F437809

General Info

Members Datasets Scaffolds Average Seq Length
412 245 393 230

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10087133|Ga0157375_100871333
Length 220
Sequence MQRRNFTSGLVSAGGLWGLAAWPSARAAGITESDAALGVRAALERGAASAVSLLGKSGGFLDNPKVRIPLPGFLNEAAKLAKFTGQQRRVDELVTAMNRAAEAAVPQARALLTNAVRSMGDNSVTQFFAAKTRVPLNARFLPIVTKETAKVSLADKYNALAGKAAATGLLKKDDANIQQYVTGKALDGLYLMIGEEERKIRQNPVATGSAILSKVFGSLR

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2547132374 Acidovorax radicis N35 Isolate Unclassified
3 2643221570 Acidovorax sp. Root568 Isolate Unclassified
4 2643221609 Acidovorax sp. Root217 Isolate Unclassified
5 2643221611 Acidovorax sp. Root219 Isolate Unclassified
6 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
7 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
8 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
9 2643221652 Acidovorax sp. Root402 Isolate Unclassified
10 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
11 2643221660 Methylibium sp. Root1272 Isolate Unclassified
12 2643221717 Acidovorax sp. Root267 Isolate Unclassified
13 2738541337 Pelomonas sp. BT06 Isolate Unclassified
14 2831864461 Roseateles noduli HZ7 Isolate Nodule
15 2842733646 Variovorax sp. R-72446 Isolate Unclassified
16 2842747753 Variovorax sp. R-72060 Isolate Unclassified
17 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
18 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
19 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
20 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
21 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
22 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
23 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
24 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
25 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
26 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
27 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
28 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
29 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
30 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
31 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
32 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
33 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
34 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
35 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
36 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
37 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
38 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
39 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
40 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
41 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
42 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
43 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
44 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
45 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
46 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
47 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
48 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
49 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
50 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
51 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
52 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
53 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
54 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
55 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
89 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
105 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
106 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
108 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
109 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
110 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
111 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
114 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
117 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
119 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
122 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
149 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
153 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
154 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
155 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
158 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
159 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
160 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
167 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
168 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
169 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
173 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
174 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
175 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
176 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
177 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
178 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
179 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
180 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
181 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
182 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
183 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
184 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
185 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
186 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
187 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
188 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
189 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
190 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
191 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
192 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
193 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
194 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
195 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
196 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
199 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
200 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
201 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
202 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
203 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
204 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
205 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
206 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
207 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
208 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
