F437746

General Info

Members Datasets Scaffolds Average Seq Length
412 271 824 135

Family's Representative Sequence

Representative Sequence 3300005545|Ga0070695_101803694|Ga0070695_1018036941
Length 132
Sequence VGVDLLDIEGLKELEHKGPIVMVNLMRFRDRSLDGDGSGWDAYLRYSALTVPMIKARGGTLLWTGNAKAVALGPDGNQWDYVALVYYPDVAAFIDMMTSADYENLSDPHRRNGCAEHVIIATAEAYSKFKVS

Samples

Sample ID Description Type Environment
1 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
135 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
136 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
137 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
142 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
143 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
144 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
145 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
146 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
147 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
148 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
149 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
153 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
154 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
156 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
157 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
158 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
159 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
160 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
161 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
162 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
165 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
174 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
175 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
176 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
177 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
178 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
179 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
180 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
181 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
184 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
185 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
186 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
187 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
188 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
189 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
190 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
191 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
192 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
193 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
194 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
195 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
196 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
197 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
198 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
199 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
200 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
201 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
202 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
203 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
204 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
205 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
206 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
207 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
208 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
209 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
210 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
211 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
212 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
213 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
214 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
215 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
216 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
217 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
218 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
228 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
233 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
234 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
235 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
236 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
237 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
238 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
239 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
240 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
