F437870

General Info

Members Datasets Scaffolds Average Seq Length
412 253 404 389

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0029404|Ga0466972_0029404_521_1774
Length 417
Sequence MLSEKEYQERLDRIQALRERLAKRLSGSLVSNPALAEELNGQIDDLVQAATNADGTKPSPPDGGLAALVGIGPQAAQQFGETLTPHGVVPYDEQVNSERIVAVGDLYYLYQHEQIGVFKVVRKLKELFEAGAVRLSAGPGAYRLYQFDRRDVLRYTRKDRVDAYRRVLGYGRGLGSAQSRPNTDFHMLFGHFVNQVTLFWRDKRISDVIRERALDPSFGSIAVVRRSGLDLRNNLKFTSFGHLNVMRVELMQVLDEAFKILGSPDVIDLFGADNAWDVVDEVLIRYFDERLQSSPRQRMAVTGRDVLRWLAGPHILETGRGEFEALLMQIAEPAEEWLTSAQAMSLARRTGTDRVLPWEQLGQSGLATPVMERSPVTLPPIMQPRRRMPKPVYPKRNGRGTYRGGRAGRRVSAYPGP

Samples

Sample ID Description Type Environment
1 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
2 2671180195 Frankia sp. CcI49 Isolate Nodule
3 2773857922 Frankia sp. CcI49 Isolate Nodule
4 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
5 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
6 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
7 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300019177 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
81 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
82 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
107 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
110 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
111 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
112 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
113 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
114 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
115 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
119 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
120 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
121 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
122 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
123 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
124 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
125 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
126 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
127 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
128 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
129 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
130 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
131 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
132 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
135 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
136 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
137 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
138 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
139 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
140 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
141 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
142 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
143 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
146 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
147 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
148 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
149 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
150 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
151 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
152 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
153 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
156 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
157 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
166 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
167 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
168 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
169 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
170 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
171 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
172 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
173 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
174 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
175 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
176 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
177 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
185 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
186 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
187 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
188 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
189 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
190 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
191 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
192 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
193 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
194 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
195 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
196 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
197 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
198 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
199 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
200 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
201 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
202 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
203 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
204 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
205 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
206 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
207 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
208 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
209 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
210 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
211 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
212 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
213 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
214 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
215 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
216 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
217 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
218 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
219 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
220 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
221 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
222 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
232 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
233 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
234 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
235 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
236 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
237 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
238 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
