F437725

General Info

Members Datasets Scaffolds Average Seq Length
412 226 824 305

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10057426|Ga0070709_100574264
Length 323
Sequence MTTSSATSKPEGRQNPKVGHDVAIGVVPVTLDLLRERGYESVRAFASSRSAGKQVNGLTVEEATPEALSAGDLDLCLFSIGTVASRELVPHAVRGGAVAIDKSSAYRLQDGIPLVVPEVNGDRALAHDGIVANPNCASIPLTLVLKPLHDAVGVARVRVATYQSASGAGTERMERLRAQDPAEGDLGMDWDFDGEEFDEESKLRAETRKILELPELPVSATCVRVPVMVGHSESVWIETAEPITPEQVRQVLGEAPSVRLEDFPTPRAAAGEDEVLVGRIRPDRAAEQNGVSLFLACDNLRKGAALNAIQIAELILASRAVAA

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
68 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
98 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
101 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
102 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
103 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
104 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
105 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
106 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
107 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
108 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
109 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
110 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
111 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
112 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
113 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
114 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
115 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
116 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
117 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
118 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
119 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
120 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
121 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
122 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
123 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
124 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
125 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
126 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
127 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
137 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
138 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
139 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
140 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
141 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
142 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
143 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
144 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
145 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
146 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
147 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
148 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
149 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
152 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
153 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
154 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
155 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
156 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
157 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
158 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
159 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
160 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
161 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
162 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
163 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
164 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
165 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
166 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
167 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
168 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
169 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
170 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
171 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
174 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
175 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
176 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
179 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
180 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
181 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
182 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
204 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
205 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
206 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
207 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
208 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
209 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