209 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
210 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
211 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
212 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
213 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
216 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
217 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
218 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
219 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
225 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
226 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
227 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
228 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
229 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
230 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
233 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
234 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
235 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
236 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
237 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
238 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
239 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
240 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
241 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
242 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
243 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
244 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
245 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.15
Metatranscriptomes 0.24
Isolates 4.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 35.68
Nodule 0.97
Rhizoplane 0.73
Rhizosphere 45.63
Stem 0
Stem Tuber 0
Unclassified 16.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000031 3300002704 Bacteria 106418
2 JGI25156J39149_1000040 3300002705 Bacteria 106617
3 JGI25154J39366_1000060 3300002738 Bacteria 106617
4 JGI25157J39369_1000058 3300002741 Bacteria 106617
5 JGI25159J45721_1000140 3300002987 Bacteria 33403
6 JGI25159J45721_1001846 3300002987 Bacteria 8465
7 Ga0006778J45830_1055026 3300003162 Bacteria 1929
8 JGI25151J46595_10003714 3300003187 Bacteria 8295
9 JGI25151J46595_10005843 3300003187 Bacteria 6294
10 rootH1_10001728 3300003316 Bacteria 11784
11 rootH2_10001809 3300003320 Bacteria 13966
12 rootL2_10000062 3300003322 Bacteria 27456
13 rootL2_10029867 3300003322 Bacteria 4286
14 rootH1_10003360 3300003323 Bacteria 7493
15 rootH1_10017044 3300003323 Bacteria 11838
16 JGI25160J50197_1000198 3300003354 Bacteria 50243
17 JGI25161J50226_1000021 3300003374 Bacteria 163584
18 Ga0055526_1009325 3300003771 Bacteria 4743
19 Ga0055526_1015450 3300003771 Bacteria 3063
20 Ga0055526_1015722 3300003771 Bacteria 3017
21 Ga0055526_1055789 3300003771 Bacteria 869
22 Ga0055537_1000265 3300003773 Bacteria 38230
23 Ga0055524_1000139 3300003775 Bacteria 86430
24 Ga0055524_1000338 3300003775 Bacteria 43287
25 Ga0055524_1000614 3300003775 Bacteria 25561
26 Ga0055524_1008203 3300003775 Bacteria 4360
27 Ga0055536_1004503 3300003781 Bacteria 7096
28 Ga0055536_1036375 3300003781 Bacteria 1218
29 Ga0055534_1000911 3300003784 Bacteria 13330
30 Ga0055528_1001693 3300003790 Bacteria 12842
31 Ga0055530_10000509 3300003791 Bacteria 33816
32 Ga0055530_10007910 3300003791 Bacteria 4363
33 Ga0055540_1000090 3300003792 Bacteria 99454
34 Ga0055540_1000091 3300003792 Bacteria 99089
35 Ga0055540_1000274 3300003792 Bacteria 46571
36 Ga0055540_1005597 3300003792 Bacteria 5230
37 Ga0055531_10002811 3300003794 Bacteria 11424
38 Ga0055531_10003224 3300003794 Bacteria 10465
39 Ga0055531_10003742 3300003794 Bacteria 9554
40 Ga0055531_10005864 3300003794 Bacteria 7092
41 Ga0055531_10021893 3300003794 Bacteria 2459
42 Ga0055543_1000238 3300004625 Bacteria 42822
43 Ga0055543_1002946 3300004625 Bacteria 5303
44 Ga0065165_1000235 3300005262 Bacteria 96698
45 Ga0065165_1000496 3300005262 Bacteria 60846
46 Ga0065165_1007398 3300005262 Bacteria 5412
47 Ga0065165_1008359 3300005262 Bacteria 4861
48 Ga0065704_10365554 3300005289 Bacteria 790
49 Ga0070676_10221069 3300005328 Bacteria 1251
50 Ga0070676_10233863 3300005328 Bacteria 1219
51 Ga0070670_100260704 3300005331 Unclassified 1511
52 Ga0070677_10004605 3300005333 Bacteria 4508
53 Ga0070666_10073748 3300005335 Bacteria 2325
54 Ga0070661_100010214 3300005344 Bacteria 6522
55 Ga0070668_100618844 3300005347 Bacteria 949
56 Ga0070669_100009870 3300005353 Bacteria 6800
57 Ga0070669_100405444 3300005353 Bacteria 1116
58 Ga0070675_100001482 3300005354 Bacteria 17319
59 Ga0070674_100012232 3300005356 Bacteria 5266
60 Ga0070673_100011049 3300005364 Bacteria 6151
61 Ga0070673_100208758 3300005364 Bacteria 1685
62 Ga0070659_100005081 3300005366 Bacteria 9434
63 Ga0070663_100003133 3300005455 Bacteria 9477
64 Ga0070663_100018262 3300005455 Bacteria 4594
65 Ga0070678_100027436 3300005456 Bacteria 3867
66 Ga0070678_100459486 3300005456 Bacteria 1116
67 Ga0070662_100001654 3300005457 Bacteria 13712
68 Ga0070662_100202236 3300005457 Bacteria 1577
69 Ga0070662_100215834 3300005457 Bacteria 1528
70 Ga0068867_100002317 3300005459 Bacteria 13397
71 Ga0068867_100132034 3300005459 Bacteria 1942
72 Ga0068867_100360329 3300005459 Bacteria 1216
73 Ga0070706_100000367 3300005467 Bacteria 54314
74 Ga0070706_100536786 3300005467 Bacteria 1088
75 Ga0068853_100348093 3300005539 Bacteria 1378
76 Ga0070672_100000485 3300005543 Bacteria 23134
77 Ga0070665_100514228 3300005548 Bacteria 1209
78 Ga0070664_100002915 3300005564 Bacteria 13849
79 Ga0070664_100069438 3300005564 Bacteria 3015
80 Ga0070664_100196841 3300005564 Bacteria 1797
81 Ga0068857_100097449 3300005577 Bacteria 2636
82 Ga0068854_100061852 3300005578 Bacteria 2712
83 Ga0068854_100134601 3300005578 Bacteria 1891
84 Ga0068856_100008694 3300005614 Bacteria 9879
85 Ga0068852_100104534 3300005616 Bacteria 2563
86 Ga0068852_100386559 3300005616 Bacteria 1374
87 Ga0068859_100187630 3300005617 Bacteria 2152
88 Ga0068864_100272298 3300005618 Bacteria 1578
89 Ga0068866_10264243 3300005718 Bacteria 1059
90 Ga0068861_100388683 3300005719 Bacteria 1235
91 Ga0068870_10419541 3300005840 Bacteria 875
92 Ga0068863_100047320 3300005841 Bacteria 4080
93 Ga0068860_100035852 3300005843 Bacteria 4757
94 Ga0068860_100848564 3300005843 Bacteria 928
95 Ga0075363_100000145 3300006048 Bacteria 17501
96 Ga0075363_100112468 3300006048 Bacteria 1514
97 Ga0075363_100140224 3300006048 Bacteria 1361
98 Ga0075364_10048249 3300006051 Bacteria 2774
99 Ga0075362_10011743 3300006177 Bacteria 3457
100 Ga0075362_10053283 3300006177 Bacteria 1815
101 Ga0075367_10002249 3300006178 Bacteria 8731
102 Ga0075367_10040639 3300006178 Bacteria 2716
