F437747

General Info

Members Datasets Scaffolds Average Seq Length
412 179 412 246

Family's Representative Sequence

Representative Sequence 3300005546|Ga0070696_100059205|Ga0070696_1000592052
Length 298
Sequence MSAKRENSKLPTSARLRRVAGGGARGPSKSLDRCQTSSLTLLSRALLPSKKMQVMQTDLISAELRNRFEHARRVVVLTGAGISAESGVPTFRGGGNTAVWKGMPFDVISSARMLERDLPAVWEWFDYRRSLLQSLKPNPAHNELARWADLFPEFTLVTQNVDGLHQAAGSRDVIELHGSVWRARCVSCRTSYEIVPHERRLDNCHGCGAWLRPDVVLFGEMLPPGAFELAAEAAAGCQLCFVVGTSALVYPAASIPEIAKAAGAYVCEVNPERTPLSAICDEVLTGKAGEVLPLIGKS

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
145 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
146 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
155 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
156 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
157 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
159 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
160 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
161 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
162 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
163 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
164 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
165 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
166 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
167 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
168 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
169 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
170 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
171 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
172 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
173 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
174 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
177 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
178 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
179 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.18
Rhizosphere 97.57
Stem 0
Stem Tuber 0
Unclassified 0.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10025526 3300003203 Bacteria 2293
2 Ga0065704_10015995 3300005289 Bacteria 2620
3 Ga0065704_10037954 3300005289 Unclassified 1150
4 Ga0065704_10173498 3300005289 Bacteria 1262
5 Ga0065712_10074984 3300005290 Bacteria 3963
6 Ga0065712_10165176 3300005290 Bacteria 1277
7 Ga0065715_10001878 3300005293 Bacteria 5462
8 Ga0065715_10100983 3300005293 Unclassified 3249
9 Ga0065715_10106500 3300005293 Bacteria 2826
10 Ga0065715_10213843 3300005293 Unclassified 1302
11 Ga0065715_10411343 3300005293 Unclassified 869
12 Ga0065707_10115935 3300005295 Bacteria 2252
13 Ga0065707_10380088 3300005295 Unclassified 878
14 Ga0070676_10342885 3300005328 Bacteria 1025
15 Ga0070690_100000910 3300005330 Bacteria 15087
16 Ga0070690_100055454 3300005330 Bacteria 2538
17 Ga0070690_100158848 3300005330 Bacteria 1547
18 Ga0070690_100238591 3300005330 Bacteria 1281
19 Ga0070670_100131238 3300005331 Bacteria 2163
20 Ga0070670_100157069 3300005331 Bacteria 1970
21 Ga0070670_100238656 3300005331 Bacteria 1583
22 Ga0068869_100067582 3300005334 Bacteria 2637
23 Ga0068869_100099974 3300005334 Bacteria 2193
24 Ga0068869_100125175 3300005334 Bacteria 1970
25 Ga0068869_100338667 3300005334 Bacteria 1224
26 Ga0068869_100346635 3300005334 Bacteria 1210
27 Ga0070666_10064155 3300005335 Unclassified 2491
28 Ga0070666_10204759 3300005335 Bacteria 1388
29 Ga0070680_100004835 3300005336 Bacteria 10143
30 Ga0070682_100003732 3300005337 Bacteria 8470
31 Ga0068868_100398262 3300005338 Unclassified 1187
32 Ga0070689_100048244 3300005340 Unclassified 3284
33 Ga0070689_100120113 3300005340 Unclassified 2098
34 Ga0070687_100460968 3300005343 Bacteria 847
35 Ga0070661_100177034 3300005344 Bacteria 1621
36 Ga0070692_10013079 3300005345 Bacteria 3862
37 Ga0070692_10127834 3300005345 Bacteria 1425
38 Ga0070669_100029657 3300005353 Bacteria 3944
39 Ga0070669_100224308 3300005353 Unclassified 1487
40 Ga0070669_100270447 3300005353 Bacteria 1359
41 Ga0070669_100357993 3300005353 Bacteria 1186
42 Ga0070675_100090777 3300005354 Bacteria 2559
43 Ga0070675_100204079 3300005354 Bacteria 1716
44 Ga0070675_100463602 3300005354 Unclassified 1138
45 Ga0070671_100005420 3300005355 Bacteria 10177
46 Ga0070671_100145512 3300005355 Bacteria 2000
47 Ga0070671_100180946 3300005355 Unclassified 1784
48 Ga0070671_100255201 3300005355 Bacteria 1490
49 Ga0070673_100023695 3300005364 Unclassified 4488
50 Ga0070673_100034869 3300005364 Bacteria 3812
51 Ga0070673_100084088 3300005364 Bacteria 2587
52 Ga0070673_100096882 3300005364 Bacteria 2421
53 Ga0070673_100243956 3300005364 Unclassified 1563
54 Ga0070673_100405518 3300005364 Bacteria 1220
55 Ga0070667_100043067 3300005367 Bacteria 3788
56 Ga0070667_100129664 3300005367 Unclassified 2200
57 Ga0070667_100371709 3300005367 Unclassified 1297
58 Ga0070703_10000091 3300005406 Bacteria 45812
59 Ga0070703_10104312 3300005406 Unclassified 1004
60 Ga0070705_100066762 3300005440 Unclassified 2158
61 Ga0070705_100089064 3300005440 Bacteria 1917
62 Ga0070700_100001208 3300005441 Bacteria 12794
63 Ga0070700_100091212 3300005441 Unclassified 1989
64 Ga0070694_100000775 3300005444 Bacteria 17866
65 Ga0070694_100037664 3300005444 Unclassified 3208
66 Ga0070694_100183954 3300005444 Unclassified 1547
67 Ga0070694_100283346 3300005444 Bacteria 1264
68 Ga0070694_100309378 3300005444 Bacteria 1213
69 Ga0070708_100000002 3300005445 Bacteria 195857
70 Ga0070708_100614202 3300005445 Unclassified 1025
71 Ga0070662_100227982 3300005457 Unclassified 1489
72 Ga0070662_100722852 3300005457 Bacteria 843
73 Ga0070681_10000041 3300005458 Bacteria 89178
74 Ga0070681_10279507 3300005458 Bacteria 1580
75 Ga0068867_100040042 3300005459 Bacteria 3418
76 Ga0068867_100227480 3300005459 Bacteria 1506
77 Ga0068867_100239747 3300005459 Bacteria 1470
78 Ga0068867_100247565 3300005459 Bacteria 1448
79 Ga0070685_10074941 3300005466 Unclassified 2015
80 Ga0070706_100000002 3300005467 Bacteria 326510
81 Ga0070706_100014192 3300005467 Bacteria 7360
82 Ga0070706_100014630 3300005467 Bacteria 7250
83 Ga0070706_100107798 3300005467 Bacteria 2591