241 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
242 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
243 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
244 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
245 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
246 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
247 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
248 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
249 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
250 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
251 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
252 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
253 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
254 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
255 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
256 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
257 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
258 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
259 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
260 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
261 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
262 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
263 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
264 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
265 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
266 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
267 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
268 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
269 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
270 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
271 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0
Isolates 0.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.89
Nodule 0.73
Rhizoplane 6.31
Rhizosphere 77.18
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070695_101803694 3300005545 Bacteria 513
2 JGI24742J22300_10092963 3300002244 Bacteria 578
3 JGI25406J46586_10000064 3300003203 Bacteria 49110
4 JGI25404J52841_10007209 3300003659 Bacteria 2346
5 JGI25404J52841_10012714 3300003659 Bacteria 1824
6 JGI25404J52841_10023864 3300003659 Bacteria 1319
7 JGI25404J52841_10035840 3300003659 Bacteria 1056
8 Ga0055542_1020864 3300003762 Bacteria 954
9 Ga0070683_102157528 3300005329 Bacteria 535
10 Ga0070670_100305506 3300005331 Bacteria 1392
11 Ga0068869_100258641 3300005334 Bacteria 1393
12 Ga0070680_100018190 3300005336 Bacteria 5551
13 Ga0070682_100208994 3300005337 Bacteria 1382
14 Ga0068868_100070970 3300005338 Bacteria 2777
15 Ga0068868_101283279 3300005338 Bacteria 680
16 Ga0070660_100020111 3300005339 Bacteria 4901
17 Ga0070660_100078349 3300005339 Bacteria 2591
18 Ga0070691_10388027 3300005341 Bacteria 784
19 Ga0070661_100524266 3300005344 Bacteria 951
20 Ga0070661_100816888 3300005344 Bacteria 766
21 Ga0070668_100823478 3300005347 Bacteria 826
22 Ga0070668_101580877 3300005347 Bacteria 600
23 Ga0070673_100563666 3300005364 Bacteria 1036
24 Ga0070673_101748461 3300005364 Bacteria 589
25 Ga0070659_100171965 3300005366 Bacteria 1775
26 Ga0070659_101087145 3300005366 Bacteria 704
27 Ga0070710_10263104 3300005437 Bacteria 1113
28 Ga0070711_100294698 3300005439 Bacteria 1288
29 Ga0070711_100454632 3300005439 Bacteria 1049
30 Ga0070711_100929160 3300005439 Bacteria 744
31 Ga0070708_100032198 3300005445 Bacteria 4545
32 Ga0070708_100234497 3300005445 Bacteria 1722
33 Ga0070663_100007227 3300005455 Bacteria 6749
34 Ga0070663_100823927 3300005455 Bacteria 797
35 Ga0070678_100582400 3300005456 Bacteria 997
36 Ga0070681_10100485 3300005458 Bacteria 2839
37 Ga0070681_10182532 3300005458 Bacteria 2019
38 Ga0070681_10481101 3300005458 Bacteria 1154
39 Ga0068867_101430734 3300005459 Bacteria 642
40 Ga0068867_101953409 3300005459 Bacteria 554
41 Ga0070685_10794031 3300005466 Bacteria 697
42 Ga0070706_100136160 3300005467 Bacteria 2293
43 Ga0070706_100417388 3300005467 Bacteria 1249
44 Ga0070707_100040211 3300005468 Bacteria 4474
45 Ga0070698_100443843 3300005471 Bacteria 1233
46 Ga0070699_100611622 3300005518 Bacteria 994
47 Ga0070679_100144623 3300005530 Bacteria 2356
48 Ga0070679_100504033 3300005530 Bacteria 1154
49 Ga0070684_100025731 3300005535 Bacteria 4948
50 Ga0070684_100187398 3300005535 Bacteria 1882
51 Ga0070684_100790146 3300005535 Bacteria 887
52 Ga0070697_100221982 3300005536 Bacteria 1611
53 Ga0068853_100011134 3300005539 Bacteria 7296
54 Ga0068853_100979180 3300005539 Bacteria 814
55 Ga0070672_100419764 3300005543 Bacteria 1149
56 Ga0070665_100211357 3300005548 Bacteria 1941