210 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
211 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
214 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
220 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
221 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
222 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
223 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
224 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
225 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
226 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 12.86
Rhizosphere 86.65
Stem 0
Stem Tuber 0
Unclassified 0.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10057426 3300005434 Bacteria 2465
2 Ga0070683_100019855 3300005329 Bacteria 5973
3 Ga0070680_100032672 3300005336 Bacteria 4189
4 Ga0070680_100162430 3300005336 Bacteria 1877
5 Ga0070682_100048991 3300005337 Bacteria 2633
6 Ga0070682_100120485 3300005337 Bacteria 1760
7 Ga0070660_100080998 3300005339 Bacteria 2548
8 Ga0070661_100044054 3300005344 Bacteria 3259
9 Ga0070661_100047401 3300005344 Bacteria 3144
10 Ga0070671_100077738 3300005355 Bacteria 2773
11 Ga0070659_100020630 3300005366 Bacteria 5009
12 Ga0070659_100268657 3300005366 Bacteria 1416
13 Ga0070709_10020207 3300005434 Bacteria 3861
14 Ga0070709_10234554 3300005434 Bacteria 1314
15 Ga0070714_100096572 3300005435 Bacteria 2596
16 Ga0070713_100045005 3300005436 Bacteria 3615
17 Ga0070713_100185738 3300005436 Bacteria 1871
18 Ga0070713_100262041 3300005436 Bacteria 1580
19 Ga0070713_100267453 3300005436 Bacteria 1564
20 Ga0070713_100306704 3300005436 Bacteria 1463
21 Ga0070710_10089703 3300005437 Bacteria 1811
22 Ga0070711_100110597 3300005439 Bacteria 2016
23 Ga0070705_100026439 3300005440 Bacteria 3158
24 Ga0070700_100004284 3300005441 Bacteria 7447
25 Ga0070694_100014403 3300005444 Bacteria 4950
26 Ga0070708_100023496 3300005445 Bacteria 5245
27 Ga0070663_100197700 3300005455 Bacteria 1568
28 Ga0070678_100007397 3300005456 Bacteria 6509
29 Ga0070678_100058931 3300005456 Bacteria 2820
30 Ga0070681_10007722 3300005458 Bacteria 10513
31 Ga0070681_10017334 3300005458 Bacteria 7196
32 Ga0070706_100036108 3300005467 Bacteria 4563
33 Ga0070706_100308624 3300005467 Bacteria 1476
34 Ga0070707_100003437 3300005468 Bacteria 14972
35 Ga0070707_100006645 3300005468 Bacteria 10720
36 Ga0070698_100181764 3300005471 Bacteria 2041
37 Ga0070699_100010233 3300005518 Bacteria 8114
38 Ga0070699_100122973 3300005518 Bacteria 2283
39 Ga0070679_100034422 3300005530 Bacteria 5020
40 Ga0070684_100021833 3300005535 Bacteria 5333
41 Ga0070684_100116526 3300005535 Bacteria 2400
42 Ga0070684_100158595 3300005535 Bacteria 2052
43 Ga0070684_100424912 3300005535 Bacteria 1227
44 Ga0070684_100607957 3300005535 Bacteria 1017
45 Ga0070686_100016523 3300005544 Bacteria 4294
46 Ga0070686_100023361 3300005544 Bacteria 3695
47 Ga0070696_100009393 3300005546 Bacteria 6547
48 Ga0070693_100035685 3300005547 Bacteria 2759
49 Ga0070704_100195821 3300005549 Bacteria 1627
50 Ga0068855_100077240 3300005563 Bacteria 3863
51 Ga0068855_100078338 3300005563 Bacteria 3834
52 Ga0068855_100394057 3300005563 Bacteria 1518
53 Ga0068855_100493178 3300005563 Bacteria 1332
54 Ga0068857_100044631 3300005577 Bacteria 3932
55 Ga0068857_100057188 3300005577 Bacteria 3462
56 Ga0068856_100045443 3300005614 Bacteria 4324
57 Ga0068856_100084559 3300005614 Bacteria 3152
58 Ga0068856_100373498 3300005614 Bacteria 1445
59 Ga0070702_100018413 3300005615 Bacteria 3624
60 Ga0070702_100088610 3300005615 Bacteria 1871
61 Ga0070702_100128530 3300005615 Bacteria 1597
62 Ga0068852_100028819 3300005616 Bacteria 4549
63 Ga0068852_100137064 3300005616 Bacteria 2260
64 Ga0068852_100182454 3300005616 Bacteria 1974
65 Ga0068860_100065492 3300005843 Bacteria 3450
66 Ga0075432_10000907 3300006058 Bacteria 9321
67 Ga0070715_10018155 3300006163 Bacteria 2676
68 Ga0070712_100016272 3300006175 Bacteria 4803
69 Ga0097621_100229172 3300006237 Bacteria 1621
70 Ga0068871_100032052 3300006358 Bacteria 4147
71 Ga0075428_100015136 3300006844 Bacteria 8562
72 Ga0075431_100026307 3300006847 Bacteria 5969
73 Ga0075433_10125804 3300006852 Bacteria 2276
74 Ga0075433_10172658 3300006852 Bacteria 1923
75 Ga0075434_100007881 3300006871 Bacteria 9866
76 Ga0075434_100084725 3300006871 Bacteria 3168
77 Ga0075434_100145444 3300006871 Bacteria 2391
78 Ga0075434_100157752 3300006871 Bacteria 2288
79 Ga0075436_100027005 3300006914 Bacteria 3953
80 Ga0075436_100029387 3300006914 Bacteria 3780
81 Ga0075436_100133860 3300006914 Bacteria 1739
82 Ga0075435_100024651 3300007076 Bacteria 4671
83 Ga0075435_100215508 3300007076 Bacteria 1629
84 Ga0105240_10098649 3300009093 Bacteria 3557
85 Ga0111539_10005978 3300009094 Bacteria 15722
86 Ga0105245_10177179 3300009098 Bacteria 2034
87 Ga0114129_10013491 3300009147 Bacteria 11645
88 Ga0114129_10080286 3300009147 Bacteria 4534
89 Ga0114129_10228951 3300009147 Bacteria 2504
90 Ga0105243_10370903 3300009148 Bacteria 1320
