F437666

General Info

Members Datasets Scaffolds Average Seq Length
411 260 411 143

Family's Representative Sequence

Representative Sequence 3300053098|Ga0500650_0261568|Ga0500650_0261568_138_668
Length 176
Sequence MSLLEARNLSQCPPQPSRVLEQVARIAQCKETDDMADKHTGTCFCGAVEIEVTGSPEVMGYCHCESCRSWSAGPVNAFTLWKPEAVKVTKGKEQLGMFAKNPSSERQFCKKCGGHVMTAHPGMGMTDVYAATIPSLAFKPGAHVSYAETVLHMKDGLPKFKDFPKEFGGSGEMAAE

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
139 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
141 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
142 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
143 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
144 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
147 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
148 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
151 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
154 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
155 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
156 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
159 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
171 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
172 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
173 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
174 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
175 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
176 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
177 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
180 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
181 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
182 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
183 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
184 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
185 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
186 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
189 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
190 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
191 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
192 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
193 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
194 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
195 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
196 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
197 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
198 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
199 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
200 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
201 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
202 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
203 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
204 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
205 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
206 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
207 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
208 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
209 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
210 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
211 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
212 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
213 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
214 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
229 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
230 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
231 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
232 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
236 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
237 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
238 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
239 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
240 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
241 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
242 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
243 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