84 Ga0070706_100147831 3300005467 Bacteria 2194
85 Ga0070707_100000167 3300005468 Bacteria 63391
86 Ga0070707_100028879 3300005468 Bacteria 5278
87 Ga0070707_100037352 3300005468 Bacteria 4635
88 Ga0070707_100104793 3300005468 Bacteria 2742
89 Ga0070698_100010410 3300005471 Bacteria 9933
90 Ga0070698_100031228 3300005471 Bacteria 5522
91 Ga0070698_100140138 3300005471 Bacteria 2370
92 Ga0070698_100176403 3300005471 Bacteria 2076
93 Ga0070699_100000483 3300005518 Bacteria 37967
94 Ga0070699_100146152 3300005518 Bacteria 2089
95 Ga0070699_100223283 3300005518 Unclassified 1679
96 Ga0070699_100445323 3300005518 Bacteria 1174
97 Ga0070699_100550824 3300005518 Bacteria 1050
98 Ga0070679_100000074 3300005530 Bacteria 74890
99 Ga0070679_100101107 3300005530 Bacteria 2870
100 Ga0070697_100000071 3300005536 Bacteria 80945
101 Ga0070697_100002337 3300005536 Bacteria 14587
102 Ga0070697_100458971 3300005536 Bacteria 1110
103 Ga0068853_100040387 3300005539 Bacteria 3981
104 Ga0068853_100174619 3300005539 Unclassified 1946
105 Ga0070672_100016898 3300005543 Bacteria 5236
106 Ga0070672_100254007 3300005543 Unclassified 1481
107 Ga0070686_100010966 3300005544 Bacteria 5130
108 Ga0070686_100038038 3300005544 Bacteria 2989
109 Ga0070686_100141649 3300005544 Bacteria 1674
110 Ga0070695_100110857 3300005545 Unclassified 1862
111 Ga0070695_100264904 3300005545 Bacteria 1256
112 Ga0070695_100275060 3300005545 Bacteria 1235
113 Ga0070696_100059205 3300005546 Unclassified 2676
114 Ga0070696_100341050 3300005546 Bacteria 1158
115 Ga0070665_100035078 3300005548 Bacteria 5045
116 Ga0070704_100014347 3300005549 Bacteria 4948
117 Ga0070704_100156852 3300005549 Unclassified 1796
118 Ga0070704_100270772 3300005549 Bacteria 1403
119 Ga0070664_100040417 3300005564 Unclassified 3932
120 Ga0070664_100487139 3300005564 Bacteria 1135
121 Ga0068856_100021307 3300005614 Bacteria 6299
122 Ga0070702_100002032 3300005615 Bacteria 8549
123 Ga0070702_100021565 3300005615 Bacteria 3391
124 Ga0070702_100281421 3300005615 Unclassified 1142
125 Ga0070702_100311023 3300005615 Unclassified 1094
126 Ga0068852_100045633 3300005616 Bacteria 3729
127 Ga0068852_100272595 3300005616 Unclassified 1629
128 Ga0068852_100560578 3300005616 Bacteria 1144
129 Ga0068859_100026769 3300005617 Bacteria 5785
130 Ga0068859_100035305 3300005617 Bacteria 5017
131 Ga0068859_100139991 3300005617 Bacteria 2493
132 Ga0068859_100190026 3300005617 Bacteria 2138
133 Ga0068859_100212643 3300005617 Bacteria 2020
134 Ga0068859_101217994 3300005617 Unclassified 829
135 Ga0068864_100082234 3300005618 Bacteria 2825
136 Ga0068864_100168193 3300005618 Bacteria 1997
137 Ga0068861_100000717 3300005719 Bacteria 19814
138 Ga0068861_100230331 3300005719 Bacteria 1571
139 Ga0068870_10006280 3300005840 Bacteria 5234
140 Ga0068870_10204209 3300005840 Bacteria 1200
141 Ga0068863_100076413 3300005841 Bacteria 3168
142 Ga0068863_100077692 3300005841 Unclassified 3142
143 Ga0068863_100245515 3300005841 Bacteria 1729
144 Ga0068863_100526850 3300005841 Bacteria 1165
145 Ga0068863_100824428 3300005841 Unclassified 926
146 Ga0068858_100018070 3300005842 Bacteria 6604
147 Ga0068858_100203555 3300005842 Unclassified 1872
148 Ga0068858_100383646 3300005842 Bacteria 1349
149 Ga0068860_100009528 3300005843 Bacteria 9645
150 Ga0068860_100061934 3300005843 Bacteria 3555
151 Ga0068860_100100367 3300005843 Bacteria 2761
152 Ga0068860_100153446 3300005843 Bacteria 2219
153 Ga0068860_100990157 3300005843 Unclassified 858
154 Ga0068862_100012832 3300005844 Bacteria 6930
155 Ga0068862_100646771 3300005844 Bacteria 1019
156 Ga0081539_10006502 3300005985 Bacteria 11175
157 Ga0081539_10074553 3300005985 Unclassified 1807
158 Ga0070716_100000017 3300006173 Bacteria 88957
159 Ga0070716_100231297 3300006173 Unclassified 1248
160 Ga0097621_100001570 3300006237 Bacteria 15609
161 Ga0097621_100020452 3300006237 Bacteria 5100
162 Ga0097621_100027025 3300006237 Bacteria 4509
163 Ga0097621_100398653 3300006237 Unclassified 1231
164 Ga0097621_100421138 3300006237 Unclassified 1198
165 Ga0068871_100001715 3300006358 Bacteria 14742
166 Ga0068871_100026364 3300006358 Bacteria 4534
167 Ga0068871_100118988 3300006358 Bacteria 2229
168 Ga0075428_100080672 3300006844 Bacteria 3551
169 Ga0075433_10044562 3300006852 Bacteria 3855
170 Ga0075433_10057663 3300006852 Bacteria 3395
171 Ga0075433_10066587 3300006852 Bacteria 3161
172 Ga0075433_10077649 3300006852 Bacteria 2925
173 Ga0075433_10773361 3300006852 Unclassified 840
174 Ga0075434_100191549 3300006871 Bacteria 2065
175 Ga0075429_100056012 3300006880 Bacteria 3432
176 Ga0068865_100070452 3300006881 Bacteria 2477
177 Ga0097620_100026768 3300006931 Bacteria 5785
178 Ga0097620_100028708 3300006931 Bacteria 5579
179 Ga0097620_100035305 3300006931 Bacteria 5017
180 Ga0097620_100139995 3300006931 Bacteria 2493
181 Ga0097620_100190036 3300006931 Bacteria 2138
182 Ga0097620_100212661 3300006931 Bacteria 2020
183 Ga0097620_101217762 3300006931 Unclassified 829
184 Ga0075435_100540786 3300007076 Unclassified 1008
185 Ga0111539_10094906 3300009094 Bacteria 3505
186 Ga0111539_10413707 3300009094 Bacteria 1570
187 Ga0105245_10066024 3300009098 Bacteria 3273
188 Ga0105245_10521369 3300009098 Bacteria 1207
189 Ga0114129_10028648 3300009147 Bacteria 7891
190 Ga0114129_10034623 3300009147 Bacteria 7134
191 Ga0114129_10043671 3300009147 Bacteria 6306
192 Ga0114129_10104694 3300009147 Bacteria 3910
193 Ga0114129_10115289 3300009147 Bacteria 3704
194 Ga0114129_10435212 3300009147 Bacteria 1723
195 Ga0105243_10000084 3300009148 Bacteria 106821
196 Ga0105243_10000207 3300009148 Bacteria 68914
197 Ga0105243_10016117 3300009148 Bacteria 5653
198 Ga0105243_10323305 3300009148 Bacteria 1407
199 Ga0105243_10348322 3300009148 Bacteria 1359
200 Ga0105241_10038444 3300009174 Bacteria 3607
201 Ga0105241_10047908 3300009174 Bacteria 3251
202 Ga0105241_10179129 3300009174 Bacteria 1757
203 Ga0105241_10296497 3300009174 Bacteria 1386
204 Ga0105241_10753273 3300009174 Unclassified 893
205 Ga0105241_10777080 3300009174 Unclassified 880
206 Ga0105242_10000229 3300009176 Bacteria 44171