91 Ga0105241_10120806 3300009174 Bacteria 2110
92 Ga0105241_10419331 3300009174 Bacteria 1178
93 Ga0105242_10202724 3300009176 Bacteria 1763
94 Ga0105237_10076912 3300009545 Bacteria 3328
95 Ga0105238_10197847 3300009551 Bacteria 1985
96 Ga0105249_10196889 3300009553 Bacteria 1970
97 Ga0105239_10028588 3300010375 Bacteria 6129
98 Ga0105239_10222854 3300010375 Bacteria 2115
99 Ga0157371_10141759 3300013102 Bacteria 1712
100 Ga0157370_10014527 3300013104 Bacteria 8050
101 Ga0157370_10141531 3300013104 Bacteria 2241
102 Ga0157369_10266235 3300013105 Bacteria 1787
103 Ga0157369_10267836 3300013105 Bacteria 1781
104 Ga0157369_10628148 3300013105 Bacteria 1108
105 Ga0157374_10089326 3300013296 Bacteria 2936
106 Ga0157374_10515043 3300013296 Bacteria 1202
107 Ga0163162_10229922 3300013306 Bacteria 1985
108 Ga0157372_10015478 3300013307 Bacteria 8176
109 Ga0157372_10168844 3300013307 Bacteria 2531
110 Ga0157372_10363956 3300013307 Bacteria 1685
111 Ga0157372_10588895 3300013307 Bacteria 1296
112 Ga0157375_10206204 3300013308 Bacteria 2122
113 Ga0157375_10729845 3300013308 Bacteria 1143
114 Ga0157379_10281532 3300014968 Bacteria 1513
115 Ga0157376_10014378 3300014969 Bacteria 5939
116 Ga0157376_10157189 3300014969 Bacteria 2057
117 Ga0182007_10007129 3300015262 Bacteria 4723
118 Ga0207692_10027195 3300025898 Bacteria 2692
119 Ga0207685_10002840 3300025905 Bacteria 4072
120 Ga0207685_10055471 3300025905 Bacteria 1547
121 Ga0207705_10323801 3300025909 Bacteria 1185
122 Ga0207684_10074367 3300025910 Bacteria 2887
123 Ga0207684_10154609 3300025910 Bacteria 1974
124 Ga0207684_10223141 3300025910 Bacteria 1626
125 Ga0207654_10185430 3300025911 Bacteria 1360
126 Ga0207707_10004915 3300025912 Bacteria 11749
127 Ga0207707_10091455 3300025912 Bacteria 2659
128 Ga0207707_10112148 3300025912 Bacteria 2384
129 Ga0207695_10194255 3300025913 Bacteria 1946
130 Ga0207671_10101038 3300025914 Bacteria 2185
131 Ga0207693_10002521 3300025915 Bacteria 15916
132 Ga0207693_10032389 3300025915 Bacteria 4126
133 Ga0207660_10029344 3300025917 Bacteria 3772
134 Ga0207657_10022070 3300025919 Bacteria 5975
135 Ga0207657_10023872 3300025919 Bacteria 5681
136 Ga0207657_10054462 3300025919 Bacteria 3459
137 Ga0207649_10062024 3300025920 Bacteria 2355
138 Ga0207649_10151105 3300025920 Bacteria 1599
139 Ga0207646_10002458 3300025922 Bacteria 21888
140 Ga0207646_10387710 3300025922 Bacteria 1262
141 Ga0207700_10000004 3300025928 Bacteria 443409
142 Ga0207700_10420477 3300025928 Bacteria 1174
143 Ga0207664_10005773 3300025929 Bacteria 8467
144 Ga0207686_10212465 3300025934 Bacteria 1392
145 Ga0207661_10009294 3300025944 Bacteria 7045
146 Ga0207667_10329686 3300025949 Bacteria 1558
147 Ga0207668_10254686 3300025972 Bacteria 1428
148 Ga0207640_10258224 3300025981 Bacteria 1356
149 Ga0207677_10348827 3300026023 Bacteria 1239
150 Ga0207678_10046646 3300026067 Bacteria 3746
151 Ga0207678_10224164 3300026067 Bacteria 1609
152 Ga0207708_10018799 3300026075 Bacteria 5204
153 Ga0207702_10130659 3300026078 Bacteria 2260
154 Ga0207702_10144627 3300026078 Bacteria 2156
155 Ga0207648_10124702 3300026089 Bacteria 2265
156 Ga0207674_10035299 3300026116 Bacteria 5220
157 Ga0207674_10047762 3300026116 Bacteria 4386
158 Ga0207683_10002297 3300026121 Bacteria 16764
159 Ga0207683_10011772 3300026121 Bacteria 7465
160 Ga0207698_10082000 3300026142 Bacteria 2606
161 Ga0207698_10090646 3300026142 Bacteria 2500
162 Ga0207428_10004637 3300027907 Bacteria 13027
163 Ga0265318_10002390 3300028577 Bacteria 10047
164 Ga0265322_10012892 3300028654 Bacteria 2421
165 Ga0265338_10007766 3300028800 Bacteria 13196
166 Ga0265338_10009902 3300028800 Bacteria 11275
167 Ga0265330_10032496 3300031235 Bacteria 2338
168 Ga0265332_10050416 3300031238 Bacteria 1789
169 Ga0265320_10017983 3300031240 Bacteria 3905
170 Ga0265325_10077167 3300031241 Bacteria 1661
171 Ga0265329_10008294 3300031242 Bacteria 3948
172 Ga0265329_10011048 3300031242 Bacteria 3292
173 Ga0265339_10051625 3300031249 Bacteria 2243
174 Ga0265331_10062663 3300031250 Bacteria 1753
175 Ga0265327_10014855 3300031251 Bacteria 5069
176 Ga0265316_10011096 3300031344 Bacteria 8160
177 Ga0265316_10019374 3300031344 Bacteria 5821
178 Ga0265313_10007900 3300031595 Bacteria 7160
179 Ga0265314_10005549 3300031711 Bacteria 11347
180 Ga0265342_10027508 3300031712 Bacteria 3552
181 Ga0373948_0008889 3300034817 Bacteria 1722
182 Ga0373958_0000611 3300034819 Bacteria 4441
183 Ga0373938_0001932 3300034957 Bacteria 3316
184 Ga0373929_0000126 3300035085 Bacteria 12700
185 Ga0373944_0053881 3300035089 Bacteria 1274
186 Ga0373949_0003006 3300035090 Bacteria 4143
187 Ga0373951_0005721 3300035091 Bacteria 2877
188 Ga0373932_0009585 3300035112 Bacteria 2329
189 Ga0373939_0001749 3300035114 Bacteria 5236
190 Ga0373939_0002880 3300035114 Bacteria 4044
191 Ga0373941_0004717 3300035115 Bacteria 3169
192 Ga0373945_0061285 3300035116 Bacteria 1405
193 Ga0373960_0011296 3300035121 Bacteria 2197