57 Ga0070665_100250285 3300005548 Bacteria 1773
58 Ga0070665_100336218 3300005548 Bacteria 1515
59 Ga0070665_100443184 3300005548 Bacteria 1308
60 Ga0070665_100748841 3300005548 Bacteria 990
61 Ga0068855_100376962 3300005563 Bacteria 1558
62 Ga0068855_100962683 3300005563 Bacteria 898
63 Ga0068857_100117001 3300005577 Bacteria 2398
64 Ga0068854_100171732 3300005578 Bacteria 1687
65 Ga0068854_100538117 3300005578 Bacteria 989
66 Ga0068854_100709430 3300005578 Bacteria 869
67 Ga0068856_100669877 3300005614 Bacteria 1058
68 Ga0068856_101020294 3300005614 Bacteria 845
69 Ga0070702_100341061 3300005615 Bacteria 1052
70 Ga0068852_100039300 3300005616 Bacteria 3983
71 Ga0068852_100164470 3300005616 Bacteria 2075
72 Ga0068852_102479964 3300005616 Bacteria 539
73 Ga0068864_100214723 3300005618 Bacteria 1773
74 Ga0068861_101212426 3300005719 Bacteria 730
75 Ga0068851_10003917 3300005834 Bacteria 6665
76 Ga0068851_10156765 3300005834 Bacteria 1248
77 Ga0068870_10145632 3300005840 Bacteria 1390
78 Ga0068858_100261826 3300005842 Bacteria 1644
79 Ga0081455_10006152 3300005937 Bacteria 12948
80 Ga0081455_10008216 3300005937 Bacteria 10883
81 Ga0081455_10034568 3300005937 Bacteria 4527
82 Ga0081455_10044929 3300005937 Bacteria 3848
83 Ga0081540_1001057 3300005983 Bacteria 24537
84 Ga0081540_1001355 3300005983 Bacteria 21285
85 Ga0081540_1005237 3300005983 Bacteria 9708
86 Ga0081540_1008112 3300005983 Bacteria 7373
87 Ga0081540_1013124 3300005983 Bacteria 5409
88 Ga0081540_1029651 3300005983 Bacteria 3044
89 Ga0081540_1043678 3300005983 Bacteria 2296
90 Ga0081540_1070257 3300005983 Bacteria 1623
91 Ga0081540_1315436 3300005983 Bacteria 536
92 Ga0081539_10000099 3300005985 Bacteria 201018
93 Ga0070717_10159239 3300006028 Bacteria 1958
94 Ga0075365_10442089 3300006038 Bacteria 918
95 Ga0075368_10112968 3300006042 Bacteria 1121
96 Ga0075368_10140678 3300006042 Bacteria 1005
97 Ga0075364_10259030 3300006051 Bacteria 1182
98 Ga0070716_101134779 3300006173 Bacteria 625
99 Ga0070712_100606197 3300006175 Bacteria 927
100 Ga0075367_10036546 3300006178 Bacteria 2849
101 Ga0075367_10451548 3300006178 Bacteria 815
102 Ga0075367_10554105 3300006178 Bacteria 730
103 Ga0075366_10010461 3300006195 Bacteria 5209
104 Ga0097621_100112589 3300006237 Bacteria 2301
105 Ga0075370_10965313 3300006353 Bacteria 522
106 Ga0068871_101309210 3300006358 Bacteria 682
107 Ga0068865_100111071 3300006881 Bacteria 2023
108 Ga0105240_10012518 3300009093 Bacteria 11703
109 Ga0105240_11682881 3300009093 Bacteria 663
110 Ga0105245_10033874 3300009098 Bacteria 4527
111 Ga0105247_10154797 3300009101 Bacteria 1513
112 Ga0114129_10551621 3300009147 Bacteria 1498
113 Ga0114129_11499072 3300009147 Bacteria 829
114 Ga0105243_11566764 3300009148 Bacteria 684
115 Ga0105241_10284521 3300009174 Bacteria 1413
116 Ga0105242_10551740 3300009176 Bacteria 1105
117 Ga0105242_11318597 3300009176 Bacteria 746
118 Ga0105242_12679331 3300009176 Bacteria 548
119 Ga0105248_10101432 3300009177 Bacteria 3244
120 Ga0105248_10467574 3300009177 Bacteria 1422
121 Ga0105237_10005704 3300009545 Bacteria 13994
122 Ga0105237_10050406 3300009545 Bacteria 4183
123 Ga0105237_11511397 3300009545 Bacteria 678
124 Ga0105237_12088702 3300009545 Bacteria 576
125 Ga0105238_10028935 3300009551 Bacteria 5643
126 Ga0105238_10380920 3300009551 Bacteria 1402
127 Ga0105238_12610826 3300009551 Bacteria 541
128 Ga0105239_10020716 3300010375 Bacteria 7254
129 Ga0105239_10212611 3300010375 Bacteria 2168
130 Ga0105239_10694125 3300010375 Bacteria 1164
131 Ga0105239_11710623 3300010375 Bacteria 728
132 Ga0105246_10055274 3300011119 Bacteria 2739
133 Ga0157370_10034448 3300013104 Bacteria 4931
134 Ga0157369_10008842 3300013105 Bacteria 11534
135 Ga0157374_10249155 3300013296 Bacteria 1748
136 Ga0157374_10922754 3300013296 Bacteria 891
137 Ga0157374_11336666 3300013296 Bacteria 739
138 Ga0157378_10361639 3300013297 Bacteria 1420
139 Ga0157378_10501676 3300013297 Bacteria 1212
140 Ga0163162_11169087 3300013306 Bacteria 873
141 Ga0163162_11405582 3300013306 Bacteria 794
142 Ga0157375_10008999 3300013308 Bacteria 8741
143 Ga0157375_12756203 3300013308 Bacteria 588
144 Ga0163163_10064907 3300014325 Bacteria 3623
145 Ga0157380_10523697 3300014326 Bacteria 1157
146 Ga0157380_13434646 3300014326 Bacteria 507
147 Ga0157377_10390624 3300014745 Bacteria 945
148 Ga0157379_10096506 3300014968 Bacteria 2653
149 Ga0157379_10199667 3300014968 Bacteria 1808
150 Ga0157376_10011109 3300014969 Bacteria 6623
151 Ga0157376_12286543 3300014969 Bacteria 580
152 Ga0163161_10301773 3300017792 Bacteria 1261
153 Ga0163161_11405749 3300017792 Bacteria 610
154 Ga0213876_10090634 3300021384 Bacteria 1619
155 Ga0213876_10625492 3300021384 Bacteria 573