239 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
240 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
241 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
242 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
243 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
244 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
245 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
246 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
247 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
248 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
249 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
253 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.12
Metatranscriptomes 1.94
Isolates 1.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.7
Nodule 0.49
Rhizoplane 2.91
Rhizosphere 90.78
Stem 0
Stem Tuber 0
Unclassified 4.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10006232 3300001991 Bacteria 2024
2 JGI25406J46586_10002133 3300003203 Bacteria 9350
3 JGI25406J46586_10003578 3300003203 Bacteria 7285
4 JGI25407J50210_10025275 3300003373 Bacteria 1540
5 Ga0065712_10072442 3300005290 Bacteria 4747
6 Ga0070658_10033364 3300005327 Bacteria 4142
7 Ga0070658_10047859 3300005327 Bacteria 3461
8 Ga0070676_10005506 3300005328 Bacteria 6745
9 Ga0070676_10006256 3300005328 Bacteria 6360
10 Ga0070666_10141289 3300005335 Bacteria 1677
11 Ga0070682_100153674 3300005337 Bacteria 1582
12 Ga0068868_100000068 3300005338 Bacteria 59767
13 Ga0068868_100065339 3300005338 Bacteria 2890
14 Ga0068868_100123257 3300005338 Bacteria 2115
15 Ga0070692_10026015 3300005345 Bacteria 2889
16 Ga0070692_10045127 3300005345 Bacteria 2272
17 Ga0070669_100000037 3300005353 Bacteria 136220
18 Ga0070671_100090608 3300005355 Unclassified 2560
19 Ga0070674_100099220 3300005356 Unclassified 2118
20 Ga0070709_10000835 3300005434 Bacteria 17236
21 Ga0070714_100002002 3300005435 Bacteria 14898
22 Ga0070714_100002549 3300005435 Bacteria 13418
23 Ga0070714_100068566 3300005435 Bacteria 3060
24 Ga0070713_100005318 3300005436 Bacteria 8781
25 Ga0070713_100011528 3300005436 Bacteria 6440
26 Ga0070713_100030848 3300005436 Bacteria 4264
27 Ga0070713_100248881 3300005436 Bacteria 1620
28 Ga0070713_100307475 3300005436 Bacteria 1461
29 Ga0070710_10065354 3300005437 Unclassified 2083
30 Ga0070711_100002003 3300005439 Bacteria 11471
31 Ga0070711_100023308 3300005439 Unclassified 4023
32 Ga0070711_100147112 3300005439 Bacteria 1773
33 Ga0070700_100069576 3300005441 Bacteria 2242
34 Ga0070694_100032941 3300005444 Bacteria 3405
35 Ga0070708_100023748 3300005445 Bacteria 5217
36 Ga0070663_100030558 3300005455 Unclassified 3693
37 Ga0070685_10013700 3300005466 Bacteria 4283
38 Ga0070685_10072455 3300005466 Unclassified 2045
39 Ga0070685_10131524 3300005466 Bacteria 1565
40 Ga0070706_100000870 3300005467 Bacteria 33204
41 Ga0070706_100005810 3300005467 Bacteria 11723
42 Ga0070706_100008261 3300005467 Bacteria 9707
43 Ga0070706_100147833 3300005467 Bacteria 2194
44 Ga0070706_100193606 3300005467 Bacteria 1900
45 Ga0070707_100001544 3300005468 Bacteria 22386
46 Ga0070707_100002288 3300005468 Bacteria 18303
47 Ga0070707_100012281 3300005468 Bacteria 7999
48 Ga0070707_100160426 3300005468 Bacteria 2191
49 Ga0070698_100001226 3300005471 Bacteria 28529
50 Ga0070698_100003106 3300005471 Bacteria 18303
51 Ga0070698_100009338 3300005471 Bacteria 10515
52 Ga0070698_100061195 3300005471 Bacteria 3799
53 Ga0070699_100016633 3300005518 Bacteria 6314
54 Ga0070686_100021940 3300005544 Bacteria 3800
55 Ga0070665_100000173 3300005548 Bacteria 114859
56 Ga0070665_100047194 3300005548 Unclassified 4324
57 Ga0070664_100207712 3300005564 Bacteria 1749
58 Ga0068857_100186557 3300005577 Unclassified 1888
59 Ga0068859_100034225 3300005617 Bacteria 5100
60 Ga0068859_100139322 3300005617 Bacteria 2499
61 Ga0068864_100025824 3300005618 Bacteria 4949
62 Ga0068864_100059594 3300005618 Unclassified 3303
63 Ga0068870_10067113 3300005840 Unclassified 1945
64 Ga0081455_10003237 3300005937 Bacteria 18863
65 Ga0081538_10001681 3300005981 Bacteria 22530
66 Ga0081538_10037086 3300005981 Bacteria 3170
67 Ga0081539_10000193 3300005985 Bacteria 141450
68 Ga0081539_10000198 3300005985 Bacteria 140511
69 Ga0081539_10029655 3300005985 Bacteria 3412
70 Ga0070717_10000108 3300006028 Bacteria 65497
71 Ga0070717_10000680 3300006028 Bacteria 21907
72 Ga0070717_10002843 3300006028 Bacteria 12270
73 Ga0070717_10021030 3300006028 Bacteria 5140
74 Ga0070717_10022266 3300006028 Bacteria 5005
75 Ga0070717_10118860 3300006028 Bacteria 2262
76 Ga0075365_10110968 3300006038 Bacteria 1885
77 Ga0075363_100005811 3300006048 Bacteria 5542
78 Ga0075364_10039035 3300006051 Bacteria 3076
79 Ga0070716_100023163 3300006173 Bacteria 3289
80 Ga0070716_100054623 3300006173 Unclassified 2282
81 Ga0070712_100000004 3300006175 Bacteria 215464
82 Ga0070712_100004869 3300006175 Bacteria 8303
83 Ga0070712_100015225 3300006175 Unclassified 4947
84 Ga0075367_10013282 3300006178 Bacteria 4422
85 Ga0075428_100014844 3300006844 Bacteria 8657
86 Ga0075428_100016713 3300006844 Bacteria 8101
87 Ga0075428_100017455 3300006844 Bacteria 7931
88 Ga0075428_100036780 3300006844 Bacteria 5390
89 Ga0075430_100003838 3300006846 Bacteria 12655
90 Ga0075430_100041642 3300006846 Unclassified 3885
91 Ga0075431_100006407 3300006847 Bacteria 11684
92 Ga0075431_100014291 3300006847 Bacteria 8028
93 Ga0075431_100262775 3300006847 Bacteria 1751
94 Ga0075433_10327850 3300006852 Bacteria 1354
95 Ga0075434_100002321 3300006871 Bacteria 16664
96 Ga0075434_100003607 3300006871 Bacteria 13817
97 Ga0075429_100001135 3300006880 Bacteria 21475
98 Ga0075429_100004370 3300006880 Bacteria 12133
99 Ga0075436_100000254 3300006914 Bacteria 33300
100 Ga0097620_100034225 3300006931 Bacteria 5100
101 Ga0097620_100139325 3300006931 Bacteria 2499
102 Ga0075435_100058189 3300007076 Unclassified 3130
103 Ga0075435_100273449 3300007076 Bacteria 1441
104 Ga0105240_10014009 3300009093 Bacteria 10969
105 Ga0111539_10005619 3300009094 Bacteria 16218
106 Ga0111539_10012184 3300009094 Bacteria 10788
107 Ga0111539_10050773 3300009094 Bacteria 4941
108 Ga0105245_10002129 3300009098 Bacteria 17922
109 Ga0105245_10031798 3300009098 Bacteria 4672
110 Ga0114129_10007661 3300009147 Bacteria 15365
111 Ga0114129_10011102 3300009147 Bacteria 12834
112 Ga0114129_10014968 3300009147 Bacteria 11052
113 Ga0114129_10024205 3300009147 Bacteria 8605
114 Ga0114129_10049791 3300009147 Bacteria 5887
115 Ga0105237_10113202 3300009545 Bacteria 2705
116 Ga0105238_10000115 3300009551 Bacteria 89300
117 Ga0105239_10049754 3300010375 Bacteria 4596
118 Ga0105246_10119049 3300011119 Unclassified 1953
119 Ga0157374_10000006 3300013296 Bacteria 640284
120 Ga0157374_10000396 3300013296 Bacteria 39487
121 Ga0157374_10002422 3300013296 Bacteria 15718