194 Ga0373960_0012612 3300035121 Bacteria 2103
195 Ga0373943_0154077 3300035170 Bacteria 1247
196 Ga0373961_0001879 3300035241 Bacteria 5719
197 Ga0373962_0015793 3300035242 Bacteria 1940
198 Ga0373931_0007799 3300035691 Bacteria 5057
199 Ga0373947_0005765 3300035725 Bacteria 7224
200 Ga0373947_0176248 3300035725 Bacteria 1390
201 Ga0373937_0238138 3300036401 Bacteria 1714
202 Ga0373937_0664198 3300036401 Bacteria 988
203 Ga0373925_0027734 3300037068 Bacteria 4145
204 Ga0395899_0003038 3300037312 Bacteria 13400
205 Ga0395899_0056805 3300037312 Bacteria 2891
206 Ga0395899_0058651 3300037312 Bacteria 2839
207 Ga0395899_0134497 3300037312 Bacteria 1763
208 Ga0395899_0150301 3300037312 Bacteria 1651
209 Ga0395899_0162720 3300037312 Bacteria 1575
210 Ga0395900_0001650 3300037418 Bacteria 26129
211 Ga0395900_0002208 3300037418 Bacteria 21750
212 Ga0395900_0004169 3300037418 Bacteria 15378
213 Ga0395900_0010867 3300037418 Bacteria 9311
214 Ga0395900_0024550 3300037418 Bacteria 6172
215 Ga0395900_0066648 3300037418 Bacteria 3699
216 Ga0395900_0186712 3300037418 Bacteria 2104
217 Ga0395900_0475600 3300037418 Bacteria 1202
218 Ga0395898_0003199 3300037466 Bacteria 18440
219 Ga0395898_0006394 3300037466 Bacteria 12576
220 Ga0395898_0009960 3300037466 Bacteria 9956
221 Ga0395898_0017446 3300037466 Bacteria 7330
222 Ga0395905_0003043 3300037471 Bacteria 18158
223 Ga0395905_0011305 3300037471 Bacteria 8631
224 Ga0395905_0022263 3300037471 Bacteria 5997
225 Ga0395905_0049336 3300037471 Bacteria 3944
226 Ga0395905_0083569 3300037471 Bacteria 2991
227 Ga0395905_0104325 3300037471 Bacteria 2661
228 Ga0395901_0001109 3300038443 Bacteria 28630
229 Ga0395901_0001415 3300038443 Bacteria 25052
230 Ga0395901_0003492 3300038443 Bacteria 15840
231 Ga0395901_0004074 3300038443 Bacteria 14725
232 Ga0395901_0020532 3300038443 Bacteria 6760
233 Ga0395901_0024304 3300038443 Bacteria 6218
234 Ga0395901_0082015 3300038443 Bacteria 3369
235 Ga0395901_0123605 3300038443 Bacteria 2719
236 Ga0395901_0191040 3300038443 Bacteria 2147
237 Ga0395901_0237987 3300038443 Bacteria 1899
238 Ga0451789_0841330 3300041443 Bacteria 1132
239 Ga0451795_1282916 3300041456 Bacteria 2455
240 Ga0451841_0156596 3300041498 Bacteria 2457
241 Ga0451853_0264222 3300041512 Bacteria 1741
242 Ga0466966_0027314 3300044684 Bacteria 3722
243 Ga0466966_0244260 3300044684 Bacteria 1082
244 Ga0466961_0013498 3300044693 Bacteria 5232
245 Ga0466961_0027117 3300044693 Bacteria 3683
246 Ga0466963_0000205 3300044694 Bacteria 25099
247 Ga0466963_0005844 3300044694 Bacteria 7245
248 Ga0466963_0009776 3300044694 Bacteria 5787
249 Ga0466963_0039439 3300044694 Bacteria 3092
250 Ga0466963_0042884 3300044694 Bacteria 2972
251 Ga0466963_0055141 3300044694 Bacteria 2643
252 Ga0466963_0102135 3300044694 Bacteria 1963
253 Ga0466963_0182988 3300044694 Bacteria 1463
254 Ga0466964_0002046 3300044706 Bacteria 7093
255 Ga0466964_0003856 3300044706 Bacteria 5505
256 Ga0466964_0069259 3300044706 Bacteria 1487
257 Ga0466971_0033376 3300044719 Bacteria 2307
258 Ga0466971_0044436 3300044719 Bacteria 1995
259 Ga0466968_0012723 3300044735 Bacteria 3300
260 Ga0466968_0095896 3300044735 Bacteria 1320
261 Ga0466968_0168892 3300044735 Bacteria 1013
262 Ga0466970_0025815 3300044765 Bacteria 3078
263 Ga0466957_0097974 3300044842 Bacteria 1845
264 Ga0466957_0101606 3300044842 Bacteria 1813
265 Ga0466957_0134146 3300044842 Bacteria 1589
266 Ga0466959_0006265 3300045049 Bacteria 8221
267 Ga0466959_0028515 3300045049 Bacteria 4140
268 Ga0466959_0029182 3300045049 Bacteria 4088
269 Ga0466959_0049998 3300045049 Bacteria 3071
270 Ga0466958_0005452 3300045836 Bacteria 6850
271 Ga0466958_0018696 3300045836 Bacteria 4026
272 Ga0466958_0028007 3300045836 Bacteria 3338
273 Ga0466958_0053207 3300045836 Bacteria 2454
274 Ga0466958_0133983 3300045836 Bacteria 1557
275 Ga0466958_0176754 3300045836 Bacteria 1354
276 Ga0466967_0000577 3300045976 Bacteria 18063
277 Ga0466967_0005636 3300045976 Bacteria 8713
278 Ga0466967_0016911 3300045976 Bacteria 5768
279 Ga0466967_0038424 3300045976 Bacteria 4105
280 Ga0466967_0042195 3300045976 Bacteria 3940
281 Ga0466967_0073762 3300045976 Bacteria 3062
282 Ga0466967_0080932 3300045976 Bacteria 2933
283 Ga0466967_0085285 3300045976 Bacteria 2859
284 Ga0466967_0180656 3300045976 Bacteria 1990
285 Ga0466967_0273011 3300045976 Bacteria 1620
286 Ga0466967_0284020 3300045976 Bacteria 1588
287 Ga0466967_0332648 3300045976 Bacteria 1467
288 Ga0495603_0008110 3300046455 Bacteria 6344
289 Ga0495641_0031381 3300046461 Bacteria 2539
290 Ga0495651_0353482 3300046462 Bacteria 970
291 Ga0495653_0197588 3300046463 Bacteria 1367
292 Ga0495580_0068379 3300046472 Bacteria 2484
293 Ga0495582_0040610 3300046473 Bacteria 2563
294 Ga0495664_0029879 3300046477 Bacteria 3190
295 Ga0495584_0278628 3300046491 Bacteria 850
296 Ga0495585_0095053 3300046492 Bacteria 1601
297 Ga0495608_0029047 3300046511 Bacteria 3754
298 Ga0495628_0306004 3300046516 Bacteria 1176