244 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
245 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
246 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
247 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
248 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
249 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
250 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
251 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
252 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
253 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
254 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
255 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
256 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
257 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
258 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
259 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0.49
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.68
Nodule 0
Rhizoplane 3.41
Rhizosphere 91
Stem 0
Stem Tuber 0
Unclassified 2.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10000180 3300001989 Bacteria 21071
2 JGI24737J22298_10000337 3300001990 Bacteria 15722
3 JGI24735J21928_10009625 3300002067 Bacteria 3098
4 Ga0070658_11046956 3300005327 Bacteria 710
5 Ga0070676_10194925 3300005328 Unclassified 1325
6 Ga0070690_100589027 3300005330 Bacteria 843
7 Ga0070690_100793934 3300005330 Bacteria 734
8 Ga0070680_100010256 3300005336 Bacteria 7223
9 Ga0070682_100068134 3300005337 Bacteria 2268
10 Ga0068868_100994881 3300005338 Bacteria 767
11 Ga0070660_100003272 3300005339 Bacteria 11124
12 Ga0070660_100250731 3300005339 Bacteria 1443
13 Ga0070689_100418091 3300005340 Bacteria 1136
14 Ga0070689_100882099 3300005340 Bacteria 791
15 Ga0070661_100335216 3300005344 Bacteria 1184
16 Ga0070661_101532467 3300005344 Unclassified 563
17 Ga0070692_10512583 3300005345 Bacteria 779
18 Ga0070668_100019814 3300005347 Bacteria 5068
19 Ga0070669_100840989 3300005353 Bacteria 782
20 Ga0070671_100130694 3300005355 Bacteria 2115
21 Ga0070674_100139514 3300005356 Bacteria 1818
22 Ga0070674_100206065 3300005356 Bacteria 1521
23 Ga0070673_100184546 3300005364 Unclassified 1787
24 Ga0070688_101076683 3300005365 Bacteria 642
25 Ga0070659_100000803 3300005366 Bacteria 22895
26 Ga0070667_101052437 3300005367 Bacteria 760
27 Ga0070709_10299567 3300005434 Bacteria 1174
28 Ga0070714_100135975 3300005435 Bacteria 2201
29 Ga0070713_100965259 3300005436 Bacteria 821
30 Ga0070713_101577538 3300005436 Bacteria 637
31 Ga0070705_100250011 3300005440 Bacteria 1244
32 Ga0070700_100119183 3300005441 Bacteria 1766
33 Ga0070663_100077872 3300005455 Bacteria 2429
34 Ga0070678_100036614 3300005456 Bacteria 3436
35 Ga0070678_100237439 3300005456 Bacteria 1522
36 Ga0070662_100145874 3300005457 Bacteria 1838
37 Ga0070681_10008467 3300005458 Bacteria 10067
38 Ga0070681_10129251 3300005458 Bacteria 2458
39 Ga0068867_100077081 3300005459 Bacteria 2504
40 Ga0068867_100544349 3300005459 Bacteria 1004
41 Ga0070679_100026893 3300005530 Bacteria 5658
42 Ga0070684_101835972 3300005535 Bacteria 572
43 Ga0070697_100001453 3300005536 Bacteria 18039
44 Ga0068853_100026753 3300005539 Bacteria 4845
45 Ga0068853_100069270 3300005539 Bacteria 3068
46 Ga0068853_100922729 3300005539 Bacteria 839
47 Ga0068853_101104966 3300005539 Bacteria 764
48 Ga0070672_100059953 3300005543 Unclassified 2995
49 Ga0070672_100210920 3300005543 Bacteria 1627
50 Ga0070686_100160792 3300005544 Bacteria 1581
51 Ga0070686_101018943 3300005544 Unclassified 680
52 Ga0070695_100698641 3300005545 Bacteria 805
53 Ga0070696_101736027 3300005546 Unclassified 538
54 Ga0070665_100292286 3300005548 Bacteria 1632
55 Ga0068855_100040189 3300005563 Bacteria 5552
56 Ga0068855_100132240 3300005563 Bacteria 2848
57 Ga0068855_100160886 3300005563 Bacteria 2548
58 Ga0068855_100179118 3300005563 Bacteria 2397
59 Ga0068857_100002427 3300005577 Bacteria 15215
60 Ga0068854_100154061 3300005578 Bacteria 1774
61 Ga0068856_100151309 3300005614 Bacteria 2329
62 Ga0068856_100286955 3300005614 Bacteria 1663
63 Ga0068856_101746284 3300005614 Bacteria 634
64 Ga0070702_100199978 3300005615 Bacteria 1322
