595_0105648
815 Ga0495595_0286680
816 Ga0495619_0009263
817 Ga0495619_0046592
818 Ga0495619_0108206
819 Ga0495619_0150176
820 Ga0495619_0643651
821 Ga0501084_1184525
822 Ga0501082_0079221
823 Ga0530510_0211538
824 Ga0530510_0312634

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jw3-assembly2.cif.gz_D selection of specific protein binders for pre-defined targets from an optimized library of artificial helicoidal repeat proteins (alpharep) 0.8717 28 125
6hwp-assembly1.cif.gz_A structure of a3_bgfpd, an artificial bi-domain protein based on two different alpharep domains : a3 and a gfp binding domain (bgfpd) 0.8625 28 159
7q1e-assembly1.cif.gz_D cpap:tubulin:iih5 alpharep complex 0.8329 33 156
7zjs-assembly2.cif.gz_C structural basis of centromeric cohesion protection by sgo1 0.8307 25 154
3w3z-assembly1.cif.gz_A crystal structure of kap121p bound to rangtp 0.8268 25 154
ID Description Score Start End Superfamily
4jw3D00 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.8717 28 125 1.25.10.10
af_Q08951_18_624_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.8712 24 159 1.25.10.10
af_I1K5M5_4_544_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.8616 24 160 1.25.10.10
af_Q2FYK3_220_373_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.8537 28 160 1.25.10.10
af_K7LXL8_807_983_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.8447 28 154 1.25.10.10
ID Description Score Start End GO Terms
AF-A0A538GMT7-F1-model_v4 Uncharacterized protein 1.003 1 163
AF-A0A538H747-F1-model_v4 HEAT repeat domain-containing protein 1 2 161
AF-A0A538FVX6-F1-model_v4 HEAT repeat domain-containing protein 0.9941 1 160
AF-A0A538GMT7-F1-model_v4 Uncharacterized protein 0.9786 1 163
AF-A0A538FVX6-F1-model_v4 HEAT repeat domain-containing protein 0.9641 1 160

Map