122 Ga0163162_10007550 3300013306 Bacteria 10590
123 Ga0157372_10150278 3300013307 Bacteria 2688
124 Ga0157375_10000106 3300013308 Bacteria 82080
125 Ga0157375_10005132 3300013308 Bacteria 11371
126 Ga0163163_10418910 3300014325 Unclassified 1398
127 Ga0157380_10001092 3300014326 Bacteria 17458
128 Ga0157377_10000003 3300014745 Bacteria 435133
129 Ga0157377_10034008 3300014745 Unclassified 2786
130 Ga0157379_10051989 3300014968 Bacteria 3658
131 Ga0157376_10127803 3300014969 Bacteria 2263
132 Ga0184592_105357 3300019177 Bacteria 5070
133 Ga0206352_10323729 3300020078 Bacteria 6702
134 Ga0213875_10000002 3300021388 Bacteria 921066
135 Ga0228598_1003029 3300024227 Bacteria 3642
136 Ga0207692_10001516 3300025898 Bacteria 8724
137 Ga0207692_10002479 3300025898 Bacteria 7086
138 Ga0207688_10004062 3300025901 Bacteria 7976
139 Ga0207699_10008081 3300025906 Bacteria 5172
140 Ga0207645_10009519 3300025907 Bacteria 6715
141 Ga0207643_10121543 3300025908 Unclassified 1547
142 Ga0207684_10001634 3300025910 Bacteria 23807
143 Ga0207684_10001756 3300025910 Bacteria 22923
144 Ga0207684_10025344 3300025910 Bacteria 5053
145 Ga0207684_10046765 3300025910 Bacteria 3672
146 Ga0207695_10022799 3300025913 Bacteria 7093
147 Ga0207693_10000105 3300025915 Bacteria 75790
148 Ga0207693_10001552 3300025915 Bacteria 20283
149 Ga0207693_10005124 3300025915 Bacteria 10977
150 Ga0207693_10024853 3300025915 Unclassified 4751
151 Ga0207693_10062613 3300025915 Bacteria 2914
152 Ga0207693_10167569 3300025915 Bacteria 1730
153 Ga0207663_10023735 3300025916 Bacteria 3524
154 Ga0207646_10000531 3300025922 Bacteria 50930
155 Ga0207646_10003313 3300025922 Bacteria 18317
156 Ga0207646_10071679 3300025922 Bacteria 3095
157 Ga0207681_10000015 3300025923 Bacteria 352892
158 Ga0207681_10144053 3300025923 Bacteria 1778
159 Ga0207694_10000001 3300025924 Bacteria 4078485
160 Ga0207687_10001822 3300025927 Bacteria 14671
161 Ga0207687_10009811 3300025927 Bacteria 6267
162 Ga0207700_10001271 3300025928 Bacteria 14390
163 Ga0207700_10009306 3300025928 Bacteria 6130
164 Ga0207700_10057974 3300025928 Bacteria 2923
165 Ga0207700_10130359 3300025928 Bacteria 2052
166 Ga0207700_10213306 3300025928 Bacteria 1633
167 Ga0207700_10252206 3300025928 Bacteria 1508
168 Ga0207664_10000852 3300025929 Bacteria 20647
169 Ga0207664_10002279 3300025929 Bacteria 12647
170 Ga0207664_10022385 3300025929 Bacteria 4718
171 Ga0207664_10119310 3300025929 Bacteria 2205
172 Ga0207669_10038585 3300025937 Unclassified 2752
173 Ga0207665_10005313 3300025939 Bacteria 8606
174 Ga0207679_10273893 3300025945 Unclassified 1445
175 Ga0207712_10046769 3300025961 Unclassified 3001
176 Ga0207677_10000180 3300026023 Bacteria 50319
177 Ga0207677_10115893 3300026023 Unclassified 2005
178 Ga0207703_10010524 3300026035 Bacteria 7232
179 Ga0207708_10068342 3300026075 Bacteria 2720
180 Ga0207702_10156626 3300026078 Bacteria 2077
181 Ga0207676_10092149 3300026095 Unclassified 2491
182 Ga0207428_10010869 3300027907 Bacteria 8108
183 Ga0207428_10023447 3300027907 Bacteria 5190
184 Ga0207428_10086404 3300027907 Bacteria 2441
185 Ga0265356_1004072 3300028017 Bacteria 1802
186 Ga0268266_10000774 3300028379 Bacteria 42708
187 Ga0268266_10168748 3300028379 Unclassified 1985
188 Ga0265326_10000036 3300028558 Bacteria 89310
189 Ga0265334_10000145 3300028573 Bacteria 44296
190 Ga0265318_10000083 3300028577 Bacteria 85655
191 Ga0265318_10065513 3300028577 Bacteria 1351
192 Ga0265338_10027781 3300028800 Bacteria 5665
193 Ga0265324_10002977 3300029957 Bacteria 8285
194 Ga0307511_10001719 3300030521 Bacteria 23050
195 Ga0265762_1008381 3300030760 Bacteria 1838
196 Ga0265767_100065 3300030836 Bacteria 3298
197 Ga0265760_10000173 3300031090 Bacteria 17023
198 Ga0265330_10000253 3300031235 Bacteria 39943
199 Ga0265332_10000266 3300031238 Bacteria 41582
200 Ga0265328_10008055 3300031239 Bacteria 4365
201 Ga0265320_10001581 3300031240 Bacteria 16353
202 Ga0265325_10074739 3300031241 Bacteria 1694
203 Ga0265329_10000038 3300031242 Bacteria 54238
204 Ga0265339_10006290 3300031249 Bacteria 7805
205 Ga0265339_10067001 3300031249 Bacteria 1921
206 Ga0265316_10000647 3300031344 Bacteria 38748
207 Ga0265316_10119652 3300031344 Unclassified 1989
208 Ga0307509_10000873 3300031507 Bacteria 51992
209 Ga0265313_10079097 3300031595 Bacteria 1497
210 Ga0307508_10057839 3300031616 Bacteria 3431
211 Ga0265314_10000725 3300031711 Bacteria 39871
212 Ga0265342_10000576 3300031712 Bacteria 38722
213 Ga0307518_10000753 3300031838 Bacteria 24372
214 Ga0307407_10034374 3300031903 Bacteria 2775
215 Ga0307409_100057953 3300031995 Bacteria 3005
216 Ga0307507_10026112 3300033179 Bacteria 6307
217 Ga0316214_1000540 3300033545 Bacteria 3932
218 Ga0373926_0000142 3300035083 Bacteria 15330
219 Ga0373928_0027744 3300035084 Unclassified 1234
220 Ga0373934_0000805 3300035086 Bacteria 11303
221 Ga0373940_0004750 3300035088 Unclassified 2894
222 Ga0373944_0000422 3300035089 Bacteria 9689
223 Ga0373944_0068999 3300035089 Bacteria 1148
224 Ga0373949_0000437 3300035090 Bacteria 14337
225 Ga0373951_0025385 3300035091 Unclassified 1376
226 Ga0373923_0000058 3300035111 Bacteria 17423
227 Ga0373923_0005610 3300035111 Bacteria 4272
228 Ga0373936_0000065 3300035113 Bacteria 50174
229 Ga0373936_0022208 3300035113 Bacteria 2471
230 Ga0373941_0001367 3300035115 Bacteria 5142
231 Ga0373945_0000072 3300035116 Bacteria 23111
232 Ga0373954_0009847 3300035118 Bacteria 4207
233 Ga0373956_0000856 3300035119 Bacteria 12665
234 Ga0373957_0000253 3300035120 Bacteria 13425
235 Ga0373957_0080656 3300035120 Bacteria 1284
236 Ga0373943_0001620 3300035170 Bacteria 10213
237 Ga0373943_0003419 3300035170 Bacteria 7232
238 Ga0373946_0000500 3300035171 Bacteria 12960
239 Ga0373946_0003271 3300035171 Bacteria 5752
240 Ga0373955_0000517 3300035172 Bacteria 16433
241 Ga0373924_0000090 3300035410 Bacteria 24971
242 Ga0373924_0000190 3300035410 Bacteria 18345
243 Ga0373935_0001655 3300035692 Bacteria 12453
244 Ga0373935_0002766 3300035692 Bacteria 10086
245 Ga0373927_0000586 3300035695 Bacteria 27726
246 Ga0373927_0001277 3300035695 Bacteria 19075
247 Ga0373927_0002139 3300035695 Bacteria 14532
248 Ga0373927_0107728 3300035695 Bacteria 1815
249 Ga0373933_0000887 3300035724 Bacteria 18307
250 Ga0373933_0201661 3300035724 Bacteria 1273
251 Ga0373947_0001634 3300035725 Bacteria 13755
252 Ga0373947_0002110 3300035725 Bacteria 12118
253 Ga0373947_0003718 3300035725 Bacteria 9015
254 Ga0373947_0069917 3300035725 Bacteria 2150
255 Ga0373937_0000610 3300036401 Bacteria 31566
256 Ga0373937_0128507 3300036401 Bacteria 2365
257 Ga0373925_0001542 3300037068 Bacteria 19627
258 Ga0373925_0020935 3300037068 Bacteria 4766
259 Ga0395900_0057100 3300037418 Bacteria 4018
260 Ga0395898_0061720 3300037466 Bacteria 3642
261 Ga0395905_0007112 3300037471 Bacteria 11183
262 Ga0436364_0226095 3300037853 Bacteria 12231