207 Ga0105242_10005822 3300009176 Bacteria 9493
208 Ga0105242_10031790 3300009176 Bacteria 4218
209 Ga0105248_10013500 3300009177 Bacteria 8993
210 Ga0105248_10231901 3300009177 Bacteria 2078
211 Ga0105237_10004944 3300009545 Bacteria 15226
212 Ga0105237_10292902 3300009545 Unclassified 1630
213 Ga0105238_10009968 3300009551 Bacteria 9527
214 Ga0105238_10505455 3300009551 Unclassified 1210
215 Ga0105249_10132306 3300009553 Bacteria 2383
216 Ga0105249_10238014 3300009553 Bacteria 1798
217 Ga0105249_10297233 3300009553 Bacteria 1618
218 Ga0105239_10097937 3300010375 Unclassified 3242
219 Ga0105239_10133378 3300010375 Unclassified 2764
220 Ga0105246_10098101 3300011119 Archaea 2128
221 Ga0105246_10121417 3300011119 Bacteria 1937
222 Ga0105246_10736811 3300011119 Unclassified 868
223 Ga0157371_10149705 3300013102 Bacteria 1664
224 Ga0157374_10521145 3300013296 Bacteria 1194
225 Ga0157378_10000191 3300013297 Bacteria 59071
226 Ga0157378_10019827 3300013297 Bacteria 5912
227 Ga0157378_10028766 3300013297 Unclassified 4907
228 Ga0157378_10039741 3300013297 Bacteria 4173
229 Ga0157378_10069502 3300013297 Bacteria 3159
230 Ga0157378_10098060 3300013297 Bacteria 2672
231 Ga0157378_10302144 3300013297 Unclassified 1549
232 Ga0163162_10010566 3300013306 Bacteria 8980
233 Ga0163162_10558158 3300013306 Unclassified 1273
234 Ga0163162_10613560 3300013306 Unclassified 1213
235 Ga0157372_10051102 3300013307 Bacteria 4599
236 Ga0157372_10115468 3300013307 Bacteria 3078
237 Ga0157375_10055796 3300013308 Bacteria 3897
238 Ga0157375_10063517 3300013308 Bacteria 3673
239 Ga0157375_10159532 3300013308 Unclassified 2397
240 Ga0157375_10164367 3300013308 Bacteria 2363
241 Ga0157375_10412315 3300013308 Bacteria 1517
242 Ga0163163_10004533 3300014325 Bacteria 11860
243 Ga0163163_10018608 3300014325 Bacteria 6507
244 Ga0163163_10033567 3300014325 Bacteria 4966
245 Ga0163163_10188348 3300014325 Bacteria 2111
246 Ga0163163_10291727 3300014325 Bacteria 1683
247 Ga0163163_10337945 3300014325 Bacteria 1561
248 Ga0157380_10000627 3300014326 Bacteria 21695
249 Ga0157380_10018222 3300014326 Bacteria 5210
250 Ga0157380_10279068 3300014326 Bacteria 1528
251 Ga0157376_10010271 3300014969 Bacteria 6837
252 Ga0157376_10344355 3300014969 Unclassified 1424
253 Ga0163161_10087952 3300017792 Bacteria 2296
254 Ga0207653_10000034 3300025885 Bacteria 103130
255 Ga0207642_10007742 3300025899 Bacteria 3641
256 Ga0207642_10093972 3300025899 Unclassified 1489
257 Ga0207680_10172386 3300025903 Bacteria 1458
258 Ga0207680_10430172 3300025903 Unclassified 935
259 Ga0207647_10198683 3300025904 Bacteria 1160
260 Ga0207643_10001259 3300025908 Bacteria 14841
261 Ga0207684_10000076 3300025910 Bacteria 183107
262 Ga0207684_10008995 3300025910 Bacteria 8856
263 Ga0207684_10019056 3300025910 Bacteria 5870
264 Ga0207684_10105820 3300025910 Bacteria 2406
265 Ga0207654_10027614 3300025911 Bacteria 3086
266 Ga0207707_10000077 3300025912 Bacteria 100255
267 Ga0207707_10286076 3300025912 Bacteria 1427
268 Ga0207707_10472768 3300025912 Bacteria 1071
269 Ga0207671_10013064 3300025914 Bacteria 6637
270 Ga0207671_10223752 3300025914 Bacteria 1475
271 Ga0207660_10030701 3300025917 Bacteria 3695
272 Ga0207662_10005115 3300025918 Bacteria 6959
273 Ga0207662_10435309 3300025918 Bacteria 895
274 Ga0207652_10000096 3300025921 Bacteria 96047
275 Ga0207646_10001426 3300025922 Bacteria 29683
276 Ga0207646_10032515 3300025922 Bacteria 4721
277 Ga0207681_10057227 3300025923 Bacteria 2663
278 Ga0207681_10111449 3300025923 Unclassified 1991
279 Ga0207694_10060029 3300025924 Unclassified 2959
280 Ga0207650_10108710 3300025925 Unclassified 2144
281 Ga0207650_10139513 3300025925 Bacteria 1905
282 Ga0207659_10076311 3300025926 Bacteria 2463
283 Ga0207644_10008281 3300025931 Bacteria 6814
284 Ga0207644_10030706 3300025931 Unclassified 3739
285 Ga0207644_10243728 3300025931 Unclassified 1432
286 Ga0207706_10261223 3300025933 Unclassified 1512
287 Ga0207706_10643551 3300025933 Bacteria 908
288 Ga0207686_10000015 3300025934 Bacteria 202118
289 Ga0207686_10013469 3300025934 Bacteria 4527
290 Ga0207686_10078463 3300025934 Unclassified 2147
291 Ga0207709_10000043 3300025935 Bacteria 248179
292 Ga0207709_10001111 3300025935 Bacteria 19708
293 Ga0207709_10145940 3300025935 Bacteria 1632
294 Ga0207670_10002603 3300025936 Bacteria 9489
295 Ga0207670_10063772 3300025936 Unclassified 2522
296 Ga0207670_10191728 3300025936 Bacteria 1547
297 Ga0207669_10047450 3300025937 Bacteria 2545
298 Ga0207665_10000033 3300025939 Bacteria 89014
299 Ga0207691_10009258 3300025940 Bacteria 9451
300 Ga0207711_10065350 3300025941 Bacteria 3145
301 Ga0207711_10106493 3300025941 Bacteria 2488
302 Ga0207689_10010604 3300025942 Bacteria 7935
303 Ga0207689_10033078 3300025942 Bacteria 4297
304 Ga0207689_10072620 3300025942 Bacteria 2827
305 Ga0207689_10131866 3300025942 Bacteria 2057
306 Ga0207689_10301783 3300025942 Bacteria 1327
307 Ga0207651_10082039 3300025960 Bacteria 2326
308 Ga0207651_10263008 3300025960 Bacteria 1417
309 Ga0207651_10290559 3300025960 Bacteria 1355
310 Ga0207651_10311738 3300025960 Bacteria 1312
311 Ga0207712_10541735 3300025961 Bacteria 1000
312 Ga0207658_10104064 3300025986 Unclassified 2230
313 Ga0207677_10246850 3300026023 Bacteria 1447
314 Ga0207703_10057402 3300026035 Bacteria 3174
315 Ga0207703_10595821 3300026035 Bacteria 1045
316 Ga0207639_10050240 3300026041 Bacteria 3166
317 Ga0207639_10115454 3300026041 Bacteria 2196
318 Ga0207708_10013730 3300026075 Bacteria 6052
319 Ga0207708_10092185 3300026075 Unclassified 2337
320 Ga0207708_10117420 3300026075 Unclassified 2070
321 Ga0207702_10311530 3300026078 Bacteria 1497
322 Ga0207641_10030664 3300026088 Unclassified 4455
323 Ga0207641_10066824 3300026088 Bacteria 3078
324 Ga0207641_10512498 3300026088 Unclassified 1166
325 Ga0207648_10305483 3300026089 Bacteria 1427
326 Ga0207676_10002249 3300026095 Bacteria 13870
327 Ga0207676_10020829 3300026095 Bacteria 4803
328 Ga0207676_10024669 3300026095 Bacteria 4454
329 Ga0207676_10043492 3300026095 Bacteria 3459
330 Ga0207676_10183473 3300026095 Bacteria 1834
331 Ga0207674_10000525 3300026116 Bacteria 50323