156 Ga0209148_1000900 3300025254 Bacteria 20229
157 Ga0209455_1001425 3300025272 Bacteria 10837
158 Ga0209564_1026373 3300025295 Bacteria 1922
159 Ga0207697_10035855 3300025315 Bacteria 2031
160 Ga0207656_10004473 3300025321 Bacteria 4887
161 Ga0207656_10198244 3300025321 Bacteria 969
162 Ga0207680_10485724 3300025903 Bacteria 879
163 Ga0207685_10497502 3300025905 Bacteria 641
164 Ga0207643_10125986 3300025908 Bacteria 1521
165 Ga0207643_10248606 3300025908 Bacteria 1095
166 Ga0207705_10229816 3300025909 Bacteria 1411
167 Ga0207684_10180382 3300025910 Bacteria 1821
168 Ga0207654_10775013 3300025911 Bacteria 692
169 Ga0207707_10001679 3300025912 Bacteria 20395
170 Ga0207707_10109761 3300025912 Bacteria 2411
171 Ga0207707_10174959 3300025912 Bacteria 1875
172 Ga0207695_10033407 3300025913 Bacteria 5611
173 Ga0207695_11025653 3300025913 Bacteria 705
174 Ga0207671_10073678 3300025914 Bacteria 2551
175 Ga0207671_10201425 3300025914 Bacteria 1555
176 Ga0207693_10196116 3300025915 Bacteria 1588
177 Ga0207693_10545737 3300025915 Bacteria 904
178 Ga0207663_10083023 3300025916 Bacteria 2104
179 Ga0207663_10594805 3300025916 Bacteria 869
180 Ga0207660_10016947 3300025917 Bacteria 4834
181 Ga0207662_11086235 3300025918 Bacteria 569
182 Ga0207657_10157312 3300025919 Bacteria 1847
183 Ga0207649_10320866 3300025920 Bacteria 1138
184 Ga0207652_10001089 3300025921 Bacteria 24596
185 Ga0207652_10238774 3300025921 Bacteria 1638
186 Ga0207646_10017460 3300025922 Bacteria 6713
187 Ga0207694_10141291 3300025924 Bacteria 1936
188 Ga0207694_11004050 3300025924 Bacteria 706
189 Ga0207650_10385000 3300025925 Bacteria 1159
190 Ga0207687_10560714 3300025927 Bacteria 959
191 Ga0207690_10092768 3300025932 Bacteria 2138
192 Ga0207706_10331151 3300025933 Bacteria 1325
193 Ga0207686_11455362 3300025934 Bacteria 564
194 Ga0207670_10550220 3300025936 Bacteria 943
195 Ga0207669_10816650 3300025937 Bacteria 774
196 Ga0207669_10880454 3300025937 Bacteria 747
197 Ga0207704_10074920 3300025938 Bacteria 2162
198 Ga0207704_10212451 3300025938 Bacteria 1425
199 Ga0207691_10147684 3300025940 Bacteria 2068
200 Ga0207691_10915385 3300025940 Bacteria 734
201 Ga0207711_10355662 3300025941 Bacteria 1356
202 Ga0207679_10399965 3300025945 Bacteria 1208
203 Ga0207679_10495808 3300025945 Bacteria 1089
204 Ga0207667_10007349 3300025949 Bacteria 13260
205 Ga0207667_10345865 3300025949 Bacteria 1517
206 Ga0207651_10731027 3300025960 Bacteria 874
207 Ga0207651_10823871 3300025960 Bacteria 824
208 Ga0207668_11098790 3300025972 Bacteria 713
209 Ga0207640_10045852 3300025981 Bacteria 2810
210 Ga0207640_10486088 3300025981 Bacteria 1025
211 Ga0207640_10718894 3300025981 Bacteria 858
212 Ga0207640_10961823 3300025981 Bacteria 749
213 Ga0207703_10077670 3300026035 Bacteria 2757
214 Ga0207639_10020473 3300026041 Bacteria 4735
215 Ga0207639_10022260 3300026041 Bacteria 4564
216 Ga0207639_11204111 3300026041 Bacteria 711
217 Ga0207678_10003718 3300026067 Bacteria 13719
218 Ga0207678_10059734 3300026067 Bacteria 3281
219 Ga0207678_10779415 3300026067 Bacteria 844
220 Ga0207702_10000325 3300026078 Bacteria 54690
221 Ga0207702_10073776 3300026078 Bacteria 2943
222 Ga0207702_10903189 3300026078 Bacteria 875
223 Ga0207648_11219111 3300026089 Bacteria 707
224 Ga0207676_10214471 3300026095 Bacteria 1710
225 Ga0207676_10298860 3300026095 Bacteria 1469
226 Ga0207675_100157083 3300026118 Bacteria 2167
227 Ga0207683_10028366 3300026121 Bacteria 4840
228 Ga0207698_10047893 3300026142 Bacteria 3242
229 Ga0207698_10113866 3300026142 Bacteria 2274
230 Ga0209389_1000086 3300027296 Bacteria 84925
231 Ga0209589_1000027 3300027357 Bacteria 155295
232 Ga0209489_100313 3300027361 Bacteria 85507
233 Ga0209179_1003096 3300027512 Bacteria 2350
234 Ga0209813_10093504 3300027866 Bacteria 1013
235 Ga0268266_10351032 3300028379 Bacteria 1386
236 Ga0268266_10480778 3300028379 Bacteria 1184
237 Ga0268266_10571611 3300028379 Bacteria 1084
238 Ga0268266_10754919 3300028379 Bacteria 939
239 Ga0268265_10314602 3300028380 Bacteria 1415
240 Ga0265334_10080125 3300028573 Bacteria 1204
241 Ga0307515_10537694 3300028794 Bacteria 778
242 Ga0265328_10098283 3300031239 Bacteria 1083
243 Ga0265340_10008671 3300031247 Bacteria 5482
244 Ga0265339_10159592 3300031249 Bacteria 1135
245 Ga0265339_10470376 3300031249 Bacteria 582
246 Ga0265316_10092126 3300031344 Bacteria 2311
247 Ga0307513_10087389 3300031456 Bacteria 3191
248 Ga0307513_10492978 3300031456 Bacteria 943
249 Ga0265314_10011115 3300031711 Bacteria 7460
250 Ga0265314_10058663 3300031711 Bacteria 2637
251 Ga0307516_10747545 3300031730 Bacteria 637
252 Ga0307412_11696649 3300031911 Bacteria 579
253 Ga0307416_100754485 3300032002 Bacteria 1066