263 Ga0436364_0939060 3300037853 Unclassified 2578
264 Ga0436364_0940248 3300037853 Bacteria 592364
265 Ga0395901_0005450 3300038443 Bacteria 12881
266 Ga0395901_0186365 3300038443 Bacteria 2176
267 Ga0400489_57212 3300039093 Bacteria 18237
268 Ga0436365_0354335 3300039437 Bacteria 8521
269 Ga0436360_1107199 3300039438 Bacteria 2850
270 Ga0436361_0709478 3300039447 Bacteria 10396
271 Ga0436363_1441530 3300039450 Bacteria 3902
272 Ga0451577_0010685 3300042876 Bacteria 8740
273 Ga0466972_0029404 3300044658 Bacteria 2705
274 Ga0466966_0001298 3300044684 Bacteria 15994
275 Ga0466963_0000074 3300044694 Bacteria 35006
276 Ga0466971_0008385 3300044719 Bacteria 4509
277 Ga0466957_0003631 3300044842 Bacteria 8503
278 Ga0466960_0030928 3300044901 Bacteria 2467
279 Ga0466959_0003085 3300045049 Bacteria 10794
280 Ga0451576_0000673 3300045051 Bacteria 69699
281 Ga0451576_0090257 3300045051 Bacteria 3187
282 Ga0466958_0000241 3300045836 Bacteria 21059
283 Ga0466967_0079226 3300045976 Bacteria 2961
284 Ga0495592_0001188 3300046454 Bacteria 18073
285 Ga0495592_0026920 3300046454 Bacteria 4359
286 Ga0495603_0001440 3300046455 Bacteria 13836
287 Ga0495629_0000641 3300046459 Bacteria 28297
288 Ga0495641_0000184 3300046461 Bacteria 48241
289 Ga0495641_0048496 3300046461 Bacteria 1947
290 Ga0495651_0000215 3300046462 Bacteria 44284
291 Ga0495653_0002728 3300046463 Bacteria 14068
292 Ga0495580_0002179 3300046472 Bacteria 17139
293 Ga0495580_0043098 3300046472 Bacteria 3213
294 Ga0495582_0000343 3300046473 Bacteria 25586
295 Ga0495639_0000602 3300046475 Bacteria 16804
296 Ga0495662_0000054 3300046476 Bacteria 39454
297 Ga0495662_0018289 3300046476 Bacteria 3391
298 Ga0495664_0000350 3300046477 Bacteria 22437
299 Ga0495664_0000377 3300046477 Bacteria 21657
300 Ga0495664_0018171 3300046477 Unclassified 4024
301 Ga0495664_0083274 3300046477 Bacteria 1920
302 Ga0495594_0002835 3300046499 Bacteria 9011
303 Ga0495608_0000444 3300046511 Bacteria 28907
304 Ga0495608_0145999 3300046511 Bacteria 1509
305 Ga0495618_0000626 3300046514 Bacteria 25051
306 Ga0495618_0008125 3300046514 Bacteria 6355
307 Ga0495628_0006645 3300046516 Bacteria 10086
308 Ga0495628_0096812 3300046516 Bacteria 2280
309 Ga0495630_0000866 3300046517 Bacteria 21319
310 Ga0495630_0016753 3300046517 Bacteria 5362
311 Ga0495666_0005381 3300046526 Bacteria 6445
312 Ga0495652_0004180 3300046529 Bacteria 13902
313 Ga0495652_0010358 3300046529 Bacteria 8447
314 Ga0495665_0000427 3300046531 Bacteria 21447
315 Ga0495640_0001976 3300046533 Bacteria 16369
316 Ga0495640_0091663 3300046533 Bacteria 2005
317 Ga0495586_0004200 3300046535 Bacteria 7717
318 Ga0495586_0014122 3300046535 Bacteria 4243
319 Ga0495587_0001509 3300046536 Bacteria 15481
320 Ga0495645_0000167 3300046543 Bacteria 45640
321 Ga0495645_0040523 3300046543 Bacteria 3398
322 Ga0495667_0002461 3300046559 Bacteria 12364
323 Ga0495634_0002611 3300046642 Bacteria 14828
324 Ga0495634_0077762 3300046642 Bacteria 2175
325 Ga0495635_0001336 3300046663 Bacteria 16413
326 Ga0495635_0009984 3300046663 Bacteria 6635
327 Ga0495657_0000676 3300046675 Bacteria 30764
328 Ga0495657_0000739 3300046675 Bacteria 29139
329 Ga0495599_0002281 3300046678 Bacteria 11161
330 Ga0495646_0003267 3300046680 Bacteria 10086
331 Ga0495658_0000340 3300046683 Bacteria 26360
332 Ga0495613_0001108 3300046689 Bacteria 20568
333 Ga0495613_0002229 3300046689 Bacteria 14676
334 Ga0495613_0199043 3300046689 Bacteria 1413
335 Ga0495600_0000437 3300046809 Bacteria 21408
336 Ga0495581_0000281 3300047315 Bacteria 24731
337 Ga0495581_0003322 3300047315 Bacteria 9238
338 Ga0495604_0000286 3300047317 Bacteria 45196
339 Ga0495674_0003817 3300047319 Bacteria 14633
340 Ga0495674_0011761 3300047319 Bacteria 8254
341 Ga0495676_0000478 3300047321 Bacteria 32779
342 Ga0495676_0002723 3300047321 Bacteria 15853
343 Ga0495680_0007571 3300047322 Bacteria 9929
344 Ga0495675_0000628 3300047444 Bacteria 22465
345 Ga0495684_0014159 3300047471 Bacteria 6136
346 Ga0495684_0020191 3300047471 Bacteria 5132
347 Ga0495593_0001228 3300047673 Bacteria 14990
348 Ga0495593_0060817 3300047673 Bacteria 1977
349 Ga0495593_0060854 3300047673 Bacteria 1976
350 Ga0495602_0000473 3300048088 Bacteria 37174
351 Ga0495602_0034575 3300048088 Bacteria 4727
352 Ga0495614_0001039 3300048089 Bacteria 11866
353 Ga0495614_0036637 3300048089 Bacteria 2105
354 Ga0496102_0005087 3300048905 Bacteria 11139
355 Ga0496104_0046601 3300048907 Bacteria 4083
356 Ga0496108_0002137 3300048911 Bacteria 15836
357 Ga0496110_0010697 3300048913 Bacteria 7474
358 Ga0496110_0097846 3300048913 Bacteria 2629
359 Ga0496110_0137807 3300048913 Unclassified 2206
360 Ga0496112_0003034 3300048915 Bacteria 13729
361 Ga0496112_0026030 3300048915 Bacteria 5624
362 Ga0496112_0139649 3300048915 Bacteria 2392
363 Ga0496113_0001339 3300048916 Bacteria 13646
364 Ga0496114_0066805 3300048917 Bacteria 3016
365 Ga0496115_0072064 3300048918 Bacteria 2803
366 Ga0501067_0003191 3300049583 Bacteria 9046
367 nmdc:mga00v17_37690_c1 3300050491 Bacteria 2888
368 nmdc:mga06z11_1135_c1 3300050494 Bacteria 9705
369 nmdc:mga05p37_4434_c1 3300050507 Bacteria 16402
370 nmdc:mga05p37_44542_c1 3300050507 Bacteria 5458
371 nmdc:mga05p37_6304_c1 3300050507 Bacteria 13964
372 nmdc:mga05p37_77426_c1 3300050507 Bacteria 4094
373 nmdc:mga05p37_8046_c1 3300050507 Bacteria 12452
374 nmdc:mga09592_2266_c1 3300050508 Bacteria 15493
375 nmdc:mga09592_29026_c1 3300050508 Bacteria 4600
376 nmdc:mga09592_305047_c1 3300050508 Unclassified 1380
377 nmdc:mga0qj67_1041_c1 3300050509 Bacteria 19191
378 nmdc:mga06r32_61891_c1 3300050510 Bacteria 3604
379 nmdc:mga06r32_8521_c1 3300050510 Bacteria 9243
380 nmdc:mga08y16_2175_c1 3300050511 Bacteria 20096
381 nmdc:mga08y16_35528_c1 3300050511 Bacteria 5233
382 nmdc:mga0n895_122341_c1 3300050512 Bacteria 2624
383 nmdc:mga0n895_12856_c1 3300050512 Bacteria 7521
384 nmdc:mga0n895_1684_c1 3300050512 Bacteria 16687
385 nmdc:mga0rr50_13864_c1 3300050513 Bacteria 5266
386 nmdc:mga0rr50_211896_c1 3300050513 Bacteria 1596
387 nmdc:mga0rr50_39720_c1 3300050513 Bacteria 3415
388 nmdc:mga08x19_304_c1 3300050514 Bacteria 36093
389 nmdc:mga0a205_5073_c2 3300050515 Bacteria 7907
390 nmdc:mga0a205_6680_c1 3300050515 Bacteria 10437
391 nmdc:mga0a205_76590_c1 3300050515 Bacteria 3233
392 nmdc:mga0a205_89612_c1 3300050515 Unclassified 2973
393 Ga0495601_0002679 3300053077 Bacteria 10086
394 Ga0495612_0002841 3300053078 Bacteria 7164
395 Ga0495595_0002584 3300053084 Bacteria 7104
396 Ga0495619_0001006 3300053085 Bacteria 18435
397 Ga0495619_0099503 3300053085 Bacteria 1978
398 Ga0501084_0039574 3300054114 Bacteria 3943
399 Ga0500661_009452 3300055283 Bacteria 1784
400 Ga0587066_005278 3300059490 Unclassified 1646
401 Ga0587077_011394 3300059493 Bacteria 1397
402 Ga0587079_010786 3300059647 Unclassified 1457