299 Ga0495630_0037793 3300046517 Bacteria 3610
300 Ga0495644_0003004 3300046523 Bacteria 6684
301 Ga0495652_0202193 3300046529 Bacteria 1507
302 Ga0495586_0016132 3300046535 Bacteria 3974
303 Ga0495656_0059261 3300046615 Bacteria 1665
304 Ga0495588_0059167 3300046674 Bacteria 1981
305 Ga0495657_0042033 3300046675 Bacteria 3123
306 Ga0495657_0052115 3300046675 Bacteria 2745
307 Ga0495599_0056626 3300046678 Bacteria 2454
308 Ga0495623_0036271 3300046679 Bacteria 3159
309 Ga0495658_0249191 3300046683 Bacteria 1117
310 Ga0495613_0057298 3300046689 Bacteria 2861
311 Ga0495624_0114451 3300046690 Bacteria 1658
312 Ga0495670_0019123 3300046691 Bacteria 3376
313 Ga0495600_0028653 3300046809 Bacteria 3603
314 Ga0495581_0090631 3300047315 Bacteria 1774
315 Ga0495674_0064777 3300047319 Bacteria 3176
316 Ga0495676_0007966 3300047321 Bacteria 9711
317 Ga0495680_0049906 3300047322 Bacteria 3274
318 Ga0495684_0070655 3300047471 Bacteria 2654
319 Ga0495602_0134301 3300048088 Bacteria 1968
320 Ga0496100_0008702 3300048903 Bacteria 5671
321 Ga0496100_0057227 3300048903 Bacteria 2553
322 Ga0496100_0292249 3300048903 Bacteria 1218
323 Ga0496100_0361122 3300048903 Bacteria 1099
324 Ga0496101_0004739 3300048904 Bacteria 8621
325 Ga0496101_0038563 3300048904 Bacteria 3393
326 Ga0496101_0121354 3300048904 Bacteria 1976
327 Ga0496102_0031338 3300048905 Bacteria 4769
328 Ga0496102_0058971 3300048905 Bacteria 3508
329 Ga0496102_0211954 3300048905 Bacteria 1826
330 Ga0496103_0036701 3300048906 Bacteria 3001
331 Ga0496103_0041661 3300048906 Bacteria 2823
332 Ga0496104_0003742 3300048907 Bacteria 13142
333 Ga0496104_0004753 3300048907 Bacteria 11826
334 Ga0496104_0106582 3300048907 Bacteria 2686
335 Ga0496104_0156708 3300048907 Bacteria 2185
336 Ga0496105_0014586 3300048908 Bacteria 6257
337 Ga0496105_0021371 3300048908 Bacteria 5237
338 Ga0496105_0058294 3300048908 Bacteria 3187
339 Ga0496105_0109629 3300048908 Bacteria 2279
340 Ga0496106_0003866 3300048909 Bacteria 11165
341 Ga0496106_0008337 3300048909 Bacteria 7670
342 Ga0496107_0010781 3300048910 Bacteria 6356
343 Ga0496107_0053038 3300048910 Bacteria 2925
344 Ga0496107_0123100 3300048910 Bacteria 1911
345 Ga0496107_0202445 3300048910 Bacteria 1475
346 Ga0496108_0187602 3300048911 Bacteria 1791
347 Ga0496108_0189218 3300048911 Bacteria 1784
348 Ga0496109_0000818 3300048912 Bacteria 25933
349 Ga0496109_0001803 3300048912 Bacteria 17819
350 Ga0496109_0034463 3300048912 Bacteria 4559
351 Ga0496109_0084445 3300048912 Bacteria 2929
352 Ga0496110_0036845 3300048913 Bacteria 4249
353 Ga0496110_0047487 3300048913 Bacteria 3760
354 Ga0496110_0084566 3300048913 Bacteria 2832
355 Ga0496111_0025733 3300048914 Bacteria 4152
356 Ga0496111_0048869 3300048914 Bacteria 3049
357 Ga0496111_0056827 3300048914 Bacteria 2832
358 Ga0496111_0095792 3300048914 Bacteria 2178
359 Ga0496111_0124161 3300048914 Bacteria 1908
360 Ga0496112_0081133 3300048915 Bacteria 3207
361 Ga0496112_0177615 3300048915 Bacteria 2094
362 Ga0496112_0277020 3300048915 Bacteria 1625
363 Ga0496112_0651669 3300048915 Bacteria 983
364 Ga0496113_0004127 3300048916 Bacteria 8858
365 Ga0496114_0133277 3300048917 Bacteria 2147
366 Ga0496114_0189948 3300048917 Bacteria 1797
367 Ga0496115_0003647 3300048918 Bacteria 11080
368 Ga0496115_0067863 3300048918 Bacteria 2886
369 Ga0496115_0126489 3300048918 Bacteria 2105
370 Ga0496115_0164948 3300048918 Bacteria 1832
371 Ga0501031_0024438 3300049568 Bacteria 3939
372 Ga0501031_0036791 3300049568 Bacteria 3194
373 Ga0501036_0059363 3300049572 Bacteria 3241
374 Ga0501040_0027165 3300049576 Bacteria 3852
375 Ga0501040_0227308 3300049576 Bacteria 1328
376 Ga0501042_0039727 3300049578 Bacteria 3345
377 Ga0501042_0108492 3300049578 Bacteria 1998
378 Ga0501046_0112117 3300049580 Bacteria 2083
379 Ga0501067_0023247 3300049583 Bacteria 3434
380 Ga0501069_0010083 3300049585 Bacteria 4995
381 Ga0501069_0097057 3300049585 Bacteria 1670
382 Ga0501070_0193104 3300049586 Bacteria 1673
383 Ga0501071_0067754 3300049587 Bacteria 2596
384 Ga0501072_0310486 3300049588 Bacteria 1253
385 Ga0501074_0120958 3300049590 Bacteria 1872
386 Ga0501075_0003955 3300049591 Bacteria 9988
387 Ga0501076_0036023 3300049592 Bacteria 3875
388 Ga0501076_0109708 3300049592 Bacteria 2230
389 Ga0501077_0121839 3300049593 Bacteria 1653
390 Ga0501080_0038542 3300049742 Bacteria 4461
391 Ga0501080_0253510 3300049742 Bacteria 1604
392 Ga0501081_0097938 3300049743 Bacteria 2070
393 Ga0501045_0056016 3300049824 Bacteria 2883
394 nmdc:mga05p37_54257_c1 3300050507 Bacteria 4931
395 nmdc:mga06r32_9777_c1 3300050510 Bacteria 8660
396 nmdc:mga08y16_28666_c1 3300050511 Bacteria 5868
397 nmdc:mga0n895_16074_c1 3300050512 Bacteria 6857
398 nmdc:mga0n895_49559_c1 3300050512 Bacteria 4115
399 nmdc:mga0rr50_496351_c1 3300050513 Bacteria 1038
400 nmdc:mga08x19_104135_c1 3300050514 Bacteria 1886
401 nmdc:mga08x19_61237_c1 3300050514 Bacteria 2439
402 nmdc:mga0a205_226375_c1 3300050515 Bacteria 1755