254 Ga0307416_102633981 3300032002 Bacteria 600
255 Ga0307510_10066290 3300033180 Bacteria 3648
256 Ga0373934_0001735 3300035086 Bacteria 8005
257 Ga0373923_0127933 3300035111 Bacteria 1139
258 Ga0373941_0050470 3300035115 Bacteria 1321
259 Ga0373953_0000959 3300035117 Bacteria 8074
260 Ga0373954_0001263 3300035118 Bacteria 10152
261 Ga0373956_0001458 3300035119 Bacteria 9771
262 Ga0373957_0093804 3300035120 Bacteria 1195
263 Ga0373946_0166550 3300035171 Bacteria 1038
264 Ga0373955_0065915 3300035172 Bacteria 2011
265 Ga0373924_0003172 3300035410 Bacteria 5623
266 Ga0373931_0309511 3300035691 Bacteria 978
267 Ga0373927_0027415 3300035695 Bacteria 3719
268 Ga0373927_0127406 3300035695 Bacteria 1662
269 Ga0373933_0003056 3300035724 Bacteria 9340
270 Ga0373933_0325500 3300035724 Bacteria 997
271 Ga0373937_0022013 3300036401 Bacteria 5724
272 Ga0373925_0371868 3300037068 Bacteria 1163
273 Ga0395905_1627140 3300037471 Bacteria 551
274 Ga0395901_0720712 3300038443 Bacteria 993
275 Ga0436365_0616103 3300039437 Bacteria 2545
276 Ga0436365_1792126 3300039437 Bacteria 3509
277 Ga0451798_0921437 3300041458 Bacteria 539
278 Ga0466967_0419217 3300045976 Bacteria 1304
279 Ga0495592_0011131 3300046454 Bacteria 6794
280 Ga0495603_0037566 3300046455 Bacteria 2906
281 Ga0495603_0425216 3300046455 Bacteria 761
282 Ga0495603_0480117 3300046455 Bacteria 712
283 Ga0495629_0000913 3300046459 Bacteria 23749
284 Ga0495629_0005246 3300046459 Bacteria 9689
285 Ga0495651_0021535 3300046462 Bacteria 5010
286 Ga0495653_0005160 3300046463 Bacteria 10609
287 Ga0495605_0193880 3300046474 Bacteria 888
288 Ga0495639_0142488 3300046475 Bacteria 1153
289 Ga0495639_0437722 3300046475 Bacteria 663
290 Ga0495616_0190035 3300046513 Bacteria 908
291 Ga0495620_0242406 3300046515 Bacteria 688
292 Ga0495628_0039168 3300046516 Bacteria 3791
293 Ga0495628_0802695 3300046516 Bacteria 658
294 Ga0495644_0159675 3300046523 Bacteria 864
295 Ga0495652_0058280 3300046529 Bacteria 3270
296 Ga0495652_0607810 3300046529 Bacteria 745
297 Ga0495640_0021539 3300046533 Bacteria 4729
298 Ga0495587_0042038 3300046536 Bacteria 2726
299 Ga0495587_0320344 3300046536 Bacteria 866
300 Ga0495598_0012339 3300046537 Bacteria 2095
301 Ga0495621_0010496 3300046539 Bacteria 2836
302 Ga0495645_0005515 3300046543 Bacteria 8695
303 Ga0495645_0728399 3300046543 Bacteria 600
304 Ga0495667_0088148 3300046559 Bacteria 2011
305 Ga0495667_0461321 3300046559 Bacteria 798
306 Ga0495656_0387295 3300046615 Bacteria 729
307 Ga0495634_0001493 3300046642 Bacteria 20702
308 Ga0495625_0448204 3300046660 Bacteria 798
309 Ga0495635_0001482 3300046663 Bacteria 15698
310 Ga0495659_0017832 3300046664 Bacteria 2358
311 Ga0495588_0450640 3300046674 Bacteria 675
312 Ga0495657_0210642 3300046675 Bacteria 1181
313 Ga0495657_0275415 3300046675 Bacteria 1008
314 Ga0495599_0004199 3300046678 Bacteria 8505
315 Ga0495623_0005332 3300046679 Bacteria 8420
316 Ga0495646_0001167 3300046680 Bacteria 15351
317 Ga0495658_0135359 3300046683 Bacteria 1503
318 Ga0495613_0170571 3300046689 Bacteria 1544
319 Ga0495624_0122243 3300046690 Bacteria 1598
320 Ga0495624_0861505 3300046690 Bacteria 534
321 Ga0495589_0127429 3300046794 Bacteria 1224
322 Ga0495600_0001762 3300046809 Bacteria 12097
323 Ga0495581_0052673 3300047315 Bacteria 2351
324 Ga0495581_0841098 3300047315 Bacteria 525
325 Ga0495604_0016588 3300047317 Bacteria 5888
326 Ga0495604_0400909 3300047317 Bacteria 903
327 Ga0495674_0007446 3300047319 Bacteria 10462
328 Ga0495672_0021034 3300047320 Bacteria 4261
329 Ga0495680_0044041 3300047322 Bacteria 3530
330 Ga0495675_0024324 3300047444 Bacteria 3860
331 Ga0495677_0015902 3300047445 Bacteria 2732
332 Ga0495684_0017742 3300047471 Bacteria 5481
333 Ga0495686_0080090 3300047472 Bacteria 1997
334 Ga0495593_0000653 3300047673 Bacteria 19952
335 Ga0495602_0093998 3300048088 Bacteria 2479
336 Ga0495602_0151073 3300048088 Bacteria 1825
337 Ga0495602_0290635 3300048088 Bacteria 1200
338 Ga0496100_0031094 3300048903 Bacteria 3316
339 Ga0496100_0064589 3300048903 Bacteria 2423
340 Ga0496100_1123734 3300048903 Bacteria 619
341 Ga0496101_0172294 3300048904 Bacteria 1664
342 Ga0496101_0515496 3300048904 Bacteria 945
343 Ga0496102_0032853 3300048905 Bacteria 4663
344 Ga0496102_0729097 3300048905 Bacteria 914
345 Ga0496103_0133528 3300048906 Bacteria 1586
346 Ga0496104_0042059 3300048907 Bacteria 4286
347 Ga0496105_0007870 3300048908 Bacteria 8276
348 Ga0496105_0060186 3300048908 Bacteria 3133
349 Ga0496106_0191756 3300048909 Bacteria 1625
350 Ga0496106_1166427 3300048909 Bacteria 602
351 Ga0496107_0056582 3300048910 Bacteria 2834
352 Ga0496107_1262871 3300048910 Bacteria 529