332 Ga0207674_10394240 3300026116 Unclassified 1338
333 Ga0207674_10528931 3300026116 Bacteria 1139
334 Ga0207675_100013305 3300026118 Bacteria 7680
335 Ga0207675_100062426 3300026118 Bacteria 3480
336 Ga0207675_100069828 3300026118 Bacteria 3283
337 Ga0207698_10086185 3300026142 Bacteria 2553
338 Ga0207698_10254452 3300026142 Unclassified 1609
339 Ga0207698_10343664 3300026142 Bacteria 1406
340 Ga0268266_10159904 3300028379 Bacteria 2037
341 Ga0268265_10046087 3300028380 Bacteria 3257
342 Ga0268265_10128138 3300028380 Bacteria 2104
343 Ga0268265_10147298 3300028380 Bacteria 1980
344 Ga0268265_10258982 3300028380 Unclassified 1545
345 Ga0268265_10554302 3300028380 Bacteria 1092
346 Ga0268264_10031094 3300028381 Unclassified 4377
347 Ga0268264_10125049 3300028381 Unclassified 2271
348 Ga0268264_10131433 3300028381 Bacteria 2220
349 Ga0268264_10245352 3300028381 Bacteria 1661
350 Ga0268264_10275572 3300028381 Unclassified 1573
351 Ga0268264_10321121 3300028381 Bacteria 1464
352 Ga0268264_10668743 3300028381 Bacteria 1029
353 Ga0316178_1123537 3300030735 Unclassified 1096
354 Ga0307408_100484189 3300031548 Bacteria 1080
355 Ga0307413_10051402 3300031824 Bacteria 2483
356 Ga0307413_10454674 3300031824 Bacteria 1017
357 Ga0307410_10290142 3300031852 Unclassified 1287
358 Ga0307414_10078350 3300032004 Unclassified 2409
359 Ga0307415_100358864 3300032126 Unclassified 1230
360 Ga0373937_0053197 3300036401 Bacteria 3714
361 Ga0395898_0614063 3300037466 Bacteria 1030
362 Ga0395901_0426192 3300038443 Bacteria 1360
363 Ga0436365_0013216 3300039437 Bacteria 44926
364 Ga0439464_0008531 3300042439 Bacteria 2686
365 Ga0495659_0087049 3300046664 Bacteria 1194
366 Ga0495636_0201851 3300047318 Bacteria 908
367 Ga0496102_0010879 3300048905 Bacteria 7833
368 Ga0496104_0064919 3300048907 Unclassified 3463
369 Ga0496104_0218744 3300048907 Unclassified 1817
370 Ga0496108_0029854 3300048911 Bacteria 4518
371 Ga0496108_0084989 3300048911 Bacteria 2686
372 Ga0496109_0396374 3300048912 Bacteria 1304
373 Ga0496110_0453523 3300048913 Bacteria 1169
374 Ga0496112_0138175 3300048915 Bacteria 2407
375 Ga0496113_0119077 3300048916 Unclassified 2063
376 Ga0501292_004842 3300049515 Bacteria 1858
377 Ga0501296_009206 3300049519 Bacteria 1155
378 Ga0501298_005914 3300049521 Unclassified 1984
379 Ga0501298_011914 3300049521 Unclassified 1517
380 Ga0501038_0103942 3300049574 Bacteria 2361
381 Ga0501077_0401005 3300049593 Unclassified 877
382 Ga0501202_025759 3300049652 Bacteria 1200
383 Ga0501209_005472 3300049656 Unclassified 2294
384 Ga0501216_005381 3300049660 Bacteria 1928
385 Ga0501233_007862 3300049668 Bacteria 2041
386 Ga0501235_031762 3300049669 Bacteria 1193
387 Ga0501236_035132 3300049670 Unclassified 810
388 Ga0501243_033009 3300049675 Unclassified 889
389 Ga0501249_031664 3300049679 Unclassified 1181
390 Ga0501225_0015486 3300049705 Unclassified 2122
391 Ga0501234_005328 3300049707 Unclassified 2013
392 Ga0501079_0515567 3300049741 Unclassified 940
393 Ga0501273_006455 3300049770 Unclassified 1357
394 Ga0501283_001185 3300049779 Bacteria 3441
395 Ga0501212_025541 3300049851 Unclassified 933
396 nmdc:mga05p37_13138_c1 3300050507 Bacteria 5198
397 nmdc:mga05p37_308564_c1 3300050507 Unclassified 1876
398 nmdc:mga05p37_311181_c1 3300050507 Bacteria 1867
399 nmdc:mga05p37_489347_c1 3300050507 Bacteria 1415
400 nmdc:mga06r32_543732_c1 3300050510 Bacteria 1136
401 nmdc:mga08y16_191907_c1 3300050511 Bacteria 2119
402 nmdc:mga08y16_491407_c1 3300050511 Bacteria 1248
403 nmdc:mga08y16_58163_c1 3300050511 Bacteria 4039
404 nmdc:mga0n895_425786_c1 3300050512 Bacteria 1341
405 nmdc:mga0rr50_477332_c1 3300050513 Bacteria 1059
406 nmdc:mga0rr50_493579_c1 3300050513 Bacteria 1040
407 nmdc:mga0a205_158709_c1 3300050515 Bacteria 2159
408 nmdc:mga0a205_196609_c1 3300050515 Bacteria 1907
409 nmdc:mga0a205_439551_c1 3300050515 Bacteria 1165
410 nmdc:mga0a205_508891_c1 3300050515 Unclassified 1061
411 nmdc:mga0a205_57613_c1 3300050515 Bacteria 3751
412 Ga0501084_0164073 3300054114 Bacteria 1875

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005468 Ga0070707_100028879 Ga0070707_1000288792 211
2 3300025910 Ga0207684_10008995 Ga0207684_100089953 211
3 3300025922 Ga0207646_10032515 Ga0207646_100325153 211
4 3300005841 Ga0068863_100077692 Ga0068863_1000776922 221
5 3300026088 Ga0207641_10030664 Ga0207641_100306642 221
6 3300046664 Ga0495659_0087049 Ga0495659_0087049_369_1106 234
7 3300005617 Ga0068859_100035305 Ga0068859_1000353054 237
8 3300005844 Ga0068862_100646771 Ga0068862_1006467711 237
9 3300006880 Ga0075429_100056012 Ga0075429_1000560121 237
10 3300006931 Ga0097620_100035305 Ga0097620_1000353052 237
11 3300009094 Ga0111539_10094906 Ga0111539_100949063 237
12 3300009148 Ga0105243_10000084 Ga0105243_1000008462 237
13 3300009176 Ga0105242_10000229 Ga0105242_1000022924 237
14 3300025934 Ga0207686_10000015 Ga0207686_10000015150 237
15 3300025935 Ga0207709_10000043 Ga0207709_1000004373 237
16 3300028380 Ga0268265_10128138 Ga0268265_101281381 237
17 3300028381 Ga0268264_10245352 Ga0268264_102453522 237
18 3300005293 Ga0065715_10001878 Ga0065715_100018782 238
19 3300005331 Ga0070670_100131238 Ga0070670_1001312382 238
20 3300005337 Ga0070682_100003732 Ga0070682_1000037328 238
21 3300005353 Ga0070669_100224308 Ga0070669_1002243081 238
22 3300005354 Ga0070675_100204079 Ga0070675_1002040792 238
23 3300005364 Ga0070673_100405518 Ga0070673_1004055182 238
24 3300005440 Ga0070705_100066762 Ga0070705_1000667622 238
25 3300005441 Ga0070700_100091212 Ga0070700_1000912122 238
26 3300005444 Ga0070694_100183954 Ga0070694_1001839541 238
27 3300005458 Ga0070681_10279507 Ga0070681_102795072 238
28 3300005459 Ga0068867_100239747 Ga0068867_1002397472 238
29 3300005467 Ga0070706_100000002 Ga0070706_100000002161 238
30 3300005539 Ga0068853_100174619 Ga0068853_1001746192 238
31 3300005545 Ga0070695_100110857 Ga0070695_1001108572 238
32 3300005546 Ga0070696_100341050 Ga0070696_1003410501 238
33 3300005615 Ga0070702_100002032 Ga0070702_1000020329 238
34 3300005615 Ga0070702_100281421 Ga0070702_1002814211 238
35 3300005615 Ga0070702_100311023 Ga0070702_1003110232 238