403 nmdc:mga0a205_247852_c1 3300050515 Bacteria 1661
404 nmdc:mga0a205_445716_c1 3300050515 Bacteria 1155
405 Ga0495612_0024693 3300053078 Bacteria 2413
406 Ga0495619_0224117 3300053085 Unclassified 1302
407 Ga0501084_0046449 3300054114 Bacteria 3638
408 Ga0466962_0003562 3300061719 Bacteria 7416
409 Ga0530510_0009006 3300061734 Bacteria 6996
410 Ga0530510_0032994 3300061734 Bacteria 3727
411 Ga0530510_0106899 3300061734 Bacteria 2048
412 Ga0530510_0325841 3300061734 Bacteria 1152
413 Ga0070709_10057426
414 Ga0070683_100019855
415 Ga0070680_100032672
416 Ga0070680_100162430
417 Ga0070682_100048991
418 Ga0070682_100120485
419 Ga0070660_100080998
420 Ga0070661_100044054
421 Ga0070661_100047401
422 Ga0070671_100077738
423 Ga0070659_100020630
424 Ga0070659_100268657
425 Ga0070709_10020207
426 Ga0070709_10234554
427 Ga0070714_100096572
428 Ga0070713_100045005
429 Ga0070713_100185738
430 Ga0070713_100262041
431 Ga0070713_100267453
432 Ga0070713_100306704
433 Ga0070710_10089703
434 Ga0070711_100110597
435 Ga0070705_100026439
436 Ga0070700_100004284
437 Ga0070694_100014403
438 Ga0070708_100023496
439 Ga0070663_100197700
440 Ga0070678_100007397
441 Ga0070678_100058931
442 Ga0070681_10007722
443 Ga0070681_10017334
444 Ga0070706_100036108
445 Ga0070706_100308624
446 Ga0070707_100003437
447 Ga0070707_100006645
448 Ga0070698_100181764
449 Ga0070699_100010233
450 Ga0070699_100122973
451 Ga0070679_100034422
452 Ga0070684_100021833
453 Ga0070684_100116526
454 Ga0070684_100158595
455 Ga0070684_100424912
456 Ga0070684_100607957
457 Ga0070686_100016523
458 Ga0070686_100023361
459 Ga0070696_100009393
460 Ga0070693_100035685
461 Ga0070704_100195821
462 Ga0068855_100077240
463 Ga0068855_100078338
464 Ga0068855_100394057
465 Ga0068855_100493178
466 Ga0068857_100044631
467 Ga0068857_100057188
468 Ga0068856_100045443
469 Ga0068856_100084559
470 Ga0068856_100373498
471 Ga0070702_100018413
472 Ga0070702_100088610
473 Ga0070702_100128530
474 Ga0068852_100028819
475 Ga0068852_100137064
476 Ga0068852_100182454
477 Ga0068860_100065492
478 Ga0075432_10000907
479 Ga0070715_10018155
480 Ga0070712_100016272
481 Ga0097621_100229172
482 Ga0068871_100032052
483 Ga0075428_100015136
484 Ga0075431_100026307
485 Ga0075433_10125804
486 Ga0075433_10172658
487 Ga0075434_100007881
488 Ga0075434_100084725
489 Ga0075434_100145444
490 Ga0075434_100157752
491 Ga0075436_100027005
492 Ga0075436_100029387
493 Ga0075436_100133860
494 Ga0075435_100024651
495 Ga0075435_100215508
496 Ga0105240_10098649
497 Ga0111539_10005978
498 Ga0105245_10177179
499 Ga0114129_10013491
500 Ga0114129_10080286
501 Ga0114129_10228951
502 Ga0105243_10370903
503 Ga0105241_10120806
504 Ga0105241_10419331
505 Ga0105242_10202724
506 Ga0105237_10076912
507 Ga0105238_10197847
508 Ga0105249_10196889
509 Ga0105239_10028588
510 Ga0105239_10222854
511 Ga0157371_10141759
512 Ga0157370_10014527
513 Ga0157370_10141531
514 Ga0157369_10266235
515 Ga0157369_10267836
516 Ga0157369_10628148
517 Ga0157374_10089326
518 Ga0157374_10515043
519 Ga0163162_10229922
520 Ga0157372_10015478
521 Ga0157372_10168844
522 Ga0157372_10363956
523 Ga0157372_10588895
524 Ga0157375_10206204
525 Ga0157375_10729845
526 Ga0157379_10281532
527 Ga0157376_10014378
528 Ga0157376_10157189
529 Ga0182007_10007129
530 Ga0207692_10027195
531 Ga0207685_10002840
532 Ga0207685_10055471
533 Ga0207705_10323801
534 Ga0207684_10074367
535 Ga0207684_10154609
536 Ga0207684_10223141
537 Ga0207654_10185430
538 Ga0207707_10004915
539 Ga0207707_10091455
540 Ga0207707_10112148
541 Ga0207695_10194255
542 Ga0207671_10101038
543 Ga0207693_10002521
544 Ga0207693_10032389
545 Ga0207660_10029344
546 Ga0207657_10022070
547 Ga0207657_10023872
548 Ga0207657_10054462
549 Ga0207649_10062024
550 Ga0207649_10151105
551 Ga0207646_10002458
552 Ga0207646_10387710
553 Ga0207700_10000004
554 Ga0207700_10420477
555 Ga0207664_10005773
556 Ga0207686_10212465
557 Ga0207661_10009294
558 Ga0207667_10329686
559 Ga0207668_10254686
560 Ga0207640_10258224
561 Ga0207677_10348827
562 Ga0207678_10046646
563 Ga0207678_10224164
564 Ga0207708_10018799
565 Ga0207702_10130659
566 Ga0207702_10144627
567 Ga0207648_10124702
568 Ga0207674_10035299
569 Ga0207674_10047762
570 Ga0207683_10002297
571 Ga0207683_10011772
572 Ga0207698_10082000
573 Ga0207698_10090646
574 Ga0207428_10004637
575 Ga0265318_10002390
576 Ga0265322_10012892
577 Ga0265338_10007766
578 Ga0265338_10009902
579 Ga0265330_10032496
580 Ga0265332_10050416
581 Ga0265320_10017983
582 Ga0265325_10077167
583 Ga0265329_10008294
584 Ga0265329_10011048
585 Ga0265339_10051625
586 Ga0265331_10062663
587 Ga0265327_10014855
588 Ga0265316_10011096
589 Ga0265316_10019374
590 Ga0265313_10007900
591 Ga0265314_10005549
592 Ga0265342_10027508
593 Ga0373948_0008889
594 Ga0373958_0000611
595 Ga0373938_0001932
596 Ga0373929_0000126
597 Ga0373944_0053881
598 Ga0373949_0003006
599 Ga0373951_0005721
600 Ga0373932_0009585
601 Ga0373939_0001749
602 Ga0373939_0002880