353 Ga0496108_0013052 3300048911 Bacteria 6771
354 Ga0496109_0004144 3300048912 Bacteria 12110
355 Ga0496110_0671748 3300048913 Bacteria 936
356 Ga0496111_0082004 3300048914 Bacteria 2355
357 Ga0496112_0000052 3300048915 Bacteria 81285
358 Ga0496112_0021219 3300048915 Bacteria 6173
359 Ga0496113_0047169 3300048916 Bacteria 3201
360 Ga0496114_0224084 3300048917 Bacteria 1651
361 Ga0496114_0742868 3300048917 Bacteria 858
362 Ga0496115_0002706 3300048918 Bacteria 12727
363 Ga0496116_0004825 3300048919 Bacteria 12726
364 Ga0496121_0185749 3300048924 Bacteria 1495
365 Ga0496121_0310193 3300048924 Bacteria 1067
366 Ga0496124_0850569 3300048927 Bacteria 559
367 Ga0496125_0332010 3300048928 Bacteria 916
368 Ga0496126_0081596 3300048929 Bacteria 2858
369 nmdc:mga03683_281729_c1 3300050489 Bacteria 777
370 nmdc:mga0yw44_1053889_c1 3300050492 Bacteria 550
371 nmdc:mga0yw44_74022_c1 3300050492 Bacteria 2121
372 nmdc:mga0k408_280340_c1 3300050493 Bacteria 995
373 nmdc:mga06z11_111589_c1 3300050494 Bacteria 1515
374 nmdc:mga06z11_261500_c1 3300050494 Bacteria 1021
375 nmdc:mga06z11_272465_c1 3300050494 Bacteria 1001
376 nmdc:mga04h51_110761_c1 3300050495 Bacteria 1012
377 nmdc:mga07m45_280238_c1 3300050496 Bacteria 970
378 nmdc:mga07m45_889375_c1 3300050496 Bacteria 510
379 nmdc:mga05p37_869719_c1 3300050507 Bacteria 976
380 nmdc:mga0sz30_163268_c1 3300050516 Bacteria 987
381 Ga0495601_0021834 3300053077 Bacteria 3924
382 Ga0495612_0278483 3300053078 Bacteria 747
383 Ga0500635_0039638 3300053080 Bacteria 1568
384 Ga0495595_0001356 3300053084 Bacteria 9514
385 Ga0495595_0440298 3300053084 Bacteria 662
386 Ga0495595_0466656 3300053084 Bacteria 642
387 Ga0495619_0006366 3300053085 Bacteria 7478
388 Ga0495619_0419857 3300053085 Bacteria 923
389 Ga0500578_0149776 3300053086 Bacteria 1454
390 Ga0500643_027811 3300053087 Bacteria 1754
391 Ga0500651_0129777 3300053093 Bacteria 1525
392 Ga0500651_0130402 3300053093 Bacteria 1521
393 Ga0500566_0002029 3300053094 Bacteria 11957
394 Ga0500554_005241 3300053102 Bacteria 2808
395 Ga0500554_222644 3300053102 Bacteria 627
396 Ga0500562_031455 3300053108 Bacteria 1400
397 Ga0500595_009360 3300053119 Bacteria 3956
398 Ga0500595_013236 3300053119 Bacteria 3164
399 Ga0500608_018480 3300053122 Bacteria 3180
400 Ga0500617_084644 3300053124 Bacteria 1367
401 Ga0500618_007473 3300053125 Bacteria 3116
402 Ga0500559_0001096 3300053136 Bacteria 16407
403 Ga0500590_046880 3300053148 Bacteria 2208
404 Ga0500603_000310 3300053150 Bacteria 12812
405 Ga0500622_0003676 3300053156 Bacteria 10070
406 Ga0500624_005000 3300053157 Bacteria 1755
407 Ga0500633_0034693 3300053160 Bacteria 1656
408 Ga0500636_0003909 3300053177 Bacteria 8400
409 Ga0500637_0001741 3300053178 Bacteria 9389
410 Ga0500611_117844 3300053727 Bacteria 705
411 Ga0500645_004682 3300053730 Bacteria 5198
412 2885390983 2885383462 Bacteria 9473874
413 Ga0070695_101803694
414 JGI24742J22300_10092963
415 JGI25406J46586_10000064
416 JGI25404J52841_10007209
417 JGI25404J52841_10012714
418 JGI25404J52841_10023864
419 JGI25404J52841_10035840
420 Ga0055542_1020864
421 Ga0070683_102157528
422 Ga0070670_100305506
423 Ga0068869_100258641
424 Ga0070680_100018190
425 Ga0070682_100208994
426 Ga0068868_100070970
427 Ga0068868_101283279
428 Ga0070660_100020111
429 Ga0070660_100078349
430 Ga0070691_10388027
431 Ga0070661_100524266
432 Ga0070661_100816888
433 Ga0070668_100823478
434 Ga0070668_101580877
435 Ga0070673_100563666
436 Ga0070673_101748461
437 Ga0070659_100171965
438 Ga0070659_101087145
439 Ga0070710_10263104
440 Ga0070711_100294698
441 Ga0070711_100454632
442 Ga0070711_100929160
443 Ga0070708_100032198
444 Ga0070708_100234497
445 Ga0070663_100007227
446 Ga0070663_100823927
447 Ga0070678_100582400
448 Ga0070681_10100485
449 Ga0070681_10182532
450 Ga0070681_10481101
451 Ga0068867_101430734
452 Ga0068867_101953409
453 Ga0070685_10794031
454 Ga0070706_100136160
455 Ga0070706_100417388
456 Ga0070707_100040211
457 Ga0070698_100443843
458 Ga0070699_100611622
459 Ga0070679_100144623
460 Ga0070679_100504033
461 Ga0070684_100025731
462 Ga0070684_100187398
463 Ga0070684_100790146
464 Ga0070697_100221982
465 Ga0068853_100011134
466 Ga0068853_100979180
467 Ga0070672_100419764
468 Ga0070665_100211357
469 Ga0070665_100250285
470 Ga0070665_100336218
471 Ga0070665_100443184
472 Ga0070665_100748841
473 Ga0068855_100376962
474 Ga0068855_100962683
475 Ga0068857_100117001
476 Ga0068854_100171732
477 Ga0068854_100538117
478 Ga0068854_100709430
479 Ga0068856_100669877
480 Ga0068856_101020294
481 Ga0070702_100341061
482 Ga0068852_100039300
483 Ga0068852_100164470
484 Ga0068852_102479964
485 Ga0068864_100214723
486 Ga0068861_101212426
487 Ga0068851_10003917