103 Ga0075366_10000582 3300006195 Bacteria 17130
104 Ga0075366_10018221 3300006195 Bacteria 4051
105 Ga0075366_10042975 3300006195 Bacteria 2676
106 Ga0075366_10118062 3300006195 Bacteria 1598
107 Ga0075366_10151287 3300006195 Bacteria 1405
108 Ga0097621_100048632 3300006237 Bacteria 3442
109 Ga0097621_100884546 3300006237 Bacteria 831
110 Ga0075370_10000854 3300006353 Bacteria 12360
111 Ga0075370_10007981 3300006353 Bacteria 5425
112 Ga0075370_10008475 3300006353 Bacteria 5292
113 Ga0075370_10011221 3300006353 Bacteria 4702
114 Ga0075370_10036759 3300006353 Bacteria 2751
115 Ga0075370_10068866 3300006353 Bacteria 2022
116 Ga0075370_10174071 3300006353 Bacteria 1266
117 Ga0068871_100059839 3300006358 Bacteria 3105
118 Ga0075430_100035051 3300006846 Bacteria 4260
119 Ga0075429_100001726 3300006880 Bacteria 18078
120 Ga0068865_100053358 3300006881 Bacteria 2805
121 Ga0097620_100187616 3300006931 Bacteria 2152
122 Ga0099823_1000003 3300006944 Bacteria 189058
123 Ga0079104_1005464 3300006946 Bacteria 5069
124 Ga0105245_10413263 3300009098 Bacteria 1351
125 Ga0114129_10369273 3300009147 Bacteria 1897
126 Ga0105237_10160741 3300009545 Bacteria 2245
127 Ga0105239_10091245 3300010375 Bacteria 3361
128 Ga0157319_1000002 3300012497 Bacteria 410803
129 Ga0157371_10078847 3300013102 Bacteria 2333
130 Ga0157370_10429675 3300013104 Bacteria 1215
131 Ga0157378_10040522 3300013297 Bacteria 4130
132 Ga0157372_10390070 3300013307 Bacteria 1623
133 Ga0157375_10087133 3300013308 Bacteria 3174
134 Ga0157375_10608280 3300013308 Bacteria 1252
135 Ga0163163_10687341 3300014325 Bacteria 1087
136 Ga0182008_10001996 3300014497 Bacteria 13096
137 Ga0157376_10053709 3300014969 Bacteria 3356
138 Ga0163161_10012105 3300017792 Bacteria 5985
139 Ga0163161_10243392 3300017792 Bacteria 1400
140 Ga0163161_10267084 3300017792 Bacteria 1338
141 Ga0209435_100019 3300025206 Bacteria 260989
142 Ga0209436_115500 3300025208 Bacteria 1176
143 Ga0209563_100014 3300025230 Bacteria 940582
144 Ga0209646_1000038 3300025246 Bacteria 353982
145 Ga0209026_1000048 3300025250 Bacteria 257264
146 Ga0209759_1000038 3300025256 Bacteria 257264
147 Ga0209129_1004774 3300025258 Bacteria 5124
148 Ga0209129_1008371 3300025258 Bacteria 2889
149 Ga0209129_1017475 3300025258 Bacteria 1405
150 Ga0209565_1000309 3300025263 Bacteria 45428
151 Ga0209565_1001566 3300025263 Bacteria 9786
152 Ga0209565_1004921 3300025263 Bacteria 3979
153 Ga0209673_1000088 3300025273 Bacteria 204629
154 Ga0209673_1014859 3300025273 Bacteria 2992
155 Ga0209673_1017666 3300025273 Bacteria 2622
156 Ga0209673_1020442 3300025273 Bacteria 2344
157 Ga0209673_1026312 3300025273 Bacteria 1913
158 Ga0209130_1000103 3300025284 Bacteria 137115
159 Ga0209130_1000920 3300025284 Bacteria 23688
160 Ga0209675_1001254 3300025291 Bacteria 15221
161 Ga0209676_1001499 3300025292 Bacteria 21342
162 Ga0209676_1002299 3300025292 Bacteria 13921
163 Ga0209025_1003677 3300025294 Bacteria 14173
164 Ga0209025_1004241 3300025294 Bacteria 12621
165 Ga0209025_1014316 3300025294 Bacteria 4890
166 Ga0209564_1000392 3300025295 Bacteria 78508
167 Ga0209564_1000702 3300025295 Bacteria 49036
168 Ga0209564_1003145 3300025295 Bacteria 11626
169 Ga0209564_1050431 3300025295 Bacteria 1019
170 Ga0209758_1000769 3300025297 Bacteria 46067
171 Ga0209050_1000008 3300025298 Bacteria 1144179
172 Ga0209050_1000326 3300025298 Bacteria 95495
173 Ga0209050_1001275 3300025298 Bacteria 28904
174 Ga0209050_1006914 3300025298 Bacteria 6556
175 Ga0209050_1013952 3300025298 Bacteria 3515
176 Ga0209256_1000019 3300025299 Bacteria 558627
177 Ga0209256_1000072 3300025299 Bacteria 239812
178 Ga0209256_1000096 3300025299 Bacteria 204629
179 Ga0209256_1000634 3300025299 Bacteria 47973
180 Ga0207426_1000586 3300025302 Bacteria 48467
181 Ga0207426_1004328 3300025302 Bacteria 6996
182 Ga0209051_1000005 3300025303 Bacteria 1142353
183 Ga0209051_1000133 3300025303 Bacteria 139014
184 Ga0209051_1000306 3300025303 Bacteria 77135
185 Ga0209051_1001694 3300025303 Bacteria 17686
186 Ga0209257_1000015 3300025304 Bacteria 908141
187 Ga0209257_1000031 3300025304 Bacteria 688770
188 Ga0209257_1000038 3300025304 Bacteria 609032
189 Ga0209257_1000401 3300025304 Bacteria 84658
190 Ga0209257_1001115 3300025304 Bacteria 34828
191 Ga0209257_1061111 3300025304 Bacteria 1023
192 Ga0207697_10004600 3300025315 Bacteria 6555
193 Ga0207682_10009338 3300025893 Bacteria 3875
194 Ga0207682_10028565 3300025893 Bacteria 2227
195 Ga0207680_10192070 3300025903 Bacteria 1387
196 Ga0207684_10008021 3300025910 Bacteria 9432
197 Ga0207684_10435774 3300025910 Bacteria 1126
198 Ga0207649_10062829 3300025920 Bacteria 2342
199 Ga0207681_10005629 3300025923 Bacteria 7689
200 Ga0207681_10008769 3300025923 Bacteria 6177
201 Ga0207650_10000275 3300025925 Bacteria 53824
202 Ga0207659_10003305 3300025926 Bacteria 9661
203 Ga0207644_10005477 3300025931 Bacteria 8268
204 Ga0207644_10092343 3300025931 Bacteria 2258
205 Ga0207690_10012535 3300025932 Bacteria 5073
206 Ga0207706_10000754 3300025933 Bacteria 33680
207 Ga0207706_10071939 3300025933 Bacteria 3042
208 Ga0207706_10199236 3300025933 Bacteria 1756
209 Ga0207669_10004036 3300025937 Bacteria 6424
210 Ga0207704_10042029 3300025938 Bacteria 2687
211 Ga0207691_10001335 3300025940 Bacteria 24610
212 Ga0207679_10000339 3300025945 Bacteria 34501
213 Ga0207679_10200491 3300025945 Bacteria 1666
214 Ga0207679_10405584 3300025945 Bacteria 1200
215 Ga0207651_10248154 3300025960 Bacteria 1455
216 Ga0207668_10241999 3300025972 Bacteria 1460
217 Ga0207640_10033092 3300025981 Bacteria 3212
218 Ga0207658_10181785 3300025986 Bacteria 1741
219 Ga0207648_10007993 3300026089 Bacteria 10315
220 Ga0207648_10358994 3300026089 Bacteria 1314
221 Ga0207676_10082283 3300026095 Bacteria 2618
222 Ga0207676_10120816 3300026095 Bacteria 2209
223 Ga0207674_10454511 3300026116 Bacteria 1238
224 Ga0207683_10011844 3300026121 Bacteria 7441
225 Ga0207698_10173892 3300026142 Bacteria 1899
226 Ga0207698_10356824 3300026142 Bacteria 1383
227 Ga0207698_10520621 3300026142 Bacteria 1161
228 Ga0209389_1028617 3300027296 Bacteria 4768
229 Ga0209970_1000452 3300027614 Bacteria 7005
230 Ga0210002_1025500 3300027617 Bacteria 967
231 Ga0207428_10227751 3300027907 Bacteria 1396
232 Ga0307517_10009127 3300028786 Bacteria 14120
233 Ga0307517_10051134 3300028786 Bacteria 4180
234 Ga0307517_10060868 3300028786 Bacteria 3583
235 Ga0307517_10141299 3300028786 Bacteria 1689
236 Ga0307515_10011753 3300028794 Bacteria 16566
237 Ga0307515_10146272 3300028794 Bacteria 2500
238 Ga0307515_10233660 3300028794 Bacteria 1625
239 Ga0307513_10000028 3300031456 Bacteria 193264
240 Ga0307513_10000568 3300031456 Bacteria 52926
241 Ga0307513_10010837 3300031456 Bacteria 11385