36 3300005616 Ga0068852_100272595 Ga0068852_1002725952 238
37 3300005616 Ga0068852_100560578 Ga0068852_1005605781 238
38 3300005617 Ga0068859_100139991 Ga0068859_1001399912 238
39 3300005617 Ga0068859_101217994 Ga0068859_1012179941 238
40 3300005618 Ga0068864_100082234 Ga0068864_1000822342 238
41 3300005618 Ga0068864_100168193 Ga0068864_1001681932 238
42 3300005840 Ga0068870_10006280 Ga0068870_100062804 238
43 3300005840 Ga0068870_10204209 Ga0068870_102042092 238
44 3300005841 Ga0068863_100245515 Ga0068863_1002455152 238
45 3300005841 Ga0068863_100526850 Ga0068863_1005268502 238
46 3300005841 Ga0068863_100824428 Ga0068863_1008244282 238
47 3300005842 Ga0068858_100018070 Ga0068858_1000180706 238
48 3300005843 Ga0068860_100061934 Ga0068860_1000619341 238
49 3300005985 Ga0081539_10074553 Ga0081539_100745532 238
50 3300006237 Ga0097621_100027025 Ga0097621_1000270254 238
51 3300006237 Ga0097621_100421138 Ga0097621_1004211382 238
52 3300006358 Ga0068871_100001715 Ga0068871_10000171511 238
53 3300006852 Ga0075433_10077649 Ga0075433_100776492 238
54 3300006931 Ga0097620_100028708 Ga0097620_1000287085 238
55 3300006931 Ga0097620_100139995 Ga0097620_1001399952 238
56 3300006931 Ga0097620_101217762 Ga0097620_1012177621 238
57 3300009147 Ga0114129_10435212 Ga0114129_104352122 238
58 3300009148 Ga0105243_10348322 Ga0105243_103483222 238
59 3300009174 Ga0105241_10179129 Ga0105241_101791292 238
60 3300009174 Ga0105241_10777080 Ga0105241_107770801 238
61 3300009545 Ga0105237_10004944 Ga0105237_100049445 238
62 3300009545 Ga0105237_10292902 Ga0105237_102929022 238
63 3300009551 Ga0105238_10009968 Ga0105238_100099682 238
64 3300011119 Ga0105246_10098101 Ga0105246_100981012 238
65 3300011119 Ga0105246_10121417 Ga0105246_101214172 238
66 3300013307 Ga0157372_10051102 Ga0157372_100511021 238
67 3300013308 Ga0157375_10412315 Ga0157375_104123151 238
68 3300014325 Ga0163163_10033567 Ga0163163_100335672 238
69 3300014325 Ga0163163_10337945 Ga0163163_103379452 238
70 3300014326 Ga0157380_10279068 Ga0157380_102790682 238
71 3300014969 Ga0157376_10344355 Ga0157376_103443551 238
72 3300025904 Ga0207647_10198683 Ga0207647_101986831 238
73 3300025908 Ga0207643_10001259 Ga0207643_100012592 238
74 3300025910 Ga0207684_10000076 Ga0207684_1000007656 238
75 3300025912 Ga0207707_10286076 Ga0207707_102860762 238
76 3300025914 Ga0207671_10013064 Ga0207671_100130644 238
77 3300025923 Ga0207681_10111449 Ga0207681_101114492 238
78 3300025924 Ga0207694_10060029 Ga0207694_100600293 238
79 3300025925 Ga0207650_10139513 Ga0207650_101395132 238
80 3300025926 Ga0207659_10076311 Ga0207659_100763113 238
81 3300025936 Ga0207670_10002603 Ga0207670_100026038 238
82 3300025942 Ga0207689_10301783 Ga0207689_103017832 238
83 3300026035 Ga0207703_10595821 Ga0207703_105958211 238
84 3300026041 Ga0207639_10050240 Ga0207639_100502402 238
85 3300026075 Ga0207708_10092185 Ga0207708_100921852 238
86 3300026075 Ga0207708_10117420 Ga0207708_101174202 238
87 3300026095 Ga0207676_10002249 Ga0207676_1000224911 238
88 3300026095 Ga0207676_10043492 Ga0207676_100434923 238
89 3300026116 Ga0207674_10528931 Ga0207674_105289312 238
90 3300026142 Ga0207698_10254452 Ga0207698_102544522 238
91 3300026142 Ga0207698_10343664 Ga0207698_103436641 238
92 3300028380 Ga0268265_10554302 Ga0268265_105543021 238
93 3300028381 Ga0268264_10125049 Ga0268264_101250492 238
94 3300028381 Ga0268264_10321121 Ga0268264_103211212 238
95 3300030735 Ga0316178_1123537 Ga0316178_11235372 238
96 3300032126 Ga0307415_100358864 Ga0307415_1003588642 238
97 3300037466 Ga0395898_0614063 Ga0395898_0614063_179_901 238
98 3300048916 Ga0496113_0119077 Ga0496113_0119077_1217_1939 238
99 3300049521 Ga0501298_011914 Ga0501298_011914_272_994 238
100 3300049656 Ga0501209_005472 Ga0501209_005472_801_1523 238
101 3300049660 Ga0501216_005381 Ga0501216_005381_722_1456 238
102 3300049668 Ga0501233_007862 Ga0501233_007862_202_936 238
103 3300049670 Ga0501236_035132 Ga0501236_035132_56_778 238
104 3300049675 Ga0501243_033009 Ga0501243_033009_60_782 238
105 3300049679 Ga0501249_031664 Ga0501249_031664_264_986 238
106 3300049707 Ga0501234_005328 Ga0501234_005328_1146_1868 238
107 3300049770 Ga0501273_006455 Ga0501273_006455_125_847 238
108 3300050507 nmdc:mga05p37_489347_c1 nmdc:mga05p37_489347_c1_14_736 238
109 3300050510 nmdc:mga06r32_543732_c1 nmdc:mga06r32_543732_c1_193_915 238
110 3300050511 nmdc:mga08y16_58163_c1 nmdc:mga08y16_58163_c1_230_964 238
111 3300050512 nmdc:mga0n895_425786_c1 nmdc:mga0n895_425786_c1_23_745 238
112 3300050513 nmdc:mga0rr50_477332_c1 nmdc:mga0rr50_477332_c1_249_971 238
113 3300050515 nmdc:mga0a205_158709_c1 nmdc:mga0a205_158709_c1_450_1172 238
114 3300050515 nmdc:mga0a205_57613_c1 nmdc:mga0a205_57613_c1_1174_1896 238
115 3300005444 Ga0070694_100000775 Ga0070694_1000007758 239
116 3300005468 Ga0070707_100000167 Ga0070707_10000016710 239
117 3300005549 Ga0070704_100014347 Ga0070704_1000143472 239
118 3300005843 Ga0068860_100990157 Ga0068860_1009901571 239
119 3300025922 Ga0207646_10001426 Ga0207646_100014262 239
120 3300026035 Ga0207703_10057402 Ga0207703_100574023 239
121 3300028381 Ga0268264_10275572 Ga0268264_102755721 239
122 3300009147 Ga0114129_10043671 Ga0114129_100436715 240
123 3300009177 Ga0105248_10231901 Ga0105248_102319012 240
124 3300026088 Ga0207641_10512498 Ga0207641_105124982 240
125 3300050507 nmdc:mga05p37_13138_c1 nmdc:mga05p37_13138_c1_559_1281 240
126 3300005289 Ga0065704_10015995 Ga0065704_100159952 241
127 3300005293 Ga0065715_10100983 Ga0065715_101009832 241
128 3300005295 Ga0065707_10115935 Ga0065707_101159351 241
129 3300005331 Ga0070670_100238656 Ga0070670_1002386562 241
130 3300005334 Ga0068869_100125175 Ga0068869_1001251752 241
131 3300005334 Ga0068869_100338667 Ga0068869_1003386672 241
132 3300005344 Ga0070661_100177034 Ga0070661_1001770342 241
133 3300005354 Ga0070675_100463602 Ga0070675_1004636022 241
134 3300005467 Ga0070706_100014192 Ga0070706_1000141925 241
135 3300005530 Ga0070679_100101107 Ga0070679_1001011073 241
136 3300009148 Ga0105243_10323305 Ga0105243_103233053 241
137 3300009174 Ga0105241_10753273 Ga0105241_107532731 241