488 Ga0068851_10156765
489 Ga0068870_10145632
490 Ga0068858_100261826
491 Ga0081455_10006152
492 Ga0081455_10008216
493 Ga0081455_10034568
494 Ga0081455_10044929
495 Ga0081540_1001057
496 Ga0081540_1001355
497 Ga0081540_1005237
498 Ga0081540_1008112
499 Ga0081540_1013124
500 Ga0081540_1029651
501 Ga0081540_1043678
502 Ga0081540_1070257
503 Ga0081540_1315436
504 Ga0081539_10000099
505 Ga0070717_10159239
506 Ga0075365_10442089
507 Ga0075368_10112968
508 Ga0075368_10140678
509 Ga0075364_10259030
510 Ga0070716_101134779
511 Ga0070712_100606197
512 Ga0075367_10036546
513 Ga0075367_10451548
514 Ga0075367_10554105
515 Ga0075366_10010461
516 Ga0097621_100112589
517 Ga0075370_10965313
518 Ga0068871_101309210
519 Ga0068865_100111071
520 Ga0105240_10012518
521 Ga0105240_11682881
522 Ga0105245_10033874
523 Ga0105247_10154797
524 Ga0114129_10551621
525 Ga0114129_11499072
526 Ga0105243_11566764
527 Ga0105241_10284521
528 Ga0105242_10551740
529 Ga0105242_11318597
530 Ga0105242_12679331
531 Ga0105248_10101432
532 Ga0105248_10467574
533 Ga0105237_10005704
534 Ga0105237_10050406
535 Ga0105237_11511397
536 Ga0105237_12088702
537 Ga0105238_10028935
538 Ga0105238_10380920
539 Ga0105238_12610826
540 Ga0105239_10020716
541 Ga0105239_10212611
542 Ga0105239_10694125
543 Ga0105239_11710623
544 Ga0105246_10055274
545 Ga0157370_10034448
546 Ga0157369_10008842
547 Ga0157374_10249155
548 Ga0157374_10922754
549 Ga0157374_11336666
550 Ga0157378_10361639
551 Ga0157378_10501676
552 Ga0163162_11169087
553 Ga0163162_11405582
554 Ga0157375_10008999
555 Ga0157375_12756203
556 Ga0163163_10064907
557 Ga0157380_10523697
558 Ga0157380_13434646
559 Ga0157377_10390624
560 Ga0157379_10096506
561 Ga0157379_10199667
562 Ga0157376_10011109
563 Ga0157376_12286543
564 Ga0163161_10301773
565 Ga0163161_11405749
566 Ga0213876_10090634
567 Ga0213876_10625492
568 Ga0209148_1000900
569 Ga0209455_1001425
570 Ga0209564_1026373
571 Ga0207697_10035855
572 Ga0207656_10004473
573 Ga0207656_10198244
574 Ga0207680_10485724
575 Ga0207685_10497502
576 Ga0207643_10125986
577 Ga0207643_10248606
578 Ga0207705_10229816
579 Ga0207684_10180382
580 Ga0207654_10775013
581 Ga0207707_10001679
582 Ga0207707_10109761
583 Ga0207707_10174959
584 Ga0207695_10033407
585 Ga0207695_11025653
586 Ga0207671_10073678
587 Ga0207671_10201425
588 Ga0207693_10196116
589 Ga0207693_10545737
590 Ga0207663_10083023
591 Ga0207663_10594805
592 Ga0207660_10016947
593 Ga0207662_11086235
594 Ga0207657_10157312
595 Ga0207649_10320866
596 Ga0207652_10001089
597 Ga0207652_10238774
598 Ga0207646_10017460
599 Ga0207694_10141291
600 Ga0207694_11004050
601 Ga0207650_10385000
602 Ga0207687_10560714
603 Ga0207690_10092768
604 Ga0207706_10331151
605 Ga0207686_11455362
606 Ga0207670_10550220
607 Ga0207669_10816650
608 Ga0207669_10880454
609 Ga0207704_10074920
610 Ga0207704_10212451
611 Ga0207691_10147684
612 Ga0207691_10915385
613 Ga0207711_10355662
614 Ga0207679_10399965
615 Ga0207679_10495808
616 Ga0207667_10007349
617 Ga0207667_10345865
618 Ga0207651_10731027
619 Ga0207651_10823871
620 Ga0207668_11098790
621 Ga0207640_10045852
622 Ga0207640_10486088
623 Ga0207640_10718894
624 Ga0207640_10961823
625 Ga0207703_10077670
626 Ga0207639_10020473
627 Ga0207639_10022260
628 Ga0207639_11204111
629 Ga0207678_10003718
630 Ga0207678_10059734
631 Ga0207678_10779415
632 Ga0207702_10000325
633 Ga0207702_10073776
634 Ga0207702_10903189
635 Ga0207648_11219111
636 Ga0207676_10214471
637 Ga0207676_10298860
638 Ga0207675_100157083
639 Ga0207683_10028366
640 Ga0207698_10047893
641 Ga0207698_10113866
642 Ga0209389_1000086
643 Ga0209589_1000027
644 Ga0209489_100313
645 Ga0209179_1003096
646 Ga0209813_10093504
647 Ga0268266_10351032
648 Ga0268266_10480778
649 Ga0268266_10571611
650 Ga0268266_10754919
651 Ga0268265_10314602
652 Ga0265334_10080125
653 Ga0307515_10537694
654 Ga0265328_10098283
655 Ga0265340_10008671
656 Ga0265339_10159592
657 Ga0265339_10470376
658 Ga0265316_10092126
659 Ga0307513_10087389
660 Ga0307513_10492978
661 Ga0265314_10011115
662 Ga0265314_10058663
663 Ga0307516_10747545
664 Ga0307412_11696649
665 Ga0307416_100754485
666 Ga0307416_102633981
667 Ga0307510_10066290
668 Ga0373934_0001735
669 Ga0373923_0127933
670 Ga0373941_0050470
671 Ga0373953_0000959
672 Ga0373954_0001263
673 Ga0373956_0001458
674 Ga0373957_0093804
675 Ga0373946_0166550
676 Ga0373955_0065915
677 Ga0373924_0003172
678 Ga0373931_0309511
679 Ga0373927_0027415
680 Ga0373927_0127406
681 Ga0373933_0003056
682 Ga0373933_0325500
683 Ga0373937_0022013
684 Ga0373925_0371868
685 Ga0395905_1627140
686 Ga0395901_0720712
687 Ga0436365_0616103
688 Ga0436365_1792126
689 Ga0451798_0921437
690 Ga0466967_0419217
691 Ga0495592_0011131
692 Ga0495603_0037566