242 Ga0307513_10018553 3300031456 Bacteria 8309
243 Ga0307513_10083646 3300031456 Bacteria 3281
244 Ga0307513_10109819 3300031456 Bacteria 2755
245 Ga0307513_10338479 3300031456 Bacteria 1256
246 Ga0307513_10432371 3300031456 Bacteria 1044
247 Ga0307509_10000405 3300031507 Bacteria 72472
248 Ga0307509_10024760 3300031507 Bacteria 6716
249 Ga0307509_10032600 3300031507 Bacteria 5740
250 Ga0307509_10038943 3300031507 Bacteria 5181
251 Ga0307509_10107897 3300031507 Bacteria 2798
252 Ga0307509_10119283 3300031507 Bacteria 2619
253 Ga0307509_10202041 3300031507 Bacteria 1823
254 Ga0307408_100010674 3300031548 Bacteria 6057
255 Ga0307408_100089582 3300031548 Bacteria 2319
256 Ga0307408_100169664 3300031548 Bacteria 1741
257 Ga0307508_10007741 3300031616 Bacteria 9985
258 Ga0307508_10015474 3300031616 Bacteria 6948
259 Ga0307508_10086523 3300031616 Bacteria 2718
260 Ga0307514_10000530 3300031649 Bacteria 74660
261 Ga0307514_10051154 3300031649 Bacteria 3203
262 Ga0307516_10001028 3300031730 Bacteria 38713
263 Ga0307516_10020978 3300031730 Bacteria 6740
264 Ga0307516_10104215 3300031730 Bacteria 2649
265 Ga0307413_10224548 3300031824 Bacteria 1374
266 Ga0307410_10014472 3300031852 Bacteria 4643
267 Ga0307406_10000604 3300031901 Bacteria 20514
268 Ga0307406_10037932 3300031901 Bacteria 2980
269 Ga0307406_10051828 3300031901 Bacteria 2607
270 Ga0307412_10227212 3300031911 Bacteria 1435
271 Ga0307412_10268720 3300031911 Unclassified 1333
272 Ga0307409_100321106 3300031995 Bacteria 1449
273 Ga0307416_100744629 3300032002 Bacteria 1072
274 Ga0307507_10069283 3300033179 Bacteria 3211
275 Ga0307510_10003419 3300033180 Bacteria 18519
276 Ga0307510_10033328 3300033180 Bacteria 5786
277 Ga0307510_10038258 3300033180 Bacteria 5306
278 Ga0307510_10128141 3300033180 Bacteria 2220
279 Ga0373928_0011363 3300035084 Bacteria 1761
280 Ga0373932_0010722 3300035112 Bacteria 2225
281 Ga0373931_0007559 3300035691 Bacteria 5117
282 Ga0395905_0409399 3300037471 Bacteria 1251
283 Ga0439436_0000739 3300041404 Bacteria 8808
284 Ga0439439_0039459 3300041406 Bacteria 1220
285 Ga0439461_0027759 3300041410 Bacteria 1163
286 Ga0439466_0005624 3300041411 Bacteria 4781
287 Ga0439465_0002727 3300041413 Bacteria 5774
288 Ga0451795_1587285 3300041456 Bacteria 1232
289 Ga0451802_1066716 3300041460 Bacteria 696
290 Ga0451853_0936850 3300041512 Bacteria 1386
291 Ga0439431_0000511 3300041997 Bacteria 8246
292 Ga0439433_0004335 3300041999 Bacteria 3058
293 Ga0439445_0001177 3300042004 Bacteria 5615
294 Ga0439432_001319 3300042006 Bacteria 9397
295 Ga0439432_065954 3300042006 Bacteria 1109
296 Ga0439449_0000991 3300042007 Bacteria 11160
297 Ga0439449_0003349 3300042007 Bacteria 6245
298 Ga0439449_0006224 3300042007 Bacteria 4560
299 Ga0439452_003019 3300042010 Bacteria 5985
300 Ga0439462_0013351 3300042015 Bacteria 2104
301 Ga0439462_0056499 3300042015 Bacteria 1059
302 Ga0450919_001094 3300042121 Bacteria 3517
303 Ga0450923_090175 3300042125 Bacteria 698
304 Ga0450890_000423 3300042127 Bacteria 6178
305 Ga0450918_001356 3300042531 Bacteria 4904
306 Ga0451577_0000194 3300042876 Bacteria 127614
307 Ga0451577_0218910 3300042876 Bacteria 1721
308 Ga0466969_0000073 3300044656 Bacteria 52700
309 Ga0466972_0001178 3300044658 Bacteria 12542
310 Ga0466966_0119426 3300044684 Bacteria 1620
311 Ga0466963_0082442 3300044694 Bacteria 2180
312 Ga0466963_0206099 3300044694 Bacteria 1375
313 Ga0453684_0000218 3300044712 Bacteria 250267
314 Ga0453684_0019417 3300044712 Bacteria 10351
315 Ga0453684_0037298 3300044712 Bacteria 6673
316 Ga0453684_0126986 3300044712 Bacteria 3067
317 Ga0451576_0001036 3300045051 Bacteria 51297
318 Ga0451576_0411658 3300045051 Bacteria 1418
319 Ga0495627_056720 3300046453 Bacteria 1167
320 Ga0495592_0000528 3300046454 Bacteria 27565
321 Ga0495638_0055223 3300046460 Bacteria 2467
322 Ga0495610_0019994 3300046512 Bacteria 3731
323 Ga0495632_0004766 3300046519 Bacteria 9136
324 Ga0495648_0097729 3300046524 Bacteria 1628
325 Ga0495597_0159045 3300046542 Bacteria 923
326 Ga0495668_0123625 3300046616 Bacteria 1416
327 Ga0495625_0011949 3300046660 Bacteria 7048
328 Ga0495624_0090298 3300046690 Bacteria 1890
329 Ga0495649_0015516 3300046694 Bacteria 4335
330 Ga0495660_0007345 3300046810 Bacteria 6474
331 Ga0495674_0726003 3300047319 Bacteria 778
332 Ga0495676_0014995 3300047321 Bacteria 6916
333 Ga0495687_004859 3300047443 Bacteria 8826
334 Ga0495626_0042463 3300048091 Bacteria 2136
335 Ga0496106_0013343 3300048909 Bacteria 6065
336 Ga0496122_0002564 3300048925 Bacteria 25525
337 Ga0496123_0002427 3300048926 Bacteria 23189
338 Ga0496124_0055529 3300048927 Bacteria 3347
339 Ga0496124_0160369 3300048927 Bacteria 1753
340 Ga0496126_0070649 3300048929 Bacteria 3110
341 Ga0496126_0320173 3300048929 Bacteria 1275
342 Ga0501042_0123411 3300049578 Bacteria 1865
343 Ga0501043_0000277 3300049579 Bacteria 46284
344 Ga0501046_0000345 3300049580 Bacteria 46730
345 Ga0501047_0000395 3300049581 Bacteria 48969
346 Ga0501048_0000111 3300049582 Bacteria 46009
347 Ga0501045_0018065 3300049824 Bacteria 5010
348 nmdc:mga03683_2693_c1 3300050489 Bacteria 5570
349 nmdc:mga03683_29768_c1 3300050489 Bacteria 2180
350 nmdc:mga00v17_131641_c1 3300050491 Bacteria 1599
351 nmdc:mga0k408_11041_c1 3300050493 Bacteria 4906
352 nmdc:mga0k408_1412_c1 3300050493 Bacteria 12975
353 nmdc:mga0k408_162597_c1 3300050493 Bacteria 1330
354 nmdc:mga0k408_1975_c1 3300050493 Bacteria 10995
355 nmdc:mga0k408_2145_c1 3300050493 Bacteria 10579
356 nmdc:mga0k408_247273_c1 3300050493 Bacteria 1065
357 nmdc:mga0k408_39289_c1 3300050493 Bacteria 2718
358 nmdc:mga0k408_47485_c1 3300050493 Bacteria 2482
359 nmdc:mga06z11_111955_c1 3300050494 Bacteria 1513
360 nmdc:mga06z11_3034_c1 3300050494 Bacteria 6460
361 nmdc:mga06z11_52447_c1 3300050494 Bacteria 2093
362 nmdc:mga07m45_1136_c1 3300050496 Bacteria 11938
363 nmdc:mga07m45_132692_c1 3300050496 Bacteria 1441
364 nmdc:mga07m45_14735_c1 3300050496 Bacteria 4173
365 nmdc:mga07m45_1876_c1 3300050496 Bacteria 9712
366 nmdc:mga07m45_320101_c1 3300050496 Bacteria 902
367 nmdc:mga07m45_406956_c1 3300050496 Bacteria 790
368 nmdc:mga07m45_56516_c1 3300050496 Bacteria 2218
369 nmdc:mga09592_1763_c1 3300050508 Bacteria 17376
370 nmdc:mga0qj67_27872_c2 3300050509 Bacteria 3974
371 Ga0500578_0019391 3300053086 Bacteria 4367
372 Ga0500644_0007104 3300053088 Bacteria 2901
373 Ga0500651_0009118 3300053093 Bacteria 5877
374 Ga0500650_0073215 3300053098 Bacteria 1602
375 Ga0500594_0000734 3300053118 Bacteria 6961
376 Ga0500594_0008561 3300053118 Bacteria 2335
377 Ga0500597_080086 3300053120 Bacteria 1417
378 Ga0500607_049625 3300053121 Bacteria 2240
379 Ga0500658_0002749 3300053134 Bacteria 6768
380 Ga0500559_0000265 3300053136 Bacteria 40939
381 Ga0500559_0003422 3300053136 Bacteria 7808