138 3300014325 Ga0163163_10018608 Ga0163163_100186085 241
139 3300014325 Ga0163163_10188348 Ga0163163_101883482 241
140 3300025912 Ga0207707_10472768 Ga0207707_104727681 241
141 3300031824 Ga0307413_10454674 Ga0307413_104546741 241
142 3300005289 Ga0065704_10173498 Ga0065704_101734982 242
143 3300005328 Ga0070676_10342885 Ga0070676_103428852 242
144 3300005330 Ga0070690_100158848 Ga0070690_1001588482 242
145 3300005345 Ga0070692_10013079 Ga0070692_100130794 242
146 3300005353 Ga0070669_100029657 Ga0070669_1000296573 242
147 3300005544 Ga0070686_100010966 Ga0070686_1000109663 242
148 3300005549 Ga0070704_100270772 Ga0070704_1002707722 242
149 3300005617 Ga0068859_100190026 Ga0068859_1001900262 242
150 3300005844 Ga0068862_100012832 Ga0068862_1000128326 242
151 3300006931 Ga0097620_100190036 Ga0097620_1001900362 242
152 3300009094 Ga0111539_10413707 Ga0111539_104137073 242
153 3300009553 Ga0105249_10297233 Ga0105249_102972332 242
154 3300013297 Ga0157378_10019827 Ga0157378_100198272 242
155 3300013297 Ga0157378_10039741 Ga0157378_100397414 242
156 3300013306 Ga0163162_10613560 Ga0163162_106135602 242
157 3300013308 Ga0157375_10055796 Ga0157375_100557964 242
158 3300014326 Ga0157380_10018222 Ga0157380_100182222 242
159 3300017792 Ga0163161_10087952 Ga0163161_100879522 242
160 3300025923 Ga0207681_10057227 Ga0207681_100572271 242
161 3300025961 Ga0207712_10541735 Ga0207712_105417351 242
162 3300026075 Ga0207708_10013730 Ga0207708_100137305 242
163 3300026118 Ga0207675_100062426 Ga0207675_1000624263 242
164 3300028380 Ga0268265_10147298 Ga0268265_101472983 242
165 3300028381 Ga0268264_10668743 Ga0268264_106687432 242
166 3300050511 nmdc:mga08y16_191907_c1 nmdc:mga08y16_191907_c1_531_1274 242
167 3300050511 nmdc:mga08y16_491407_c1 nmdc:mga08y16_491407_c1_272_1021 242
168 3300005364 Ga0070673_100084088 Ga0070673_1000840882 243
169 3300003203 JGI25406J46586_10025526 JGI25406J46586_100255261 244
170 3300005289 Ga0065704_10037954 Ga0065704_100379541 244
171 3300005290 Ga0065712_10074984 Ga0065712_100749843 244
172 3300005290 Ga0065712_10165176 Ga0065712_101651761 244
173 3300005293 Ga0065715_10106500 Ga0065715_101065002 244
174 3300005293 Ga0065715_10213843 Ga0065715_102138431 244
175 3300005293 Ga0065715_10411343 Ga0065715_104113431 244
176 3300005295 Ga0065707_10380088 Ga0065707_103800881 244
177 3300005330 Ga0070690_100000910 Ga0070690_1000009102 244
178 3300005330 Ga0070690_100055454 Ga0070690_1000554542 244
179 3300005330 Ga0070690_100238591 Ga0070690_1002385912 244
180 3300005331 Ga0070670_100157069 Ga0070670_1001570692 244
181 3300005334 Ga0068869_100067582 Ga0068869_1000675823 244
182 3300005334 Ga0068869_100099974 Ga0068869_1000999741 244
183 3300005334 Ga0068869_100346635 Ga0068869_1003466351 244
184 3300005335 Ga0070666_10064155 Ga0070666_100641552 244
185 3300005335 Ga0070666_10204759 Ga0070666_102047592 244
186 3300005336 Ga0070680_100004835 Ga0070680_1000048351 244
187 3300005338 Ga0068868_100398262 Ga0068868_1003982621 244
188 3300005340 Ga0070689_100048244 Ga0070689_1000482441 244
189 3300005340 Ga0070689_100120113 Ga0070689_1001201131 244
190 3300005343 Ga0070687_100460968 Ga0070687_1004609681 244
191 3300005345 Ga0070692_10127834 Ga0070692_101278342 244
192 3300005353 Ga0070669_100270447 Ga0070669_1002704472 244
193 3300005353 Ga0070669_100357993 Ga0070669_1003579931 244
194 3300005354 Ga0070675_100090777 Ga0070675_1000907772 244
195 3300005355 Ga0070671_100005420 Ga0070671_1000054202 244
196 3300005355 Ga0070671_100145512 Ga0070671_1001455122 244
197 3300005355 Ga0070671_100180946 Ga0070671_1001809462 244
198 3300005355 Ga0070671_100255201 Ga0070671_1002552011 244
199 3300005364 Ga0070673_100023695 Ga0070673_1000236954 244
200 3300005364 Ga0070673_100034869 Ga0070673_1000348692 244
201 3300005364 Ga0070673_100096882 Ga0070673_1000968822 244
202 3300005364 Ga0070673_100243956 Ga0070673_1002439562 244
203 3300005367 Ga0070667_100043067 Ga0070667_1000430671 244
204 3300005367 Ga0070667_100129664 Ga0070667_1001296642 244
205 3300005367 Ga0070667_100371709 Ga0070667_1003717092 244
206 3300005406 Ga0070703_10000091 Ga0070703_1000009110 244
207 3300005406 Ga0070703_10104312 Ga0070703_101043122 244
208 3300005440 Ga0070705_100089064 Ga0070705_1000890642 244
209 3300005441 Ga0070700_100001208 Ga0070700_1000012087 244
210 3300005444 Ga0070694_100037664 Ga0070694_1000376644 244
211 3300005444 Ga0070694_100283346 Ga0070694_1002833461 244
212 3300005444 Ga0070694_100309378 Ga0070694_1003093781 244
213 3300005445 Ga0070708_100000002 Ga0070708_100000002117 244
214 3300005445 Ga0070708_100614202 Ga0070708_1006142021 244
215 3300005457 Ga0070662_100227982 Ga0070662_1002279822 244
216 3300005457 Ga0070662_100722852 Ga0070662_1007228521 244
217 3300005458 Ga0070681_10000041 Ga0070681_1000004140 244
218 3300005459 Ga0068867_100040042 Ga0068867_1000400422 244
219 3300005459 Ga0068867_100227480 Ga0068867_1002274801 244
220 3300005459 Ga0068867_100247565 Ga0068867_1002475652 244
221 3300005466 Ga0070685_10074941 Ga0070685_100749411 244
222 3300005467 Ga0070706_100014630 Ga0070706_1000146305 244
223 3300005467 Ga0070706_100107798 Ga0070706_1001077983 244
224 3300005467 Ga0070706_100147831 Ga0070706_1001478312 244
225 3300005468 Ga0070707_100037352 Ga0070707_1000373525 244
226 3300005468 Ga0070707_100104793 Ga0070707_1001047933 244
227 3300005471 Ga0070698_100010410 Ga0070698_1000104103 244
228 3300005471 Ga0070698_100031228 Ga0070698_1000312282 244
229 3300005471 Ga0070698_100140138 Ga0070698_1001401382 244
230 3300005471 Ga0070698_100176403 Ga0070698_1001764032 244
231 3300005518 Ga0070699_100000483 Ga0070699_10000048313 244
232 3300005518 Ga0070699_100146152 Ga0070699_1001461521 244
233 3300005518 Ga0070699_100223283 Ga0070699_1002232832 244
234 3300005518 Ga0070699_100445323 Ga0070699_1004453231 244
235 3300005518 Ga0070699_100550824 Ga0070699_1005508241 244
236 3300005530 Ga0070679_100000074 Ga0070679_10000007457 244
237 3300005536 Ga0070697_100000071 Ga0070697_10000007117 244
238 3300005536 Ga0070697_100002337 Ga0070697_10000233711 244
239 3300005536 Ga0070697_100458971 Ga0070697_1004589712 244