403 Ga0501082_0004093 3300060353 Bacteria 12729
404 Ga0501082_0136024 3300060353 Bacteria 2132

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046689 Ga0495613_0199043 Ga0495613_0199043_17_1015 312
2 3300035084 Ga0373928_0027744 Ga0373928_0027744_15_1046 319
3 3300048917 Ga0496114_0066805 Ga0496114_0066805_11_1138 321
4 3300035089 Ga0373944_0068999 Ga0373944_0068999_55_1131 335
5 3300035410 Ga0373924_0000090 Ga0373924_0000090_18522_19598 335
6 3300050512 nmdc:mga0n895_12856_c1 nmdc:mga0n895_12856_c1_6402_7499 340
7 3300054114 Ga0501084_0039574 Ga0501084_0039574_2258_3367 344
8 3300060353 Ga0501082_0136024 Ga0501082_0136024_998_2107 344
9 3300035083 Ga0373926_0000142 Ga0373926_0000142_4738_5973 348
10 3300035086 Ga0373934_0000805 Ga0373934_0000805_2787_4022 348
11 3300035089 Ga0373944_0000422 Ga0373944_0000422_4993_6228 348
12 3300035111 Ga0373923_0000058 Ga0373923_0000058_11252_12487 348
13 3300035113 Ga0373936_0000065 Ga0373936_0000065_31598_32833 348
14 3300035116 Ga0373945_0000072 Ga0373945_0000072_11279_12514 348
15 3300035118 Ga0373954_0009847 Ga0373954_0009847_407_1642 348
16 3300035119 Ga0373956_0000856 Ga0373956_0000856_9416_10651 348
17 3300035120 Ga0373957_0000253 Ga0373957_0000253_8106_9341 348
18 3300035170 Ga0373943_0001620 Ga0373943_0001620_274_1509 348
19 3300035171 Ga0373946_0000500 Ga0373946_0000500_4129_5364 348
20 3300035172 Ga0373955_0000517 Ga0373955_0000517_10970_12205 348
21 3300035410 Ga0373924_0000190 Ga0373924_0000190_13706_14941 348
22 3300035692 Ga0373935_0002766 Ga0373935_0002766_275_1510 348
23 3300035695 Ga0373927_0001277 Ga0373927_0001277_9156_10391 348
24 3300035724 Ga0373933_0000887 Ga0373933_0000887_11205_12440 348
25 3300035725 Ga0373947_0001634 Ga0373947_0001634_8392_9627 348
26 3300036401 Ga0373937_0000610 Ga0373937_0000610_24702_25937 348
27 3300037068 Ga0373925_0001542 Ga0373925_0001542_11508_12743 348
28 3300046454 Ga0495592_0001188 Ga0495592_0001188_8262_9497 348
29 3300046455 Ga0495603_0001440 Ga0495603_0001440_8873_10108 348
30 3300046459 Ga0495629_0000641 Ga0495629_0000641_18288_19523 348
31 3300046461 Ga0495641_0000184 Ga0495641_0000184_35952_37187 348
32 3300046462 Ga0495651_0000215 Ga0495651_0000215_32372_33607 348
33 3300046463 Ga0495653_0002728 Ga0495653_0002728_8577_9812 348
34 3300046472 Ga0495580_0002179 Ga0495580_0002179_10919_12154 348
35 3300046473 Ga0495582_0000343 Ga0495582_0000343_15648_16883 348
36 3300046475 Ga0495639_0000602 Ga0495639_0000602_12463_13698 348
37 3300046476 Ga0495662_0000054 Ga0495662_0000054_6878_8113 348
38 3300046477 Ga0495664_0000350 Ga0495664_0000350_12444_13679 348
39 3300046499 Ga0495594_0002835 Ga0495594_0002835_7440_8675 348
40 3300046511 Ga0495608_0000444 Ga0495608_0000444_21882_23117 348
41 3300046514 Ga0495618_0000626 Ga0495618_0000626_8296_9531 348
42 3300046516 Ga0495628_0006645 Ga0495628_0006645_275_1510 348
43 3300046517 Ga0495630_0000866 Ga0495630_0000866_11508_12743 348
44 3300046526 Ga0495666_0005381 Ga0495666_0005381_5090_6325 348
45 3300046529 Ga0495652_0004180 Ga0495652_0004180_5790_7025 348
46 3300046531 Ga0495665_0000427 Ga0495665_0000427_11508_12743 348
47 3300046533 Ga0495640_0001976 Ga0495640_0001976_8262_9497 348
48 3300046535 Ga0495586_0004200 Ga0495586_0004200_2537_3772 348
49 3300046536 Ga0495587_0001509 Ga0495587_0001509_5983_7218 348
50 3300046543 Ga0495645_0000167 Ga0495645_0000167_16477_17712 348
51 3300046559 Ga0495667_0002461 Ga0495667_0002461_6873_8108 348
52 3300046642 Ga0495634_0002611 Ga0495634_0002611_5869_7104 348
53 3300046663 Ga0495635_0001336 Ga0495635_0001336_8392_9627 348
54 3300046675 Ga0495657_0000676 Ga0495657_0000676_7807_9042 348
55 3300046678 Ga0495599_0002281 Ga0495599_0002281_5798_7033 348
56 3300046680 Ga0495646_0003267 Ga0495646_0003267_147_1382 348
57 3300046683 Ga0495658_0000340 Ga0495658_0000340_12913_14148 348
58 3300046689 Ga0495613_0002229 Ga0495613_0002229_8264_9499 348
59 3300046809 Ga0495600_0000437 Ga0495600_0000437_8705_9940 348
60 3300047315 Ga0495581_0000281 Ga0495581_0000281_18272_19507 348
61 3300047317 Ga0495604_0000286 Ga0495604_0000286_31802_33037 348
62 3300047319 Ga0495674_0011761 Ga0495674_0011761_147_1382 348
63 3300047321 Ga0495676_0000478 Ga0495676_0000478_17893_19128 348
64 3300047322 Ga0495680_0007571 Ga0495680_0007571_5997_7232 348
65 3300047444 Ga0495675_0000628 Ga0495675_0000628_7324_8559 348
66 3300047471 Ga0495684_0014159 Ga0495684_0014159_309_1544 348
67 3300047673 Ga0495593_0001228 Ga0495593_0001228_13347_14582 348
68 3300048088 Ga0495602_0000473 Ga0495602_0000473_31683_32918 348
69 3300048089 Ga0495614_0001039 Ga0495614_0001039_2525_3760 348
70 3300053077 Ga0495601_0002679 Ga0495601_0002679_275_1510 348
71 3300053078 Ga0495612_0002841 Ga0495612_0002841_309_1544 348
72 3300053084 Ga0495595_0002584 Ga0495595_0002584_3043_4278 348
73 3300053085 Ga0495619_0001006 Ga0495619_0001006_4500_5735 348
74 3300005338 Ga0068868_100065339 Ga0068868_1000653392 349
75 3300026023 Ga0207677_10115893 Ga0207677_101158932 349
76 3300031903 Ga0307407_10034374 Ga0307407_100343742 349
77 3300031995 Ga0307409_100057953 Ga0307409_1000579532 349
78 3300006048 Ga0075363_100005811 Ga0075363_1000058114 352
79 3300006051 Ga0075364_10039035 Ga0075364_100390352 352
80 3300006844 Ga0075428_100014844 Ga0075428_1000148445 352
81 3300006847 Ga0075431_100014291 Ga0075431_1000142916 352
82 3300006880 Ga0075429_100001135 Ga0075429_1000011352 352
83 3300009147 Ga0114129_10007661 Ga0114129_1000766112 352
84 3300013308 Ga0157375_10000106 Ga0157375_1000010626 352
85 3300050491 nmdc:mga00v17_37690_c1 nmdc:mga00v17_37690_c1_852_2117 352
86 3300050507 nmdc:mga05p37_6304_c1 nmdc:mga05p37_6304_c1_11085_12338 352
87 3300050508 nmdc:mga09592_29026_c1 nmdc:mga09592_29026_c1_2206_3459 352
88 3300050510 nmdc:mga06r32_61891_c1 nmdc:mga06r32_61891_c1_2224_3477 352
89 3300005435 Ga0070714_100002549 Ga0070714_1000025499 355
90 3300005436 Ga0070713_100030848 Ga0070713_1000308482 355
91 3300006028 Ga0070717_10002843 Ga0070717_100028439 355
92 3300025928 Ga0207700_10057974 Ga0207700_100579742 355
93 3300025929 Ga0207664_10002279 Ga0207664_100022795 355
94 3300046461 Ga0495641_0048496 Ga0495641_0048496_455_1693 355
95 3300048913 Ga0496110_0010697 Ga0496110_0010697_1513_2676 355
96 3300006844 Ga0075428_100017455 Ga0075428_1000174554 356
97 3300006847 Ga0075431_100262775 Ga0075431_1002627752 356
98 3300009094 Ga0111539_10050773 Ga0111539_100507734 356
99 3300050511 nmdc:mga08y16_35528_c1 nmdc:mga08y16_35528_c1_634_1806 356
100 3300050515 nmdc:mga0a205_5073_c2 nmdc:mga0a205_5073_c2_5491_6714 356
101 iso_pu_bacteria 2848694841 2848700535 356
102 3300006844 Ga0075428_100016713 Ga0075428_1000167135 358
103 3300006846 Ga0075430_100041642 Ga0075430_1000416422 358
104 3300009094 Ga0111539_10005619 Ga0111539_100056196 358
105 3300009147 Ga0114129_10049791 Ga0114129_100497913 358