382 Ga0500559_0018940 3300053136 Bacteria 2908
383 Ga0500559_0131724 3300053136 Bacteria 1168
384 Ga0500568_0011378 3300053139 Bacteria 4135
385 Ga0500619_010295 3300053154 Bacteria 2358
386 Ga0500622_0002135 3300053156 Bacteria 14718
387 Ga0500622_0004571 3300053156 Bacteria 8625
388 Ga0500622_0154096 3300053156 Bacteria 1083
389 Ga0500645_000422 3300053730 Bacteria 29281
390 Ga0500645_004503 3300053730 Bacteria 5329
391 Ga0500645_007176 3300053730 Bacteria 3910
392 Ga0500645_022008 3300053730 Bacteria 1964
393 Ga0500661_009009 3300055283 Bacteria 1832

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003323 rootH1_10003360 rootH1_100033607 208
2 3300003316 rootH1_10001728 rootH1_100017282 210
3 3300053121 Ga0500607_049625 Ga0500607_049625_736_1380 214
4 3300025258 Ga0209129_1008371 Ga0209129_10083712 215
5 3300025297 Ga0209758_1000769 Ga0209758_100076943 215
6 3300042125 Ga0450923_090175 Ga0450923_090175_26_676 215
7 3300044658 Ga0466972_0001178 Ga0466972_0001178_3967_4617 215
8 3300009545 Ga0105237_10160741 Ga0105237_101607413 216
9 3300010375 Ga0105239_10091245 Ga0105239_100912454 216
10 3300048909 Ga0496106_0013343 Ga0496106_0013343_1072_1722 216
11 3300050494 nmdc:mga06z11_111955_c1 nmdc:mga06z11_111955_c1_369_1025 216
12 3300050496 nmdc:mga07m45_320101_c1 nmdc:mga07m45_320101_c1_106_762 216
13 3300050496 nmdc:mga07m45_406956_c1 nmdc:mga07m45_406956_c1_29_685 216
14 3300053086 Ga0500578_0019391 Ga0500578_0019391_2289_2939 216
15 3300053730 Ga0500645_007176 Ga0500645_007176_1580_2230 216
16 3300053120 Ga0500597_080086 Ga0500597_080086_367_1035 217
17 iso_pu_bacteria 2547132374 2548501679 217
18 iso_pu_bacteria 2643221639 2644219569 217
19 iso_pu_bacteria 2643221646 2644255999 217
20 iso_pu_bacteria 2738541337 2739054457 217
21 3300025230 Ga0209563_100014 Ga0209563_100014316 218
22 3300026142 Ga0207698_10520621 Ga0207698_105206212 218
23 3300050493 nmdc:mga0k408_39289_c1 nmdc:mga0k408_39289_c1_768_1424 218
24 3300050494 nmdc:mga06z11_52447_c1 nmdc:mga06z11_52447_c1_881_1537 218
25 3300050496 nmdc:mga07m45_14735_c1 nmdc:mga07m45_14735_c1_2196_2852 218
26 iso_pu_bacteria 2831864461 2831868784 218
27 iso_pu_bacteria 2886848708 2886849132 218
28 3300005616 Ga0068852_100386559 Ga0068852_1003865592 219
29 3300026142 Ga0207698_10356824 Ga0207698_103568242 219
30 3300044656 Ga0466969_0000073 Ga0466969_0000073_51175_51843 219
31 3300044684 Ga0466966_0119426 Ga0466966_0119426_666_1334 219
32 3300044712 Ga0453684_0037298 Ga0453684_0037298_124_795 219
33 3300045051 Ga0451576_0411658 Ga0451576_0411658_53_724 219
34 3300050493 nmdc:mga0k408_247273_c1 nmdc:mga0k408_247273_c1_338_997 219
35 3300003320 rootH2_10001809 rootH2_100018092 220
36 3300003322 rootL2_10000062 rootL2_1000006217 220
37 3300003323 rootH1_10017044 rootH1_100170442 220
38 3300003771 Ga0055526_1009325 Ga0055526_10093253 220
39 3300003775 Ga0055524_1000614 Ga0055524_10006144 220
40 3300003775 Ga0055524_1008203 Ga0055524_10082034 220
41 3300003794 Ga0055531_10003224 Ga0055531_100032247 220
42 3300003794 Ga0055531_10005864 Ga0055531_100058646 220
43 3300004625 Ga0055543_1002946 Ga0055543_10029463 220
44 3300005262 Ga0065165_1000496 Ga0065165_10004962 220
45 3300005457 Ga0070662_100001654 Ga0070662_10000165412 220
46 3300006944 Ga0099823_1000003 Ga0099823_1000003172 220
47 3300012497 Ga0157319_1000002 Ga0157319_1000002361 220
48 3300013102 Ga0157371_10078847 Ga0157371_100788473 220
49 3300013308 Ga0157375_10087133 Ga0157375_100871333 220
50 3300025273 Ga0209673_1017666 Ga0209673_10176662 220
51 3300025273 Ga0209673_1020442 Ga0209673_10204422 220
52 3300025273 Ga0209673_1026312 Ga0209673_10263123 220
53 3300025295 Ga0209564_1000392 Ga0209564_100039239 220
54 3300025298 Ga0209050_1001275 Ga0209050_100127513 220
55 3300025299 Ga0209256_1000072 Ga0209256_1000072165 220
56 3300025299 Ga0209256_1000634 Ga0209256_10006344 220
57 3300025303 Ga0209051_1001694 Ga0209051_10016942 220
58 3300025304 Ga0209257_1000401 Ga0209257_100040174 220
59 3300025304 Ga0209257_1001115 Ga0209257_100111527 220
60 3300025933 Ga0207706_10000754 Ga0207706_100007545 220
61 3300026142 Ga0207698_10173892 Ga0207698_101738922 220
62 3300027296 Ga0209389_1028617 Ga0209389_10286174 220
63 3300031548 Ga0307408_100089582 Ga0307408_1000895822 220
64 3300041512 Ga0451853_0936850 Ga0451853_0936850_511_1176 220
65 3300042127 Ga0450890_000423 Ga0450890_000423_440_1117 220
66 3300044694 Ga0466963_0082442 Ga0466963_0082442_224_901 220
67 3300044694 Ga0466963_0206099 Ga0466963_0206099_172_864 220
68 3300048927 Ga0496124_0055529 Ga0496124_0055529_1444_2136 220
69 3300048929 Ga0496126_0070649 Ga0496126_0070649_1478_2173 220
70 3300050496 nmdc:mga07m45_56516_c1 nmdc:mga07m45_56516_c1_1408_2085 220
71 3300053156 Ga0500622_0002135 Ga0500622_0002135_3604_4302 220
72 3300003322 rootL2_10029867 rootL2_100298675 221
73 3300013297 Ga0157378_10040522 Ga0157378_100405224 221
74 3300028794 Ga0307515_10146272 Ga0307515_101462722 221
75 3300005262 Ga0065165_1000235 Ga0065165_100023517 222
76 3300005614 Ga0068856_100008694 Ga0068856_1000086942 222
77 3300013307 Ga0157372_10390070 Ga0157372_103900702 222
78 iso_pu_bacteria 2643221644 2644247320 222
79 3300041456 Ga0451795_1587285 Ga0451795_1587285_398_1078 223
80 3300003792 Ga0055540_1005597 Ga0055540_10055975 224
81 3300003794 Ga0055531_10002811 Ga0055531_100028118 224
82 3300025273 Ga0209673_1014859 Ga0209673_10148592 224
83 3300025303 Ga0209051_1000306 Ga0209051_100030636 224
84 3300025304 Ga0209257_1000015 Ga0209257_1000015417 224
85 3300041460 Ga0451802_1066716 Ga0451802_1066716_12_686 224
86 3300042876 Ga0451577_0000194 Ga0451577_0000194_117035_117724 224
87 3300044712 Ga0453684_0000218 Ga0453684_0000218_40961_41650 224
88 3300045051 Ga0451576_0001036 Ga0451576_0001036_36932_37621 224
89 iso_pu_bacteria 2643221660 2644338366 224
90 3300041410 Ga0439461_0027759 Ga0439461_0027759_83_763 225
91 3300005467 Ga0070706_100536786 Ga0070706_1005367862 226
92 3300025910 Ga0207684_10435774 Ga0207684_104357742 226
93 3300042121 Ga0450919_001094 Ga0450919_001094_1527_2210 226
94 3300042531 Ga0450918_001356 Ga0450918_001356_2405_3088 226
95 3300003775 Ga0055524_1000139 Ga0055524_10001399 227
96 3300003791 Ga0055530_10007910 Ga0055530_100079103 227
97 3300003792 Ga0055540_1000090 Ga0055540_10000909 227
98 3300003792 Ga0055540_1000091 Ga0055540_10000917 227
99 3300003794 Ga0055531_10021893 Ga0055531_100218932 227
100 3300005344 Ga0070661_100010214 Ga0070661_1000102146 227
101 3300005366 Ga0070659_100005081 Ga0070659_1000050818 227
102 3300005564 Ga0070664_100002915 Ga0070664_10000291510 227
103 3300005564 Ga0070664_100196841 Ga0070664_1001968413 227
104 3300006846 Ga0075430_100035051 Ga0075430_1000350513 227
105 3300006880 Ga0075429_100001726 Ga0075429_1000017269 227