603 Ga0373941_0004717
604 Ga0373945_0061285
605 Ga0373960_0011296
606 Ga0373960_0012612
607 Ga0373943_0154077
608 Ga0373961_0001879
609 Ga0373962_0015793
610 Ga0373931_0007799
611 Ga0373947_0005765
612 Ga0373947_0176248
613 Ga0373937_0238138
614 Ga0373937_0664198
615 Ga0373925_0027734
616 Ga0395899_0003038
617 Ga0395899_0056805
618 Ga0395899_0058651
619 Ga0395899_0134497
620 Ga0395899_0150301
621 Ga0395899_0162720
622 Ga0395900_0001650
623 Ga0395900_0002208
624 Ga0395900_0004169
625 Ga0395900_0010867
626 Ga0395900_0024550
627 Ga0395900_0066648
628 Ga0395900_0186712
629 Ga0395900_0475600
630 Ga0395898_0003199
631 Ga0395898_0006394
632 Ga0395898_0009960
633 Ga0395898_0017446
634 Ga0395905_0003043
635 Ga0395905_0011305
636 Ga0395905_0022263
637 Ga0395905_0049336
638 Ga0395905_0083569
639 Ga0395905_0104325
640 Ga0395901_0001109
641 Ga0395901_0001415
642 Ga0395901_0003492
643 Ga0395901_0004074
644 Ga0395901_0020532
645 Ga0395901_0024304
646 Ga0395901_0082015
647 Ga0395901_0123605
648 Ga0395901_0191040
649 Ga0395901_0237987
650 Ga0451789_0841330
651 Ga0451795_1282916
652 Ga0451841_0156596
653 Ga0451853_0264222
654 Ga0466966_0027314
655 Ga0466966_0244260
656 Ga0466961_0013498
657 Ga0466961_0027117
658 Ga0466963_0000205
659 Ga0466963_0005844
660 Ga0466963_0009776
661 Ga0466963_0039439
662 Ga0466963_0042884
663 Ga0466963_0055141
664 Ga0466963_0102135
665 Ga0466963_0182988
666 Ga0466964_0002046
667 Ga0466964_0003856
668 Ga0466964_0069259
669 Ga0466971_0033376
670 Ga0466971_0044436
671 Ga0466968_0012723
672 Ga0466968_0095896
673 Ga0466968_0168892
674 Ga0466970_0025815
675 Ga0466957_0097974
676 Ga0466957_0101606
677 Ga0466957_0134146
678 Ga0466959_0006265
679 Ga0466959_0028515
680 Ga0466959_0029182
681 Ga0466959_0049998
682 Ga0466958_0005452
683 Ga0466958_0018696
684 Ga0466958_0028007
685 Ga0466958_0053207
686 Ga0466958_0133983
687 Ga0466958_0176754
688 Ga0466967_0000577
689 Ga0466967_0005636
690 Ga0466967_0016911
691 Ga0466967_0038424
692 Ga0466967_0042195
693 Ga0466967_0073762
694 Ga0466967_0080932
695 Ga0466967_0085285
696 Ga0466967_0180656
697 Ga0466967_0273011
698 Ga0466967_0284020
699 Ga0466967_0332648
700 Ga0495603_0008110
701 Ga0495641_0031381
702 Ga0495651_0353482
703 Ga0495653_0197588
704 Ga0495580_0068379
705 Ga0495582_0040610
706 Ga0495664_0029879
707 Ga0495584_0278628
708 Ga0495585_0095053
709 Ga0495608_0029047
710 Ga0495628_0306004
711 Ga0495630_0037793
712 Ga0495644_0003004
713 Ga0495652_0202193
714 Ga0495586_0016132
715 Ga0495656_0059261
716 Ga0495588_0059167
717 Ga0495657_0042033
718 Ga0495657_0052115
719 Ga0495599_0056626
720 Ga0495623_0036271
721 Ga0495658_0249191
722 Ga0495613_0057298
723 Ga0495624_0114451
724 Ga0495670_0019123
725 Ga0495600_0028653
726 Ga0495581_0090631
727 Ga0495674_0064777
728 Ga0495676_0007966
729 Ga0495680_0049906
730 Ga0495684_0070655
731 Ga0495602_0134301
732 Ga0496100_0008702
733 Ga0496100_0057227
734 Ga0496100_0292249
735 Ga0496100_0361122
736 Ga0496101_0004739
737 Ga0496101_0038563
738 Ga0496101_0121354
739 Ga0496102_0031338
740 Ga0496102_0058971
741 Ga0496102_0211954
742 Ga0496103_0036701
743 Ga0496103_0041661
744 Ga0496104_0003742
745 Ga0496104_0004753
746 Ga0496104_0106582
747 Ga0496104_0156708
748 Ga0496105_0014586
749 Ga0496105_0021371
750 Ga0496105_0058294
751 Ga0496105_0109629
752 Ga0496106_0003866
753 Ga0496106_0008337
754 Ga0496107_0010781
755 Ga0496107_0053038
756 Ga0496107_0123100
757 Ga0496107_0202445
758 Ga0496108_0187602
759 Ga0496108_0189218
760 Ga0496109_0000818
761 Ga0496109_0001803
762 Ga0496109_0034463
763 Ga0496109_0084445
764 Ga0496110_0036845
765 Ga0496110_0047487
766 Ga0496110_0084566
767 Ga0496111_0025733
768 Ga0496111_0048869
769 Ga0496111_0056827
770 Ga0496111_0095792
771 Ga0496111_0124161
772 Ga0496112_0081133
773 Ga0496112_0177615
774 Ga0496112_0277020
775 Ga0496112_0651669
776 Ga0496113_0004127
777 Ga0496114_0133277
778 Ga0496114_0189948
779 Ga0496115_0003647
780 Ga0496115_0067863
781 Ga0496115_0126489
782 Ga0496115_0164948
783 Ga0501031_0024438
784 Ga0501031_0036791
785 Ga0501036_0059363
786 Ga0501040_0027165
787 Ga0501040_0227308
788 Ga0501042_0039727
789 Ga0501042_0108492
790 Ga0501046_0112117
791 Ga0501067_0023247
792 Ga0501069_0010083
793 Ga0501069_0097057
794 Ga0501070_0193104
795 Ga0501071_0067754
796 Ga0501072_0310486
797 Ga0501074_0120958
798 Ga0501075_0003955
799 Ga0501076_0036023
800 Ga0501076_0109708
801 Ga0501077_0121839
802 Ga0501080_0038542
803 Ga0501080_0253510
804 Ga0501081_0097938
805 Ga0501045_0056016
806 nmdc:mga05p37_54257_c1
807 nmdc:mga06r32_9777_c1
808 nmdc:mga08y16_28666_c1
809 nmdc:mga0n895_16074_c1
810 nmdc:mga0n895_49559_c1
811 nmdc:mga0rr50_496351_c1
812 nmdc:mga08x19_104135_c1
813 nmdc:mga08x19_61237_c1
814 nmdc:mga0a205_226375_c1
815 nmdc:mga0a205_247852_c1
816 nmdc:mga0a205_445716_c1
817 Ga0495612_0024693
818 Ga0495619_0224117
819 Ga0501084_0046449
820 Ga0466962_0003562
821 Ga0530510_0009006
822 Ga0530510_0032994
823 Ga0530510_0106899
824 Ga0530510_0325841