106 3300027907 Ga0207428_10010869 Ga0207428_100108699 358
107 3300049583 Ga0501067_0003191 Ga0501067_0003191_7828_8982 358
108 3300050508 nmdc:mga09592_305047_c1 nmdc:mga09592_305047_c1_58_1239 358
109 3300050511 nmdc:mga08y16_2175_c1 nmdc:mga08y16_2175_c1_15544_16725 358
110 3300060353 Ga0501082_0004093 Ga0501082_0004093_55_1209 358
111 3300005337 Ga0070682_100153674 Ga0070682_1001536741 359
112 3300005355 Ga0070671_100090608 Ga0070671_1000906082 359
113 3300005356 Ga0070674_100099220 Ga0070674_1000992202 359
114 3300005455 Ga0070663_100030558 Ga0070663_1000305582 359
115 3300005466 Ga0070685_10072455 Ga0070685_100724552 359
116 3300005548 Ga0070665_100047194 Ga0070665_1000471944 359
117 3300005617 Ga0068859_100034225 Ga0068859_1000342252 359
118 3300005618 Ga0068864_100059594 Ga0068864_1000595942 359
119 3300006846 Ga0075430_100003838 Ga0075430_1000038382 359
120 3300006847 Ga0075431_100006407 Ga0075431_1000064079 359
121 3300006880 Ga0075429_100004370 Ga0075429_1000043705 359
122 3300006931 Ga0097620_100034225 Ga0097620_1000342252 359
123 3300009098 Ga0105245_10002129 Ga0105245_100021299 359
124 3300011119 Ga0105246_10119049 Ga0105246_101190492 359
125 3300013296 Ga0157374_10002422 Ga0157374_100024224 359
126 3300013306 Ga0163162_10007550 Ga0163162_100075508 359
127 3300013308 Ga0157375_10005132 Ga0157375_100051325 359
128 3300014745 Ga0157377_10034008 Ga0157377_100340082 359
129 3300014968 Ga0157379_10051989 Ga0157379_100519892 359
130 3300025901 Ga0207688_10004062 Ga0207688_100040622 359
131 3300025927 Ga0207687_10001822 Ga0207687_100018224 359
132 3300025937 Ga0207669_10038585 Ga0207669_100385852 359
133 3300025961 Ga0207712_10046769 Ga0207712_100467692 359
134 3300026035 Ga0207703_10010524 Ga0207703_100105244 359
135 3300026095 Ga0207676_10092149 Ga0207676_100921492 359
136 3300028379 Ga0268266_10168748 Ga0268266_101687482 359
137 3300039093 Ga0400489_57212 Ga0400489_57212_1062_2192 359
138 3300048905 Ga0496102_0005087 Ga0496102_0005087_1850_3007 359
139 3300048911 Ga0496108_0002137 Ga0496108_0002137_674_1831 359
140 3300048913 Ga0496110_0137807 Ga0496110_0137807_569_1726 359
141 3300048915 Ga0496112_0026030 Ga0496112_0026030_1456_2613 359
142 3300050507 nmdc:mga05p37_8046_c1 nmdc:mga05p37_8046_c1_5179_6336 359
143 3300050508 nmdc:mga09592_2266_c1 nmdc:mga09592_2266_c1_4339_5496 359
144 3300050509 nmdc:mga0qj67_1041_c1 nmdc:mga0qj67_1041_c1_3857_5014 359
145 3300050510 nmdc:mga06r32_8521_c1 nmdc:mga06r32_8521_c1_1264_2421 359
146 iso_pu_bacteria 2997451912 2997456946 359
147 iso_pu_bacteria 8056207758 8056208849 359
148 3300005290 Ga0065712_10072442 Ga0065712_100724422 360
149 3300005328 Ga0070676_10006256 Ga0070676_100062564 360
150 3300005445 Ga0070708_100023748 Ga0070708_1000237483 360
151 3300005467 Ga0070706_100000870 Ga0070706_1000008709 360
152 3300005467 Ga0070706_100008261 Ga0070706_1000082614 360
153 3300005468 Ga0070707_100001544 Ga0070707_10000154418 360
154 3300005471 Ga0070698_100001226 Ga0070698_10000122617 360
155 3300005518 Ga0070699_100016633 Ga0070699_1000166334 360
156 3300006028 Ga0070717_10000680 Ga0070717_1000068018 360
157 3300010375 Ga0105239_10049754 Ga0105239_100497543 360
158 3300025910 Ga0207684_10001634 Ga0207684_1000163414 360
159 3300025910 Ga0207684_10025344 Ga0207684_100253444 360
160 3300025922 Ga0207646_10000531 Ga0207646_100005318 360
161 3300042876 Ga0451577_0010685 Ga0451577_0010685_209_1387 360
162 3300045051 Ga0451576_0000673 Ga0451576_0000673_20718_21896 360
163 3300059490 Ga0587066_005278 Ga0587066_005278_188_1342 360
164 3300059493 Ga0587077_011394 Ga0587077_011394_29_1183 360
165 iso_pu_bacteria 2902810491 2902810715 360
166 3300005338 Ga0068868_100123257 Ga0068868_1001232571 361
167 3300006175 Ga0070712_100000004 Ga0070712_10000000410 361
168 3300007076 Ga0075435_100273449 Ga0075435_1002734491 361
169 3300009098 Ga0105245_10031798 Ga0105245_100317983 361
170 3300009545 Ga0105237_10113202 Ga0105237_101132022 361
171 3300013296 Ga0157374_10000396 Ga0157374_1000039616 361
172 3300014969 Ga0157376_10127803 Ga0157376_101278032 361
173 3300025915 Ga0207693_10000105 Ga0207693_1000010561 361
174 3300025927 Ga0207687_10009811 Ga0207687_100098113 361
175 3300028558 Ga0265326_10000036 Ga0265326_1000003667 361
176 3300028573 Ga0265334_10000145 Ga0265334_100001454 361
177 3300028577 Ga0265318_10065513 Ga0265318_100655132 361
178 3300028800 Ga0265338_10027781 Ga0265338_100277811 361
179 3300029957 Ga0265324_10002977 Ga0265324_100029778 361
180 3300050513 nmdc:mga0rr50_211896_c1 nmdc:mga0rr50_211896_c1_229_1395 361
181 3300005466 Ga0070685_10131524 Ga0070685_101315241 362
182 3300005548 Ga0070665_100000173 Ga0070665_10000017393 362
183 3300006852 Ga0075433_10327850 Ga0075433_103278501 362
184 3300009147 Ga0114129_10024205 Ga0114129_100242052 362
185 3300014326 Ga0157380_10001092 Ga0157380_100010924 362
186 3300025923 Ga0207681_10144053 Ga0207681_101440532 362
187 3300027907 Ga0207428_10086404 Ga0207428_100864042 362
188 3300037418 Ga0395900_0057100 Ga0395900_0057100_530_1684 362
189 3300037466 Ga0395898_0061720 Ga0395898_0061720_2360_3514 362
190 3300037471 Ga0395905_0007112 Ga0395905_0007112_3855_5009 362
191 3300038443 Ga0395901_0005450 Ga0395901_0005450_2746_3900 362
192 3300046516 Ga0495628_0096812 Ga0495628_0096812_431_1660 362
193 3300050507 nmdc:mga05p37_77426_c1 nmdc:mga05p37_77426_c1_2498_3652 362
194 3300050515 nmdc:mga0a205_6680_c1 nmdc:mga0a205_6680_c1_59_1213 362
195 3300003203 JGI25406J46586_10002133 JGI25406J46586_100021334 363
196 3300003373 JGI25407J50210_10025275 JGI25407J50210_100252752 363
197 3300005335 Ga0070666_10141289 Ga0070666_101412892 363
198 3300005439 Ga0070711_100147112 Ga0070711_1001471122 363
199 3300005466 Ga0070685_10013700 Ga0070685_100137004 363
200 3300005564 Ga0070664_100207712 Ga0070664_1002077122 363
201 3300005981 Ga0081538_10001681 Ga0081538_100016813 363
202 3300005985 Ga0081539_10000198 Ga0081539_1000019815 363
203 3300009147 Ga0114129_10014968 Ga0114129_100149686 363
204 3300025922 Ga0207646_10071679 Ga0207646_100716792 363
205 3300028379 Ga0268266_10000774 Ga0268266_1000077420 363
206 3300030521 Ga0307511_10001719 Ga0307511_1000171916 363
207 3300050507 nmdc:mga05p37_4434_c1 nmdc:mga05p37_4434_c1_15039_16202 363
208 iso_pu_bacteria 2671180195 2671837045 363
209 iso_pu_bacteria 2773857922 2774855201 363
210 3300005471 Ga0070698_100061195 Ga0070698_1000611952 364
211 3300005617 Ga0068859_100139322 Ga0068859_1001393222 364
212 3300006931 Ga0097620_100139325 Ga0097620_1001393252 364
213 3300014325 Ga0163163_10418910 Ga0163163_104189101 364
214 3300035088 Ga0373940_0004750 Ga0373940_0004750_230_1396 364
215 3300035091 Ga0373951_0025385 Ga0373951_0025385_134_1300 364
216 3300035115 Ga0373941_0001367 Ga0373941_0001367_2689_3855 364
217 3300044658 Ga0466972_0029404 Ga0466972_0029404_521_1774 364
218 3300044901 Ga0466960_0030928 Ga0466960_0030928_875_2128 364