106 3300025263 Ga0209565_1004921 Ga0209565_10049213 227
107 3300025298 Ga0209050_1000326 Ga0209050_100032681 227
108 3300025298 Ga0209050_1013952 Ga0209050_10139523 227
109 3300025299 Ga0209256_1000019 Ga0209256_1000019513 227
110 3300025303 Ga0209051_1000133 Ga0209051_10001339 227
111 3300025304 Ga0209257_1000038 Ga0209257_10000389 227
112 3300025920 Ga0207649_10062829 Ga0207649_100628292 227
113 3300025932 Ga0207690_10012535 Ga0207690_100125355 227
114 3300025945 Ga0207679_10000339 Ga0207679_100003393 227
115 3300025945 Ga0207679_10200491 Ga0207679_102004912 227
116 3300028786 Ga0307517_10009127 Ga0307517_100091275 227
117 3300028786 Ga0307517_10051134 Ga0307517_100511344 227
118 3300028794 Ga0307515_10011753 Ga0307515_100117534 227
119 3300031456 Ga0307513_10083646 Ga0307513_100836461 227
120 3300031507 Ga0307509_10024760 Ga0307509_100247602 227
121 3300031507 Ga0307509_10038943 Ga0307509_100389432 227
122 3300031507 Ga0307509_10107897 Ga0307509_101078974 227
123 3300031507 Ga0307509_10119283 Ga0307509_101192832 227
124 3300031507 Ga0307509_10202041 Ga0307509_102020412 227
125 3300031616 Ga0307508_10007741 Ga0307508_100077414 227
126 3300031616 Ga0307508_10015474 Ga0307508_100154742 227
127 3300031616 Ga0307508_10086523 Ga0307508_100865232 227
128 3300031911 Ga0307412_10268720 Ga0307412_102687202 227
129 3300033179 Ga0307507_10069283 Ga0307507_100692834 227
130 3300033180 Ga0307510_10128141 Ga0307510_101281413 227
131 3300035084 Ga0373928_0011363 Ga0373928_0011363_347_1030 227
132 3300035112 Ga0373932_0010722 Ga0373932_0010722_1111_1794 227
133 3300035691 Ga0373931_0007559 Ga0373931_0007559_2683_3366 227
134 3300046460 Ga0495638_0055223 Ga0495638_0055223_1719_2402 227
135 3300046524 Ga0495648_0097729 Ga0495648_0097729_481_1164 227
136 3300046690 Ga0495624_0090298 Ga0495624_0090298_115_798 227
137 3300047319 Ga0495674_0726003 Ga0495674_0726003_61_744 227
138 3300047321 Ga0495676_0014995 Ga0495676_0014995_1124_1807 227
139 3300049578 Ga0501042_0123411 Ga0501042_0123411_97_780 227
140 3300049579 Ga0501043_0000277 Ga0501043_0000277_37525_38208 227
141 3300049580 Ga0501046_0000345 Ga0501046_0000345_8523_9206 227
142 3300049581 Ga0501047_0000395 Ga0501047_0000395_37525_38208 227
143 3300049582 Ga0501048_0000111 Ga0501048_0000111_37475_38158 227
144 3300049824 Ga0501045_0018065 Ga0501045_0018065_2109_2792 227
145 3300050508 nmdc:mga09592_1763_c1 nmdc:mga09592_1763_c1_9781_10464 227
146 3300050509 nmdc:mga0qj67_27872_c2 nmdc:mga0qj67_27872_c2_844_1527 227
147 iso_pu_bacteria 2643221654 2644303484 227
148 iso_pu_bacteria 2643221570 2643865057 228
149 iso_pu_bacteria 2643221652 2644292338 228
150 iso_pu_bacteria 2643221717 2644645464 228
151 iso_pu_bacteria 2990710928 2990710951 228
152 3300005331 Ga0070670_100260704 Ga0070670_1002607041 229
153 3300005617 Ga0068859_100187630 Ga0068859_1001876302 229
154 3300005841 Ga0068863_100047320 Ga0068863_1000473202 229
155 3300005843 Ga0068860_100035852 Ga0068860_1000358523 229
156 3300006195 Ga0075366_10118062 Ga0075366_101180622 229
157 3300006931 Ga0097620_100187616 Ga0097620_1001876162 229
158 3300009098 Ga0105245_10413263 Ga0105245_104132632 229
159 3300013308 Ga0157375_10608280 Ga0157375_106082802 229
160 3300025931 Ga0207644_10092343 Ga0207644_100923432 229
161 3300026095 Ga0207676_10082283 Ga0207676_100822833 229
162 3300031507 Ga0307509_10032600 Ga0307509_100326004 229
163 3300031730 Ga0307516_10001028 Ga0307516_100010289 229
164 3300042876 Ga0451577_0218910 Ga0451577_0218910_910_1599 229
165 3300044712 Ga0453684_0019417 Ga0453684_0019417_2017_2706 229
166 3300044712 Ga0453684_0126986 Ga0453684_0126986_367_1056 229
167 3300006353 Ga0075370_10007981 Ga0075370_100079814 230
168 3300006353 Ga0075370_10011221 Ga0075370_100112214 230
169 3300028786 Ga0307517_10060868 Ga0307517_100608684 230
170 3300028794 Ga0307515_10233660 Ga0307515_102336602 230
171 3300031548 Ga0307408_100169664 Ga0307408_1001696642 230
172 3300031824 Ga0307413_10224548 Ga0307413_102245482 230
173 3300031852 Ga0307410_10014472 Ga0307410_100144722 230
174 3300031901 Ga0307406_10051828 Ga0307406_100518283 230
175 3300031995 Ga0307409_100321106 Ga0307409_1003211062 230
176 3300050496 nmdc:mga07m45_132692_c1 nmdc:mga07m45_132692_c1_626_1423 230
177 iso_pu_bacteria 2643221609 2644059087 230
178 iso_pu_bacteria 2643221611 2644075873 230
179 iso_pu_bacteria 2842733646 2842737733 230
180 iso_pu_bacteria 2842747753 2842752888 230
181 iso_pu_bacteria 2885192300 2885197567 230
182 3300003162 Ga0006778J45830_1055026 Ga0006778J45830_10550262 231
183 3300005328 Ga0070676_10233863 Ga0070676_102338631 231
184 3300005333 Ga0070677_10004605 Ga0070677_100046052 231
185 3300005335 Ga0070666_10073748 Ga0070666_100737482 231
186 3300005347 Ga0070668_100618844 Ga0070668_1006188442 231
187 3300005354 Ga0070675_100001482 Ga0070675_10000148210 231
188 3300005356 Ga0070674_100012232 Ga0070674_1000122324 231
189 3300005364 Ga0070673_100011049 Ga0070673_1000110494 231
190 3300005364 Ga0070673_100208758 Ga0070673_1002087582 231
191 3300005455 Ga0070663_100003133 Ga0070663_10000313311 231
192 3300005455 Ga0070663_100018262 Ga0070663_1000182623 231
193 3300005456 Ga0070678_100027436 Ga0070678_1000274365 231
194 3300005456 Ga0070678_100459486 Ga0070678_1004594862 231
195 3300005457 Ga0070662_100202236 Ga0070662_1002022362 231
196 3300005457 Ga0070662_100215834 Ga0070662_1002158342 231
197 3300005459 Ga0068867_100002317 Ga0068867_10000231714 231
198 3300005459 Ga0068867_100132034 Ga0068867_1001320341 231
199 3300005459 Ga0068867_100360329 Ga0068867_1003603292 231
200 3300005467 Ga0070706_100000367 Ga0070706_10000036710 231
201 3300005543 Ga0070672_100000485 Ga0070672_10000048519 231
202 3300005548 Ga0070665_100514228 Ga0070665_1005142281 231
203 3300005564 Ga0070664_100069438 Ga0070664_1000694385 231
204 3300005577 Ga0068857_100097449 Ga0068857_1000974493 231
205 3300005578 Ga0068854_100061852 Ga0068854_1000618523 231
206 3300005616 Ga0068852_100104534 Ga0068852_1001045342 231
207 3300005618 Ga0068864_100272298 Ga0068864_1002722982 231
208 3300005718 Ga0068866_10264243 Ga0068866_102642432 231
209 3300005719 Ga0068861_100388683 Ga0068861_1003886831 231
210 3300005840 Ga0068870_10419541 Ga0068870_104195411 231
211 3300005843 Ga0068860_100848564 Ga0068860_1008485642 231
212 3300006048 Ga0075363_100000145 Ga0075363_1000001455 231
213 3300006048 Ga0075363_100112468 Ga0075363_1001124682 231
214 3300006051 Ga0075364_10048249 Ga0075364_100482492 231
215 3300006177 Ga0075362_10053283 Ga0075362_100532832 231
216 3300006178 Ga0075367_10002249 Ga0075367_1000224911 231
217 3300006178 Ga0075367_10040639 Ga0075367_100406392 231
218 3300006195 Ga0075366_10000582 Ga0075366_100005829 231