240 3300005539 Ga0068853_100040387 Ga0068853_1000403873 244
241 3300005543 Ga0070672_100016898 Ga0070672_1000168982 244
242 3300005543 Ga0070672_100254007 Ga0070672_1002540071 244
243 3300005544 Ga0070686_100038038 Ga0070686_1000380381 244
244 3300005544 Ga0070686_100141649 Ga0070686_1001416492 244
245 3300005545 Ga0070695_100264904 Ga0070695_1002649041 244
246 3300005545 Ga0070695_100275060 Ga0070695_1002750601 244
247 3300005546 Ga0070696_100059205 Ga0070696_1000592052 244
248 3300005548 Ga0070665_100035078 Ga0070665_1000350781 244
249 3300005549 Ga0070704_100156852 Ga0070704_1001568522 244
250 3300005564 Ga0070664_100040417 Ga0070664_1000404174 244
251 3300005564 Ga0070664_100487139 Ga0070664_1004871392 244
252 3300005614 Ga0068856_100021307 Ga0068856_1000213075 244
253 3300005615 Ga0070702_100021565 Ga0070702_1000215652 244
254 3300005616 Ga0068852_100045633 Ga0068852_1000456332 244
255 3300005617 Ga0068859_100026769 Ga0068859_1000267692 244
256 3300005617 Ga0068859_100212643 Ga0068859_1002126432 244
257 3300005719 Ga0068861_100000717 Ga0068861_10000071710 244
258 3300005719 Ga0068861_100230331 Ga0068861_1002303312 244
259 3300005841 Ga0068863_100076413 Ga0068863_1000764132 244
260 3300005842 Ga0068858_100203555 Ga0068858_1002035552 244
261 3300005842 Ga0068858_100383646 Ga0068858_1003836462 244
262 3300005843 Ga0068860_100009528 Ga0068860_1000095284 244
263 3300005843 Ga0068860_100100367 Ga0068860_1001003672 244
264 3300005843 Ga0068860_100153446 Ga0068860_1001534462 244
265 3300005985 Ga0081539_10006502 Ga0081539_100065028 244
266 3300006173 Ga0070716_100000017 Ga0070716_10000001749 244
267 3300006173 Ga0070716_100231297 Ga0070716_1002312972 244
268 3300006237 Ga0097621_100001570 Ga0097621_1000015706 244
269 3300006237 Ga0097621_100020452 Ga0097621_1000204524 244
270 3300006237 Ga0097621_100398653 Ga0097621_1003986532 244
271 3300006358 Ga0068871_100026364 Ga0068871_1000263642 244
272 3300006358 Ga0068871_100118988 Ga0068871_1001189882 244
273 3300006844 Ga0075428_100080672 Ga0075428_1000806723 244
274 3300006852 Ga0075433_10044562 Ga0075433_100445622 244
275 3300006852 Ga0075433_10057663 Ga0075433_100576633 244
276 3300006852 Ga0075433_10066587 Ga0075433_100665872 244
277 3300006852 Ga0075433_10773361 Ga0075433_107733611 244
278 3300006871 Ga0075434_100191549 Ga0075434_1001915492 244
279 3300006881 Ga0068865_100070452 Ga0068865_1000704522 244
280 3300006931 Ga0097620_100026768 Ga0097620_1000267685 244
281 3300006931 Ga0097620_100212661 Ga0097620_1002126612 244
282 3300007076 Ga0075435_100540786 Ga0075435_1005407862 244
283 3300009098 Ga0105245_10066024 Ga0105245_100660242 244
284 3300009098 Ga0105245_10521369 Ga0105245_105213692 244
285 3300009147 Ga0114129_10028648 Ga0114129_100286482 244
286 3300009147 Ga0114129_10034623 Ga0114129_100346233 244
287 3300009147 Ga0114129_10104694 Ga0114129_101046942 244
288 3300009147 Ga0114129_10115289 Ga0114129_101152891 244
289 3300009148 Ga0105243_10000207 Ga0105243_1000020734 244
290 3300009148 Ga0105243_10016117 Ga0105243_100161174 244
291 3300009174 Ga0105241_10038444 Ga0105241_100384443 244
292 3300009174 Ga0105241_10047908 Ga0105241_100479083 244
293 3300009174 Ga0105241_10296497 Ga0105241_102964971 244
294 3300009176 Ga0105242_10005822 Ga0105242_100058228 244
295 3300009176 Ga0105242_10031790 Ga0105242_100317902 244
296 3300009177 Ga0105248_10013500 Ga0105248_100135008 244
297 3300009551 Ga0105238_10505455 Ga0105238_105054553 244
298 3300009553 Ga0105249_10132306 Ga0105249_101323062 244
299 3300009553 Ga0105249_10238014 Ga0105249_102380142 244
300 3300010375 Ga0105239_10097937 Ga0105239_100979372 244
301 3300010375 Ga0105239_10133378 Ga0105239_101333782 244
302 3300011119 Ga0105246_10736811 Ga0105246_107368111 244
303 3300013102 Ga0157371_10149705 Ga0157371_101497051 244
304 3300013296 Ga0157374_10521145 Ga0157374_105211452 244
305 3300013297 Ga0157378_10000191 Ga0157378_1000019113 244
306 3300013297 Ga0157378_10028766 Ga0157378_100287661 244
307 3300013297 Ga0157378_10069502 Ga0157378_100695022 244
308 3300013297 Ga0157378_10098060 Ga0157378_100980602 244
309 3300013297 Ga0157378_10302144 Ga0157378_103021442 244
310 3300013306 Ga0163162_10010566 Ga0163162_100105663 244
311 3300013306 Ga0163162_10558158 Ga0163162_105581581 244
312 3300013307 Ga0157372_10115468 Ga0157372_101154682 244
313 3300013308 Ga0157375_10063517 Ga0157375_100635173 244
314 3300013308 Ga0157375_10159532 Ga0157375_101595322 244
315 3300013308 Ga0157375_10164367 Ga0157375_101643672 244
316 3300014325 Ga0163163_10004533 Ga0163163_1000453310 244
317 3300014325 Ga0163163_10291727 Ga0163163_102917272 244
318 3300014326 Ga0157380_10000627 Ga0157380_1000062711 244
319 3300014969 Ga0157376_10010271 Ga0157376_100102712 244
320 3300025885 Ga0207653_10000034 Ga0207653_1000003457 244
321 3300025899 Ga0207642_10007742 Ga0207642_100077422 244
322 3300025899 Ga0207642_10093972 Ga0207642_100939721 244
323 3300025903 Ga0207680_10172386 Ga0207680_101723862 244
324 3300025903 Ga0207680_10430172 Ga0207680_104301721 244
325 3300025910 Ga0207684_10019056 Ga0207684_100190564 244
326 3300025910 Ga0207684_10105820 Ga0207684_101058203 244
327 3300025911 Ga0207654_10027614 Ga0207654_100276143 244
328 3300025912 Ga0207707_10000077 Ga0207707_1000007748 244
329 3300025914 Ga0207671_10223752 Ga0207671_102237521 244
330 3300025917 Ga0207660_10030701 Ga0207660_100307014 244
331 3300025918 Ga0207662_10005115 Ga0207662_100051153 244
332 3300025918 Ga0207662_10435309 Ga0207662_104353091 244
333 3300025921 Ga0207652_10000096 Ga0207652_1000009646 244
334 3300025925 Ga0207650_10108710 Ga0207650_101087102 244
335 3300025931 Ga0207644_10008281 Ga0207644_100082813 244
336 3300025931 Ga0207644_10030706 Ga0207644_100307063 244
337 3300025931 Ga0207644_10243728 Ga0207644_102437282 244
338 3300025933 Ga0207706_10261223 Ga0207706_102612232 244
339 3300025933 Ga0207706_10643551 Ga0207706_106435511 244
340 3300025934 Ga0207686_10013469 Ga0207686_100134692 244
341 3300025934 Ga0207686_10078463 Ga0207686_100784633 244
342 3300025935 Ga0207709_10001111 Ga0207709_1000111111 244
343 3300025935 Ga0207709_10145940 Ga0207709_101459402 244