219 3300046477 Ga0495664_0083274 Ga0495664_0083274_524_1750 364
220 3300046543 Ga0495645_0040523 Ga0495645_0040523_863_2089 364
221 3300003203 JGI25406J46586_10003578 JGI25406J46586_100035784 365
222 3300005345 Ga0070692_10045127 Ga0070692_100451272 365
223 3300005444 Ga0070694_100032941 Ga0070694_1000329412 365
224 3300005577 Ga0068857_100186557 Ga0068857_1001865572 365
225 3300005618 Ga0068864_100025824 Ga0068864_1000258242 365
226 3300005840 Ga0068870_10067113 Ga0068870_100671132 365
227 3300005985 Ga0081539_10000193 Ga0081539_1000019331 365
228 3300005985 Ga0081539_10029655 Ga0081539_100296553 365
229 3300006038 Ga0075365_10110968 Ga0075365_101109682 365
230 3300006844 Ga0075428_100036780 Ga0075428_1000367802 365
231 3300009093 Ga0105240_10014009 Ga0105240_100140095 365
232 3300009147 Ga0114129_10011102 Ga0114129_100111029 365
233 3300025908 Ga0207643_10121543 Ga0207643_101215432 365
234 3300025913 Ga0207695_10022799 Ga0207695_100227994 365
235 3300025945 Ga0207679_10273893 Ga0207679_102738932 365
236 3300053085 Ga0495619_0099503 Ga0495619_0099503_508_1761 365
237 iso_pu_bacteria 2585427649 2586059287 365
238 iso_pu_bacteria 2808606522 2809591951 365
239 3300005937 Ga0081455_10003237 Ga0081455_1000323710 366
240 3300020078 Ga0206352_10323729 Ga0206352_103237293 366
241 3300028577 Ga0265318_10000083 Ga0265318_1000008332 366
242 3300031235 Ga0265330_10000253 Ga0265330_100002535 366
243 3300031238 Ga0265332_10000266 Ga0265332_100002666 366
244 3300031239 Ga0265328_10008055 Ga0265328_100080554 366
245 3300031240 Ga0265320_10001581 Ga0265320_1000158110 366
246 3300031241 Ga0265325_10074739 Ga0265325_100747392 366
247 3300031242 Ga0265329_10000038 Ga0265329_1000003841 366
248 3300031249 Ga0265339_10067001 Ga0265339_100670012 366
249 3300031344 Ga0265316_10000647 Ga0265316_1000064728 366
250 3300031595 Ga0265313_10079097 Ga0265313_100790972 366
251 3300031711 Ga0265314_10000725 Ga0265314_1000072527 366
252 3300031712 Ga0265342_10000576 Ga0265342_1000057628 366
253 3300035695 Ga0373927_0000586 Ga0373927_0000586_19007_20200 366
254 3300035725 Ga0373947_0069917 Ga0373947_0069917_367_1560 366
255 3300036401 Ga0373937_0128507 Ga0373937_0128507_248_1441 366
256 3300039438 Ga0436360_1107199 Ga0436360_1107199_1623_2804 366
257 3300046477 Ga0495664_0018171 Ga0495664_0018171_285_1478 366
258 3300046642 Ga0495634_0077762 Ga0495634_0077762_338_1531 366
259 3300046689 Ga0495613_0001108 Ga0495613_0001108_13452_14612 366
260 3300047319 Ga0495674_0003817 Ga0495674_0003817_4460_5653 366
261 3300047471 Ga0495684_0020191 Ga0495684_0020191_3102_4295 366
262 3300047673 Ga0495593_0060817 Ga0495593_0060817_513_1706 366
263 3300048915 Ga0496112_0139649 Ga0496112_0139649_96_1271 366
264 3300050507 nmdc:mga05p37_44542_c1 nmdc:mga05p37_44542_c1_3974_5143 366
265 3300050515 nmdc:mga0a205_76590_c1 nmdc:mga0a205_76590_c1_1084_2253 366
266 3300039447 Ga0436361_0709478 Ga0436361_0709478_817_1998 367
267 3300005328 Ga0070676_10005506 Ga0070676_100055063 368
268 3300005353 Ga0070669_100000037 Ga0070669_10000003754 368
269 3300005467 Ga0070706_100005810 Ga0070706_1000058108 368
270 3300005467 Ga0070706_100147833 Ga0070706_1001478332 368
271 3300005468 Ga0070707_100002288 Ga0070707_10000228811 368
272 3300005468 Ga0070707_100160426 Ga0070707_1001604262 368
273 3300005471 Ga0070698_100003106 Ga0070698_1000031068 368
274 3300005471 Ga0070698_100009338 Ga0070698_1000093384 368
275 3300005544 Ga0070686_100021940 Ga0070686_1000219404 368
276 3300005981 Ga0081538_10037086 Ga0081538_100370862 368
277 3300006028 Ga0070717_10118860 Ga0070717_101188602 368
278 3300006871 Ga0075434_100003607 Ga0075434_1000036076 368
279 3300006914 Ga0075436_100000254 Ga0075436_1000002549 368
280 3300007076 Ga0075435_100058189 Ga0075435_1000581892 368
281 3300021388 Ga0213875_10000002 Ga0213875_10000002579 368
282 3300025907 Ga0207645_10009519 Ga0207645_100095194 368
283 3300025910 Ga0207684_10001756 Ga0207684_100017564 368
284 3300025910 Ga0207684_10046765 Ga0207684_100467652 368
285 3300025922 Ga0207646_10003313 Ga0207646_1000331310 368
286 3300025923 Ga0207681_10000015 Ga0207681_10000015157 368
287 3300025928 Ga0207700_10130359 Ga0207700_101303592 368
288 3300035695 Ga0373927_0107728 Ga0373927_0107728_121_1317 368
289 3300037853 Ga0436364_0939060 Ga0436364_0939060_523_1695 368
290 3300037853 Ga0436364_0940248 Ga0436364_0940248_231768_232937 368
291 3300039450 Ga0436363_1441530 Ga0436363_1441530_313_1485 368
292 3300050513 nmdc:mga0rr50_13864_c1 nmdc:mga0rr50_13864_c1_1374_2555 368
293 3300050514 nmdc:mga08x19_304_c1 nmdc:mga08x19_304_c1_10339_11502 368
294 3300050515 nmdc:mga0a205_89612_c1 nmdc:mga0a205_89612_c1_1652_2833 368
295 3300005434 Ga0070709_10000835 Ga0070709_1000083515 369
296 3300005435 Ga0070714_100002002 Ga0070714_10000200210 369
297 3300005435 Ga0070714_100068566 Ga0070714_1000685662 369
298 3300005436 Ga0070713_100005318 Ga0070713_1000053188 369
299 3300005436 Ga0070713_100011528 Ga0070713_1000115284 369
300 3300005436 Ga0070713_100248881 Ga0070713_1002488812 369
301 3300005436 Ga0070713_100307475 Ga0070713_1003074752 369
302 3300005437 Ga0070710_10065354 Ga0070710_100653542 369
303 3300005439 Ga0070711_100002003 Ga0070711_1000020039 369
304 3300005439 Ga0070711_100023308 Ga0070711_1000233082 369
305 3300005441 Ga0070700_100069576 Ga0070700_1000695762 369
306 3300005467 Ga0070706_100193606 Ga0070706_1001936062 369
307 3300005468 Ga0070707_100012281 Ga0070707_1000122813 369
308 3300006028 Ga0070717_10021030 Ga0070717_100210303 369
309 3300006028 Ga0070717_10022266 Ga0070717_100222663 369
310 3300006173 Ga0070716_100023163 Ga0070716_1000231632 369
311 3300006173 Ga0070716_100054623 Ga0070716_1000546231 369
312 3300006175 Ga0070712_100004869 Ga0070712_1000048693 369
313 3300006175 Ga0070712_100015225 Ga0070712_1000152255 369
314 3300006178 Ga0075367_10013282 Ga0075367_100132822 369
315 3300006871 Ga0075434_100002321 Ga0075434_10000232110 369
316 3300009094 Ga0111539_10012184 Ga0111539_100121848 369
317 3300019177 Ga0184592_105357 Ga0184592_1053573 369
318 3300024227 Ga0228598_1003029 Ga0228598_10030292 369
319 3300025898 Ga0207692_10001516 Ga0207692_100015166 369
320 3300025898 Ga0207692_10002479 Ga0207692_100024792 369
321 3300025906 Ga0207699_10008081 Ga0207699_100080812 369
322 3300025915 Ga0207693_10001552 Ga0207693_100015526 369
323 3300025915 Ga0207693_10005124 Ga0207693_100051247 369
324 3300025915 Ga0207693_10024853 Ga0207693_100248532 369
325 3300025915 Ga0207693_10062613 Ga0207693_100626132 369
326 3300025915 Ga0207693_10167569 Ga0207693_101675692 369
327 3300025916 Ga0207663_10023735 Ga0207663_100237352 369
328 3300025928 Ga0207700_10001271 Ga0207700_1000127114 369
329 3300025928 Ga0207700_10009306 Ga0207700_100093065 369
330 3300025928 Ga0207700_10213306 Ga0207700_102133061 369