219 3300006195 Ga0075366_10018221 Ga0075366_100182214 231
220 3300006195 Ga0075366_10042975 Ga0075366_100429753 231
221 3300006195 Ga0075366_10151287 Ga0075366_101512872 231
222 3300006237 Ga0097621_100048632 Ga0097621_1000486323 231
223 3300006237 Ga0097621_100884546 Ga0097621_1008845462 231
224 3300006353 Ga0075370_10000854 Ga0075370_100008543 231
225 3300006353 Ga0075370_10008475 Ga0075370_100084757 231
226 3300006353 Ga0075370_10036759 Ga0075370_100367591 231
227 3300006358 Ga0068871_100059839 Ga0068871_1000598393 231
228 3300006881 Ga0068865_100053358 Ga0068865_1000533581 231
229 3300014325 Ga0163163_10687341 Ga0163163_106873411 231
230 3300014969 Ga0157376_10053709 Ga0157376_100537094 231
231 3300017792 Ga0163161_10012105 Ga0163161_100121054 231
232 3300025315 Ga0207697_10004600 Ga0207697_100046006 231
233 3300025893 Ga0207682_10009338 Ga0207682_100093382 231
234 3300025893 Ga0207682_10028565 Ga0207682_100285652 231
235 3300025903 Ga0207680_10192070 Ga0207680_101920702 231
236 3300025910 Ga0207684_10008021 Ga0207684_100080218 231
237 3300025923 Ga0207681_10008769 Ga0207681_100087694 231
238 3300025925 Ga0207650_10000275 Ga0207650_1000027552 231
239 3300025926 Ga0207659_10003305 Ga0207659_100033054 231
240 3300025931 Ga0207644_10005477 Ga0207644_100054779 231
241 3300025933 Ga0207706_10071939 Ga0207706_100719394 231
242 3300025933 Ga0207706_10199236 Ga0207706_101992362 231
243 3300025937 Ga0207669_10004036 Ga0207669_100040364 231
244 3300025938 Ga0207704_10042029 Ga0207704_100420291 231
245 3300025940 Ga0207691_10001335 Ga0207691_1000133527 231
246 3300025945 Ga0207679_10405584 Ga0207679_104055842 231
247 3300025960 Ga0207651_10248154 Ga0207651_102481542 231
248 3300025972 Ga0207668_10241999 Ga0207668_102419991 231
249 3300025981 Ga0207640_10033092 Ga0207640_100330922 231
250 3300025986 Ga0207658_10181785 Ga0207658_101817852 231
251 3300026089 Ga0207648_10007993 Ga0207648_1000799310 231
252 3300026089 Ga0207648_10358994 Ga0207648_103589942 231
253 3300026095 Ga0207676_10120816 Ga0207676_101208162 231
254 3300026116 Ga0207674_10454511 Ga0207674_104545112 231
255 3300026121 Ga0207683_10011844 Ga0207683_100118445 231
256 3300028786 Ga0307517_10141299 Ga0307517_101412992 231
257 3300031456 Ga0307513_10010837 Ga0307513_100108376 231
258 3300031456 Ga0307513_10109819 Ga0307513_101098192 231
259 3300031456 Ga0307513_10338479 Ga0307513_103384792 231
260 3300031507 Ga0307509_10000405 Ga0307509_1000040571 231
261 3300031649 Ga0307514_10051154 Ga0307514_100511542 231
262 3300031730 Ga0307516_10104215 Ga0307516_101042153 231
263 3300033180 Ga0307510_10003419 Ga0307510_1000341914 231
264 3300033180 Ga0307510_10033328 Ga0307510_100333282 231
265 3300033180 Ga0307510_10038258 Ga0307510_100382583 231
266 3300037471 Ga0395905_0409399 Ga0395905_0409399_285_980 231
267 3300042007 Ga0439449_0003349 Ga0439449_0003349_1178_1879 231
268 3300042015 Ga0439462_0013351 Ga0439462_0013351_1271_1972 231
269 3300046454 Ga0495592_0000528 Ga0495592_0000528_7962_8657 231
270 3300046512 Ga0495610_0019994 Ga0495610_0019994_2966_3661 231
271 3300046519 Ga0495632_0004766 Ga0495632_0004766_500_1195 231
272 3300046542 Ga0495597_0159045 Ga0495597_0159045_38_733 231
273 3300046616 Ga0495668_0123625 Ga0495668_0123625_249_944 231
274 3300046660 Ga0495625_0011949 Ga0495625_0011949_1339_2034 231
275 3300046694 Ga0495649_0015516 Ga0495649_0015516_1961_2656 231
276 3300046810 Ga0495660_0007345 Ga0495660_0007345_5627_6322 231
277 3300047443 Ga0495687_004859 Ga0495687_004859_6188_6883 231
278 3300048091 Ga0495626_0042463 Ga0495626_0042463_421_1116 231
279 3300050489 nmdc:mga03683_2693_c1 nmdc:mga03683_2693_c1_1704_2399 231
280 3300050489 nmdc:mga03683_29768_c1 nmdc:mga03683_29768_c1_717_1412 231
281 3300050491 nmdc:mga00v17_131641_c1 nmdc:mga00v17_131641_c1_794_1489 231
282 3300050493 nmdc:mga0k408_11041_c1 nmdc:mga0k408_11041_c1_4176_4871 231
283 3300050493 nmdc:mga0k408_1412_c1 nmdc:mga0k408_1412_c1_6939_7634 231
284 3300050493 nmdc:mga0k408_1975_c1 nmdc:mga0k408_1975_c1_2301_2996 231
285 3300050493 nmdc:mga0k408_2145_c1 nmdc:mga0k408_2145_c1_1996_2691 231
286 3300050493 nmdc:mga0k408_47485_c1 nmdc:mga0k408_47485_c1_752_1447 231
287 3300050494 nmdc:mga06z11_3034_c1 nmdc:mga06z11_3034_c1_252_947 231
288 3300050496 nmdc:mga07m45_1136_c1 nmdc:mga07m45_1136_c1_4781_5476 231
289 3300050496 nmdc:mga07m45_1876_c1 nmdc:mga07m45_1876_c1_166_861 231
290 3300053088 Ga0500644_0007104 Ga0500644_0007104_919_1614 231
291 3300053093 Ga0500651_0009118 Ga0500651_0009118_1031_1726 231
292 3300053098 Ga0500650_0073215 Ga0500650_0073215_861_1556 231
293 3300053118 Ga0500594_0000734 Ga0500594_0000734_2958_3653 231
294 3300053134 Ga0500658_0002749 Ga0500658_0002749_5448_6143 231
295 3300053136 Ga0500559_0000265 Ga0500559_0000265_31455_32150 231
296 3300053139 Ga0500568_0011378 Ga0500568_0011378_1880_2575 231
297 3300053154 Ga0500619_010295 Ga0500619_010295_1386_2081 231
298 3300053156 Ga0500622_0004571 Ga0500622_0004571_7276_7971 231
299 3300005328 Ga0070676_10221069 Ga0070676_102210691 232
300 3300005353 Ga0070669_100405444 Ga0070669_1004054442 232
301 3300006353 Ga0075370_10068866 Ga0075370_100688662 232
302 iso_pu_bacteria 2511231002 2511244139 233
303 3300005289 Ga0065704_10365554 Ga0065704_103655541 234
304 3300005353 Ga0070669_100009870 Ga0070669_1000098707 234
305 3300006177 Ga0075362_10011743 Ga0075362_100117432 234
306 3300009147 Ga0114129_10369273 Ga0114129_103692733 234
307 3300013104 Ga0157370_10429675 Ga0157370_104296751 234
308 3300014497 Ga0182008_10001996 Ga0182008_100019967 234
309 3300017792 Ga0163161_10243392 Ga0163161_102433922 234
310 3300017792 Ga0163161_10267084 Ga0163161_102670842 234
311 3300025923 Ga0207681_10005629 Ga0207681_100056295 234
312 3300027614 Ga0209970_1000452 Ga0209970_100045211 234
313 3300027617 Ga0210002_1025500 Ga0210002_10255001 234
314 3300031456 Ga0307513_10000028 Ga0307513_100000289 234
315 3300031456 Ga0307513_10018553 Ga0307513_100185537 234
316 3300031649 Ga0307514_10000530 Ga0307514_1000053051 234
317 3300031730 Ga0307516_10020978 Ga0307516_100209783 234
318 3300031901 Ga0307406_10000604 Ga0307406_100006044 234
319 3300041404 Ga0439436_0000739 Ga0439436_0000739_2039_2743 234
320 3300041406 Ga0439439_0039459 Ga0439439_0039459_420_1151 234
321 3300041411 Ga0439466_0005624 Ga0439466_0005624_1398_2102 234
322 3300041413 Ga0439465_0002727 Ga0439465_0002727_4289_4993 234
323 3300041997 Ga0439431_0000511 Ga0439431_0000511_4609_5313 234
324 3300041999 Ga0439433_0004335 Ga0439433_0004335_489_1193 234
325 3300042004 Ga0439445_0001177 Ga0439445_0001177_2713_3417 234
326 3300042006 Ga0439432_001319 Ga0439432_001319_4472_5176 234
327 3300042006 Ga0439432_065954 Ga0439432_065954_357_1088 234
328 3300042007 Ga0439449_0000991 Ga0439449_0000991_3330_4034 234