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02774

Semialdhyde_dhC

Semialdehyde dehydrogenase, dimerisation domain

189

302

0.93

PF02774

Semialdhyde_dhC

Semialdehyde dehydrogenase, dimerisation domain

145

191

0.91

PF01118

Semialdhyde_dh

Semialdehyde dehydrogenase, NAD binding domain

25

127

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gyy-assembly2.cif.gz_C structure of aspartate semialdehyde dehydrogenase (asadh) from streptococcus pneumoniae 0.9309 37 295
3pwk-assembly1.cif.gz_B crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with 2',5'-adenosine diphosphate and d-2-aminoadipate 0.9245 5 295
3tz6-assembly1.cif.gz_A-2 crystal structure of aspartate semialdehyde dehydrogenase complexed with inhibitor smcs (cys) and phosphate from mycobacterium tuberculosis h37rv 0.9169 4 292
2qz9-assembly2.cif.gz_B-2 crystal structure of aspartate semialdehyde dehydrogenase ii from vibrio cholerae 0.9148 4 293
2gz3-assembly1.cif.gz_C structure of aspartate semialdehyde dehydrogenase (asadh) from streptococcus pneumoniae complexed with nadp and aspartate-semialdehyde 0.9148 5 295
ID Description Score Start End Superfamily
af_Q2FYP0_124_306_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9123 111 274 3.30.360.10
af_Q93Y73_167_356_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.911 111 274 3.30.360.10
3llgA02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9075 111 274 3.30.360.10
2gyyD02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9058 111 274 3.30.360.10
2yv3B02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.8952 111 274 3.30.360.10
ID Description Score Start End GO Terms
AF-A0A3E2CBT6-F1-model_v4 deleted 0.9878 175 294
AF-A0A6B3EKT9-F1-model_v4 Aspartate-semialdehyde dehydrogenase 0.9824 173 271 GO:0004073
GO:0009085
GO:0009086
GO:0019877
GO:0046983
GO:0050661
AF-A0A6B3HAE7-F1-model_v4 Aspartate-semialdehyde dehydrogenase 0.9823 183 296 GO:0004073
GO:0009085
GO:0009086
GO:0019877
GO:0046983
GO:0050661
AF-A0A7V9SVR7-F1-model_v4 Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11) 0.98 174 295 GO:0004073
GO:0008652
GO:0046983
AF-A0A399XXM2-F1-model_v4 deleted 0.9795 198 291

Map