331 3300025928 Ga0207700_10252206 Ga0207700_102522062 369
332 3300025929 Ga0207664_10000852 Ga0207664_100008522 369
333 3300025929 Ga0207664_10022385 Ga0207664_100223853 369
334 3300025929 Ga0207664_10119310 Ga0207664_101193102 369
335 3300025939 Ga0207665_10005313 Ga0207665_100053134 369
336 3300026075 Ga0207708_10068342 Ga0207708_100683422 369
337 3300026078 Ga0207702_10156626 Ga0207702_101566261 369
338 3300027907 Ga0207428_10023447 Ga0207428_100234471 369
339 3300028017 Ga0265356_1004072 Ga0265356_10040722 369
340 3300030760 Ga0265762_1008381 Ga0265762_10083812 369
341 3300030836 Ga0265767_100065 Ga0265767_1000653 369
342 3300031090 Ga0265760_10000173 Ga0265760_1000017311 369
343 3300031249 Ga0265339_10006290 Ga0265339_100062905 369
344 3300031507 Ga0307509_10000873 Ga0307509_1000087327 369
345 3300031616 Ga0307508_10057839 Ga0307508_100578393 369
346 3300031838 Ga0307518_10000753 Ga0307518_100007536 369
347 3300033179 Ga0307507_10026112 Ga0307507_100261122 369
348 3300033545 Ga0316214_1000540 Ga0316214_10005402 369
349 3300035090 Ga0373949_0000437 Ga0373949_0000437_8387_9571 369
350 3300035111 Ga0373923_0005610 Ga0373923_0005610_892_2070 369
351 3300035113 Ga0373936_0022208 Ga0373936_0022208_1136_2314 369
352 3300035120 Ga0373957_0080656 Ga0373957_0080656_19_1197 369
353 3300035170 Ga0373943_0003419 Ga0373943_0003419_3470_4648 369
354 3300035171 Ga0373946_0003271 Ga0373946_0003271_3670_4848 369
355 3300035692 Ga0373935_0001655 Ga0373935_0001655_3643_4821 369
356 3300035695 Ga0373927_0002139 Ga0373927_0002139_6954_8132 369
357 3300035724 Ga0373933_0201661 Ga0373933_0201661_70_1248 369
358 3300035725 Ga0373947_0002110 Ga0373947_0002110_4553_5731 369
359 3300035725 Ga0373947_0003718 Ga0373947_0003718_4856_6034 369
360 3300037068 Ga0373925_0020935 Ga0373925_0020935_1436_2614 369
361 3300037853 Ga0436364_0226095 Ga0436364_0226095_59_1270 369
362 3300038443 Ga0395901_0186365 Ga0395901_0186365_690_1871 369
363 3300039437 Ga0436365_0354335 Ga0436365_0354335_5980_7191 369
364 3300044684 Ga0466966_0001298 Ga0466966_0001298_7775_8998 369
365 3300044694 Ga0466963_0000074 Ga0466963_0000074_27919_29142 369
366 3300044719 Ga0466971_0008385 Ga0466971_0008385_1591_2814 369
367 3300044842 Ga0466957_0003631 Ga0466957_0003631_3252_4475 369
368 3300045049 Ga0466959_0003085 Ga0466959_0003085_7262_8485 369
369 3300045051 Ga0451576_0090257 Ga0451576_0090257_1985_3157 369
370 3300045836 Ga0466958_0000241 Ga0466958_0000241_8360_9583 369
371 3300046454 Ga0495592_0026920 Ga0495592_0026920_3092_4291 369
372 3300046472 Ga0495580_0043098 Ga0495580_0043098_1174_2352 369
373 3300046476 Ga0495662_0018289 Ga0495662_0018289_750_1949 369
374 3300046477 Ga0495664_0000377 Ga0495664_0000377_14023_15222 369
375 3300046511 Ga0495608_0145999 Ga0495608_0145999_252_1430 369
376 3300046514 Ga0495618_0008125 Ga0495618_0008125_3249_4448 369
377 3300046517 Ga0495630_0016753 Ga0495630_0016753_2392_3570 369
378 3300046529 Ga0495652_0010358 Ga0495652_0010358_2280_3479 369
379 3300046533 Ga0495640_0091663 Ga0495640_0091663_27_1226 369
380 3300046535 Ga0495586_0014122 Ga0495586_0014122_2730_3929 369
381 3300046663 Ga0495635_0009984 Ga0495635_0009984_3297_4496 369
382 3300046675 Ga0495657_0000739 Ga0495657_0000739_11206_12405 369
383 3300047315 Ga0495581_0003322 Ga0495581_0003322_4740_5939 369
384 3300047321 Ga0495676_0002723 Ga0495676_0002723_11212_12411 369
385 3300047673 Ga0495593_0060854 Ga0495593_0060854_14_1213 369
386 3300048088 Ga0495602_0034575 Ga0495602_0034575_114_1313 369
387 3300048089 Ga0495614_0036637 Ga0495614_0036637_414_1613 369
388 3300048907 Ga0496104_0046601 Ga0496104_0046601_1614_2792 369
389 3300048913 Ga0496110_0097846 Ga0496110_0097846_754_1932 369
390 3300048915 Ga0496112_0003034 Ga0496112_0003034_11878_13056 369
391 3300048916 Ga0496113_0001339 Ga0496113_0001339_7828_9006 369
392 3300050494 nmdc:mga06z11_1135_c1 nmdc:mga06z11_1135_c1_2387_3601 369
393 3300050512 nmdc:mga0n895_122341_c1 nmdc:mga0n895_122341_c1_485_1675 369
394 3300050512 nmdc:mga0n895_1684_c1 nmdc:mga0n895_1684_c1_10366_11538 369
395 3300050513 nmdc:mga0rr50_39720_c1 nmdc:mga0rr50_39720_c1_191_1363 369
396 3300055283 Ga0500661_009452 Ga0500661_009452_561_1739 369
397 3300001991 JGI24743J22301_10006232 JGI24743J22301_100062323 370
398 3300005327 Ga0070658_10033364 Ga0070658_100333643 370
399 3300005327 Ga0070658_10047859 Ga0070658_100478594 370
400 3300005338 Ga0068868_100000068 Ga0068868_1000000684 370
401 3300005345 Ga0070692_10026015 Ga0070692_100260153 370
402 3300006028 Ga0070717_10000108 Ga0070717_1000010820 370
403 3300009551 Ga0105238_10000115 Ga0105238_1000011524 370
404 3300013296 Ga0157374_10000006 Ga0157374_10000006215 370
405 3300013307 Ga0157372_10150278 Ga0157372_101502782 370
406 3300014745 Ga0157377_10000003 Ga0157377_10000003362 370
407 3300025924 Ga0207694_10000001 Ga0207694_100000013177 370
408 3300026023 Ga0207677_10000180 Ga0207677_1000018012 370
409 3300031344 Ga0265316_10119652 Ga0265316_101196521 370
410 3300045976 Ga0466967_0079226 Ga0466967_0079226_151_1347 370
411 3300048918 Ga0496115_0072064 Ga0496115_0072064_1303_2502 370
412 3300059647 Ga0587079_010786 Ga0587079_010786_259_1440 370

Structural Annotation

Top 5 Hits

ID Description Score Start End
2l10-assembly1.cif.gz_A solution structure of the r6 domain of talin 0.349 160 344
4ecg-assembly1.cif.gz_A crystal structure of a putative iron-regulated protein a precursor (bdi_2603) from parabacteroides distasonis atcc 8503 at 2.30 a resolution 0.3287 176 346
2l10-assembly1.cif.gz_A solution structure of the r6 domain of talin 0.3101 160 344
5j7y-assembly1.cif.gz_BC architecture of loose respirasome 0.287 119 338
8gl3-assembly1.cif.gz_A de novo design of monomeric helical bundles for ph-controlled membrane lysis 0.2796 101 342
ID Description Score Start End Superfamily
2l10A00 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Talin, central domain 0.349 160 344 1.20.1420.10
af_P0AEL0_1_211_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.3401 182 344 1.20.950.20
af_I1LQ19_56_295_1.20.1410.10 Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain 0.3281 182 342 1.20.1410.10
af_Q5PQJ5_656_890_1.10.555.10 Mainly Alpha;Orthogonal Bundle;Phosphatidylinositol 3-kinase; Chain A;Rho GTPase activation protein 0.3121 185 350 1.10.555.10
2l10A00 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Talin, central domain 0.3101 160 344 1.20.1420.10
ID Description Score Start End GO Terms
AF-A0A3M1SS94-F1-model_v4 Uncharacterized protein 0.9178 1 351
AF-A0A848XAZ8-F1-model_v4 Uncharacterized protein 0.9091 1 350
AF-A0A3M1SS94-F1-model_v4 Uncharacterized protein 0.8983 1 351
AF-A0A4U0NIV6-F1-model_v4 Uncharacterized protein 0.8811 1 370
AF-A0A4U0NIV6-F1-model_v4 Uncharacterized protein 0.8765 1 370

Feature Viewer

pLDDT pTM Quality
83.79 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map