693 Ga0495603_0425216
694 Ga0495603_0480117
695 Ga0495629_0000913
696 Ga0495629_0005246
697 Ga0495651_0021535
698 Ga0495653_0005160
699 Ga0495605_0193880
700 Ga0495639_0142488
701 Ga0495639_0437722
702 Ga0495616_0190035
703 Ga0495620_0242406
704 Ga0495628_0039168
705 Ga0495628_0802695
706 Ga0495644_0159675
707 Ga0495652_0058280
708 Ga0495652_0607810
709 Ga0495640_0021539
710 Ga0495587_0042038
711 Ga0495587_0320344
712 Ga0495598_0012339
713 Ga0495621_0010496
714 Ga0495645_0005515
715 Ga0495645_0728399
716 Ga0495667_0088148
717 Ga0495667_0461321
718 Ga0495656_0387295
719 Ga0495634_0001493
720 Ga0495625_0448204
721 Ga0495635_0001482
722 Ga0495659_0017832
723 Ga0495588_0450640
724 Ga0495657_0210642
725 Ga0495657_0275415
726 Ga0495599_0004199
727 Ga0495623_0005332
728 Ga0495646_0001167
729 Ga0495658_0135359
730 Ga0495613_0170571
731 Ga0495624_0122243
732 Ga0495624_0861505
733 Ga0495589_0127429
734 Ga0495600_0001762
735 Ga0495581_0052673
736 Ga0495581_0841098
737 Ga0495604_0016588
738 Ga0495604_0400909
739 Ga0495674_0007446
740 Ga0495672_0021034
741 Ga0495680_0044041
742 Ga0495675_0024324
743 Ga0495677_0015902
744 Ga0495684_0017742
745 Ga0495686_0080090
746 Ga0495593_0000653
747 Ga0495602_0093998
748 Ga0495602_0151073
749 Ga0495602_0290635
750 Ga0496100_0031094
751 Ga0496100_0064589
752 Ga0496100_1123734
753 Ga0496101_0172294
754 Ga0496101_0515496
755 Ga0496102_0032853
756 Ga0496102_0729097
757 Ga0496103_0133528
758 Ga0496104_0042059
759 Ga0496105_0007870
760 Ga0496105_0060186
761 Ga0496106_0191756
762 Ga0496106_1166427
763 Ga0496107_0056582
764 Ga0496107_1262871
765 Ga0496108_0013052
766 Ga0496109_0004144
767 Ga0496110_0671748
768 Ga0496111_0082004
769 Ga0496112_0000052
770 Ga0496112_0021219
771 Ga0496113_0047169
772 Ga0496114_0224084
773 Ga0496114_0742868
774 Ga0496115_0002706
775 Ga0496116_0004825
776 Ga0496121_0185749
777 Ga0496121_0310193
778 Ga0496124_0850569
779 Ga0496125_0332010
780 Ga0496126_0081596
781 nmdc:mga03683_281729_c1
782 nmdc:mga0yw44_1053889_c1
783 nmdc:mga0yw44_74022_c1
784 nmdc:mga0k408_280340_c1
785 nmdc:mga06z11_111589_c1
786 nmdc:mga06z11_261500_c1
787 nmdc:mga06z11_272465_c1
788 nmdc:mga04h51_110761_c1
789 nmdc:mga07m45_280238_c1
790 nmdc:mga07m45_889375_c1
791 nmdc:mga05p37_869719_c1
792 nmdc:mga0sz30_163268_c1
793 Ga0495601_0021834
794 Ga0495612_0278483
795 Ga0500635_0039638
796 Ga0495595_0001356
797 Ga0495595_0440298
798 Ga0495595_0466656
799 Ga0495619_0006366
800 Ga0495619_0419857
801 Ga0500578_0149776
802 Ga0500643_027811
803 Ga0500651_0129777
804 Ga0500651_0130402
805 Ga0500566_0002029
806 Ga0500554_005241
807 Ga0500554_222644
808 Ga0500562_031455
809 Ga0500595_009360
810 Ga0500595_013236
811 Ga0500608_018480
812 Ga0500617_084644
813 Ga0500618_007473
814 Ga0500559_0001096
815 Ga0500590_046880
816 Ga0500603_000310
817 Ga0500622_0003676
818 Ga0500624_005000
819 Ga0500633_0034693
820 Ga0500636_0003909
821 Ga0500637_0001741
822 Ga0500611_117844
823 Ga0500645_004682
824 2885390983

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07045

DUF1330

Domain of unknown function (DUF1330)

39

123

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dca-assembly2.cif.gz_D crystal structure of the rpa0582- protein of unknown function from rhodopseudomonas palustris- a structural genomics target 0.8536 7 128
3hhl-assembly2.cif.gz_C crystal structure of methylated rpa0582 protein 0.8444 7 130
2fiu-assembly1.cif.gz_B crystal structure of the conserved protein of unknown function atu0297 from agrobacterium tumefaciens 0.8011 18 127
3lo3-assembly2.cif.gz_C the crystal structure of a conserved functionally unknown protein from colwellia psychrerythraea 34h. 0.7983 17 123
3dca-assembly2.cif.gz_D crystal structure of the rpa0582- protein of unknown function from rhodopseudomonas palustris- a structural genomics target 0.7941 7 128
ID Description Score Start End Superfamily
3hhlC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8116 7 128 3.30.70.100
3lo3U00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7938 17 123 3.30.70.100
2fiuB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7746 18 127 3.30.70.100
3lo3U00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7723 17 123 3.30.70.100
2fiuB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7677 18 127 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A7W0KT57-F1-model_v4 DUF1330 domain-containing protein 0.9297 9 126
AF-A0A382PJB2-F1-model_v4 DUF1330 domain-containing protein 0.9195 8 129
AF-A0A517Z0Y6-F1-model_v4 DUF1330 domain-containing protein 0.919 7 128
AF-A0A521V8L7-F1-model_v4 DUF1330 domain-containing protein 0.9184 23 129
AF-A0A2A5EP10-F1-model_v4 DUF1330 domain-containing protein 0.9183 7 126

Map