329 3300042007 Ga0439449_0006224 Ga0439449_0006224_1844_2575 234
330 3300042010 Ga0439452_003019 Ga0439452_003019_4563_5267 234
331 3300042015 Ga0439462_0056499 Ga0439462_0056499_142_846 234
332 3300046453 Ga0495627_056720 Ga0495627_056720_355_1059 234
333 3300048925 Ga0496122_0002564 Ga0496122_0002564_13773_14477 234
334 3300048926 Ga0496123_0002427 Ga0496123_0002427_11052_11756 234
335 3300048927 Ga0496124_0160369 Ga0496124_0160369_154_858 234
336 3300048929 Ga0496126_0320173 Ga0496126_0320173_321_1025 234
337 3300053118 Ga0500594_0008561 Ga0500594_0008561_1427_2131 234
338 3300053136 Ga0500559_0003422 Ga0500559_0003422_5642_6346 234
339 3300053136 Ga0500559_0018940 Ga0500559_0018940_826_1545 234
340 3300053136 Ga0500559_0131724 Ga0500559_0131724_249_953 234
341 3300053156 Ga0500622_0154096 Ga0500622_0154096_187_906 234
342 3300053730 Ga0500645_004503 Ga0500645_004503_736_1446 236
343 3300002704 JGI25155J39150_1000031 JGI25155J39150_100003117 237
344 3300002705 JGI25156J39149_1000040 JGI25156J39149_1000040100 237
345 3300002738 JGI25154J39366_1000060 JGI25154J39366_100006018 237
346 3300002741 JGI25157J39369_1000058 JGI25157J39369_100005818 237
347 3300002987 JGI25159J45721_1000140 JGI25159J45721_10001407 237
348 3300002987 JGI25159J45721_1001846 JGI25159J45721_10018467 237
349 3300003187 JGI25151J46595_10003714 JGI25151J46595_100037148 237
350 3300003187 JGI25151J46595_10005843 JGI25151J46595_100058438 237
351 3300003354 JGI25160J50197_1000198 JGI25160J50197_100019854 237
352 3300003374 JGI25161J50226_1000021 JGI25161J50226_1000021157 237
353 3300003771 Ga0055526_1015450 Ga0055526_10154501 237
354 3300003771 Ga0055526_1015722 Ga0055526_10157223 237
355 3300003771 Ga0055526_1055789 Ga0055526_10557891 237
356 3300003773 Ga0055537_1000265 Ga0055537_100026539 237
357 3300003775 Ga0055524_1000338 Ga0055524_100033817 237
358 3300003781 Ga0055536_1004503 Ga0055536_10045037 237
359 3300003781 Ga0055536_1036375 Ga0055536_10363751 237
360 3300003784 Ga0055534_1000911 Ga0055534_100091110 237
361 3300003790 Ga0055528_1001693 Ga0055528_100169316 237
362 3300003791 Ga0055530_10000509 Ga0055530_1000050931 237
363 3300003792 Ga0055540_1000274 Ga0055540_100027444 237
364 3300003794 Ga0055531_10003742 Ga0055531_1000374210 237
365 3300004625 Ga0055543_1000238 Ga0055543_100023837 237
366 3300005262 Ga0065165_1007398 Ga0065165_10073983 237
367 3300005262 Ga0065165_1008359 Ga0065165_10083593 237
368 3300005539 Ga0068853_100348093 Ga0068853_1003480932 237
369 3300005578 Ga0068854_100134601 Ga0068854_1001346012 237
370 3300006048 Ga0075363_100140224 Ga0075363_1001402242 237
371 3300006353 Ga0075370_10174071 Ga0075370_101740712 237
372 3300006946 Ga0079104_1005464 Ga0079104_10054643 237
373 3300025206 Ga0209435_100019 Ga0209435_10001918 237
374 3300025208 Ga0209436_115500 Ga0209436_1155002 237
375 3300025246 Ga0209646_1000038 Ga0209646_100003818 237
376 3300025250 Ga0209026_1000048 Ga0209026_100004818 237
377 3300025256 Ga0209759_1000038 Ga0209759_1000038226 237
378 3300025258 Ga0209129_1004774 Ga0209129_10047743 237
379 3300025258 Ga0209129_1017475 Ga0209129_10174751 237
380 3300025263 Ga0209565_1000309 Ga0209565_100030942 237
381 3300025263 Ga0209565_1001566 Ga0209565_10015668 237
382 3300025273 Ga0209673_1000088 Ga0209673_1000088189 237
383 3300025284 Ga0209130_1000103 Ga0209130_10001037 237
384 3300025284 Ga0209130_1000920 Ga0209130_10009207 237
385 3300025291 Ga0209675_1001254 Ga0209675_10012544 237
386 3300025292 Ga0209676_1001499 Ga0209676_100149912 237
387 3300025292 Ga0209676_1002299 Ga0209676_10022999 237
388 3300025294 Ga0209025_1003677 Ga0209025_100367710 237
389 3300025294 Ga0209025_1004241 Ga0209025_10042418 237
390 3300025294 Ga0209025_1014316 Ga0209025_10143163 237
391 3300025295 Ga0209564_1000702 Ga0209564_10007028 237
392 3300025295 Ga0209564_1003145 Ga0209564_10031457 237
393 3300025295 Ga0209564_1050431 Ga0209564_10504311 237
394 3300025298 Ga0209050_1000008 Ga0209050_1000008772 237
395 3300025298 Ga0209050_1006914 Ga0209050_10069144 237
396 3300025299 Ga0209256_1000096 Ga0209256_100009618 237
397 3300025302 Ga0207426_1000586 Ga0207426_10005867 237
398 3300025302 Ga0207426_1004328 Ga0207426_10043283 237
399 3300025303 Ga0209051_1000005 Ga0209051_1000005772 237
400 3300025304 Ga0209257_1000031 Ga0209257_1000031362 237
401 3300025304 Ga0209257_1061111 Ga0209257_10611112 237
402 3300027907 Ga0207428_10227751 Ga0207428_102277511 237
403 3300031456 Ga0307513_10000568 Ga0307513_1000056852 237
404 3300031456 Ga0307513_10432371 Ga0307513_104323711 237
405 3300031548 Ga0307408_100010674 Ga0307408_1000106741 237
406 3300031901 Ga0307406_10037932 Ga0307406_100379321 237
407 3300031911 Ga0307412_10227212 Ga0307412_102272122 237
408 3300032002 Ga0307416_100744629 Ga0307416_1007446291 237
409 3300050493 nmdc:mga0k408_162597_c1 nmdc:mga0k408_162597_c1_241_954 237
410 3300053730 Ga0500645_000422 Ga0500645_000422_24697_25410 237
411 3300053730 Ga0500645_022008 Ga0500645_022008_1136_1849 237
412 3300055283 Ga0500661_009009 Ga0500661_009009_588_1349 237

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13852

DUF4197

Protein of unknown function (DUF4197)

29

217

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wlw-assembly1.cif.gz_2 the vo region of human v-atpase in state 1 (focused refinement) 0.3695 41 209
6xby-assembly1.cif.gz_g cryo-em structure of v-atpase from bovine brain, state 2 0.3648 41 212
6pe4-assembly1.cif.gz_H yeast vo motor in complex with 1 vopq molecule 0.3644 42 216
7uzf-assembly1.cif.gz_n rat kidney v-atpase with sidk, state 1 0.3613 42 212
6wm4-assembly1.cif.gz_2 human v-atpase in state 3 with sidk and adp 0.3508 45 212
ID Description Score Start End Superfamily
af_Q9LJR0_1_144_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.3799 41 167 1.20.120.550
af_P06728_180_332_1.20.120.20 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Apolipoprotein 0.3797 42 170 1.20.120.20
af_P0AA93_45_200_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.3671 96 226 1.10.1760.20
af_Q9LJR0_1_144_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.3399 41 167 1.20.120.550
af_P06728_180_332_1.20.120.20 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Apolipoprotein 0.3324 42 170 1.20.120.20
ID Description Score Start End GO Terms
AF-A0A7S1HGS7-F1-model_v4 Uncharacterized protein 0.9794 48 153
AF-A0A315AIV8-F1-model_v4 DUF4197 domain-containing protein 0.979 33 237
AF-A0A656K504-F1-model_v4 Tail tape measure protein 0.9722 45 165
AF-A0A3B8HIQ7-F1-model_v4 DUF4197 domain-containing protein 0.9659 33 236
AF-A0A656K504-F1-model_v4 Tail tape measure protein 0.9568 45 165

Feature Viewer

pLDDT pTM Quality
74.92 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map