344 3300025936 Ga0207670_10063772 Ga0207670_100637722 244
345 3300025936 Ga0207670_10191728 Ga0207670_101917282 244
346 3300025937 Ga0207669_10047450 Ga0207669_100474502 244
347 3300025939 Ga0207665_10000033 Ga0207665_1000003349 244
348 3300025940 Ga0207691_10009258 Ga0207691_100092582 244
349 3300025941 Ga0207711_10065350 Ga0207711_100653502 244
350 3300025941 Ga0207711_10106493 Ga0207711_101064932 244
351 3300025942 Ga0207689_10010604 Ga0207689_100106046 244
352 3300025942 Ga0207689_10033078 Ga0207689_100330782 244
353 3300025942 Ga0207689_10072620 Ga0207689_100726202 244
354 3300025942 Ga0207689_10131866 Ga0207689_101318662 244
355 3300025960 Ga0207651_10082039 Ga0207651_100820392 244
356 3300025960 Ga0207651_10263008 Ga0207651_102630082 244
357 3300025960 Ga0207651_10290559 Ga0207651_102905591 244
358 3300025960 Ga0207651_10311738 Ga0207651_103117382 244
359 3300025986 Ga0207658_10104064 Ga0207658_101040641 244
360 3300026023 Ga0207677_10246850 Ga0207677_102468501 244
361 3300026041 Ga0207639_10115454 Ga0207639_101154542 244
362 3300026078 Ga0207702_10311530 Ga0207702_103115302 244
363 3300026088 Ga0207641_10066824 Ga0207641_100668244 244
364 3300026089 Ga0207648_10305483 Ga0207648_103054832 244
365 3300026095 Ga0207676_10020829 Ga0207676_100208292 244
366 3300026095 Ga0207676_10024669 Ga0207676_100246692 244
367 3300026095 Ga0207676_10183473 Ga0207676_101834732 244
368 3300026116 Ga0207674_10000525 Ga0207674_100005252 244
369 3300026116 Ga0207674_10394240 Ga0207674_103942402 244
370 3300026118 Ga0207675_100013305 Ga0207675_1000133055 244
371 3300026118 Ga0207675_100069828 Ga0207675_1000698282 244
372 3300026142 Ga0207698_10086185 Ga0207698_100861852 244
373 3300028379 Ga0268266_10159904 Ga0268266_101599042 244
374 3300028380 Ga0268265_10046087 Ga0268265_100460873 244
375 3300028380 Ga0268265_10258982 Ga0268265_102589822 244
376 3300028381 Ga0268264_10031094 Ga0268264_100310944 244
377 3300028381 Ga0268264_10131433 Ga0268264_101314332 244
378 3300031548 Ga0307408_100484189 Ga0307408_1004841892 244
379 3300031824 Ga0307413_10051402 Ga0307413_100514022 244
380 3300031852 Ga0307410_10290142 Ga0307410_102901421 244
381 3300032004 Ga0307414_10078350 Ga0307414_100783502 244
382 3300036401 Ga0373937_0053197 Ga0373937_0053197_1342_2082 244
383 3300038443 Ga0395901_0426192 Ga0395901_0426192_192_953 244
384 3300039437 Ga0436365_0013216 Ga0436365_0013216_16245_17000 244
385 3300042439 Ga0439464_0008531 Ga0439464_0008531_1491_2240 244
386 3300047318 Ga0495636_0201851 Ga0495636_0201851_117_860 244
387 3300048905 Ga0496102_0010879 Ga0496102_0010879_3650_4390 244
388 3300048907 Ga0496104_0064919 Ga0496104_0064919_290_1030 244
389 3300048907 Ga0496104_0218744 Ga0496104_0218744_507_1241 244
390 3300048911 Ga0496108_0029854 Ga0496108_0029854_548_1282 244
391 3300048911 Ga0496108_0084989 Ga0496108_0084989_1296_2030 244
392 3300048912 Ga0496109_0396374 Ga0496109_0396374_278_1018 244
393 3300048913 Ga0496110_0453523 Ga0496110_0453523_168_902 244
394 3300048915 Ga0496112_0138175 Ga0496112_0138175_738_1472 244
395 3300049515 Ga0501292_004842 Ga0501292_004842_902_1636 244
396 3300049519 Ga0501296_009206 Ga0501296_009206_205_939 244
397 3300049521 Ga0501298_005914 Ga0501298_005914_501_1235 244
398 3300049574 Ga0501038_0103942 Ga0501038_0103942_73_876 244
399 3300049593 Ga0501077_0401005 Ga0501077_0401005_49_786 244
400 3300049652 Ga0501202_025759 Ga0501202_025759_314_1048 244
401 3300049669 Ga0501235_031762 Ga0501235_031762_205_939 244
402 3300049705 Ga0501225_0015486 Ga0501225_0015486_534_1268 244
403 3300049741 Ga0501079_0515567 Ga0501079_0515567_126_863 244
404 3300049779 Ga0501283_001185 Ga0501283_001185_255_989 244
405 3300049851 Ga0501212_025541 Ga0501212_025541_61_795 244
406 3300050507 nmdc:mga05p37_308564_c1 nmdc:mga05p37_308564_c1_780_1514 244
407 3300050507 nmdc:mga05p37_311181_c1 nmdc:mga05p37_311181_c1_146_886 244
408 3300050513 nmdc:mga0rr50_493579_c1 nmdc:mga0rr50_493579_c1_72_806 244
409 3300050515 nmdc:mga0a205_196609_c1 nmdc:mga0a205_196609_c1_1095_1835 244
410 3300050515 nmdc:mga0a205_439551_c1 nmdc:mga0a205_439551_c1_17_751 244
411 3300050515 nmdc:mga0a205_508891_c1 nmdc:mga0a205_508891_c1_148_882 244
412 3300054114 Ga0501084_0164073 Ga0501084_0164073_468_1220 244

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02146

SIR2

Sir2 family

79

251

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2b4y-assembly3.cif.gz_C crystal structure of human sirtuin homolog 5 0.8979 11 242
2b4y-assembly2.cif.gz_B crystal structure of human sirtuin homolog 5 0.8968 11 243
6rxr-assembly1.cif.gz_A crystal structure of cobb ac2 (a76g, i131c, v162g) in complex with h4k16cr-2'oh-adpr peptide intermediate after co-crystallisation 0.8951 21 243
1ici-assembly1.cif.gz_A crystal structure of a sir2 homolog-nad complex 0.8929 6 241
4uu7-assembly2.cif.gz_B crystal structure of zebrafish sirtuin 5 in complex with 3-methyl- succinylated cps1-peptide 0.8924 14 243
ID Description Score Start End Superfamily
1ma3A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9645 15 242 3.40.50.1220
4buzA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9582 11 242 3.40.50.1220
1iciA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9416 6 241 3.40.50.1220
1s5pA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9382 21 243 3.40.50.1220
af_A4IAM7_70_238_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.8978 86 243 3.40.50.1220
ID Description Score Start End GO Terms
AF-A0A7W1BYC6-F1-model_v4 NAD-dependent deacylase 0.9829 1 243 GO:0017136
GO:0046872
GO:0070403
AF-A0A7W1BYC6-F1-model_v4 NAD-dependent deacylase 0.975 1 243 GO:0017136
GO:0046872
GO:0070403
AF-A0A354C484-F1-model_v4 RNA polymerase subunit sigma 0.962 80 243 GO:0017136
GO:0070403
AF-A0A3M2D4U3-F1-model_v4 protein acetyllysine N-acetyltransferase (EC 2.3.1.286) 0.9596 8 243 GO:0017136
GO:0046872
GO:0070403
AF-G2LGP9-F1-model_v4 NAD-dependent protein deacetylase, SIR2 family (EC 3.5.1.-) 0.9578 14 242 GO:0016787
GO:0017136
GO:0070403

Feature Viewer

pLDDT pTM Quality
89.38 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map