65 Ga0068852_100037903 3300005616 Bacteria 4046
66 Ga0068852_100050766 3300005616 Bacteria 3556
67 Ga0068852_101137101 3300005616 Bacteria 801
68 Ga0068861_100141575 3300005719 Bacteria 1963
69 Ga0068851_10163014 3300005834 Bacteria 1226
70 Ga0068858_100914162 3300005842 Bacteria 858
71 Ga0068860_100461522 3300005843 Bacteria 1264
72 Ga0081455_10032460 3300005937 Bacteria 4704
73 Ga0070715_10893990 3300006163 Bacteria 546
74 Ga0075427_10006965 3300006194 Unclassified 1654
75 Ga0097621_100649593 3300006237 Bacteria 968
76 Ga0068871_100614434 3300006358 Bacteria 989
77 Ga0075428_100023699 3300006844 Bacteria 6793
78 Ga0075430_100188735 3300006846 Unclassified 1713
79 Ga0075430_100200005 3300006846 Bacteria 1659
80 Ga0075431_100226293 3300006847 Bacteria 1907
81 Ga0075431_100290731 3300006847 Bacteria 1653
82 Ga0075431_100790752 3300006847 Unclassified 922
83 Ga0075431_101540936 3300006847 Bacteria 623
84 Ga0075433_10035178 3300006852 Bacteria 4306
85 Ga0075433_10221647 3300006852 Bacteria 1680
86 Ga0075433_10268113 3300006852 Unclassified 1513
87 Ga0075434_100065530 3300006871 Bacteria 3618
88 Ga0075434_100221089 3300006871 Bacteria 1914
89 Ga0075434_100304826 3300006871 Bacteria 1613
90 Ga0075434_100859540 3300006871 Unclassified 922
91 Ga0075429_100096170 3300006880 Bacteria 2583
92 Ga0075429_100350519 3300006880 Unclassified 1292
93 Ga0068865_100294154 3300006881 Bacteria 1297
94 Ga0068865_100980702 3300006881 Bacteria 739
95 Ga0075435_100059078 3300007076 Bacteria 3108
96 Ga0075435_100487351 3300007076 Bacteria 1065
97 Ga0099795_10025150 3300007788 Bacteria 1993
98 Ga0105240_10236328 3300009093 Bacteria 2121
99 Ga0105240_10266825 3300009093 Bacteria 1973
100 Ga0111539_11095934 3300009094 Unclassified 925
101 Ga0105245_10353425 3300009098 Bacteria 1457
102 Ga0105245_10438427 3300009098 Bacteria 1312
103 Ga0114129_10810730 3300009147 Bacteria 1193
104 Ga0114129_11425183 3300009147 Bacteria 854
105 Ga0114129_11922813 3300009147 Bacteria 717
106 Ga0105243_10297453 3300009148 Bacteria 1461
107 Ga0105241_10055267 3300009174 Bacteria 3041
108 Ga0105241_10383708 3300009174 Bacteria 1228
109 Ga0105241_10666990 3300009174 Bacteria 946
110 Ga0105241_11291262 3300009174 Bacteria 695
111 Ga0105242_10047362 3300009176 Bacteria 3490
112 Ga0105237_10057394 3300009545 Bacteria 3896
113 Ga0105237_10749043 3300009545 Bacteria 983
114 Ga0105238_10004368 3300009551 Bacteria 14023
115 Ga0105238_10013893 3300009551 Bacteria 8142
116 Ga0105238_12294631 3300009551 Bacteria 575
117 Ga0105249_10411501 3300009553 Bacteria 1384
118 Ga0099796_10132001 3300010159 Bacteria 969
119 Ga0105239_10002926 3300010375 Bacteria 21319
120 Ga0105239_10695716 3300010375 Bacteria 1162
121 Ga0105239_12345541 3300010375 Bacteria 621
122 Ga0105246_11843085 3300011119 Bacteria 579
123 Ga0157373_10010789 3300013100 Bacteria 6725
124 Ga0157373_10340969 3300013100 Bacteria 1068
125 Ga0157371_10006554 3300013102 Bacteria 9574
126 Ga0157371_10605255 3300013102 Bacteria 815
127 Ga0157370_10120443 3300013104 Bacteria 2450
128 Ga0157369_10220326 3300013105 Bacteria 1986
129 Ga0157369_10830019 3300013105 Bacteria 949
130 Ga0157374_10271211 3300013296 Bacteria 1673
131 Ga0157378_10375072 3300013297 Bacteria 1396
132 Ga0157378_10482110 3300013297 Bacteria 1236
133 Ga0157378_10518597 3300013297 Bacteria 1193
134 Ga0163162_10304626 3300013306 Bacteria 1726
135 Ga0163162_10382035 3300013306 Bacteria 1542
136 Ga0157372_10054142 3300013307 Bacteria 4475
137 Ga0157372_10124959 3300013307 Bacteria 2958
138 Ga0157372_10654443 3300013307 Bacteria 1223
139 Ga0157372_10982239 3300013307 Bacteria 978
140 Ga0157375_10202769 3300013308 Bacteria 2140
141 Ga0157375_11836032 3300013308 Bacteria 719
142 Ga0163163_11279282 3300014325 Bacteria 796
143 Ga0157380_10134947 3300014326 Bacteria 2111
144 Ga0157380_10303508 3300014326 Bacteria 1472
145 Ga0157376_10085862 3300014969 Bacteria 2712
146 Ga0157376_10248424 3300014969 Bacteria 1660
147 Ga0157376_10919807 3300014969 Unclassified 894
148 Ga0213874_10052117 3300021377 Unclassified 1258
149 Ga0213876_10094051 3300021384 Bacteria 1588
150 Ga0228598_1001607 3300024227 Bacteria 4942
151 Ga0207697_10447936 3300025315 Bacteria 572
152 Ga0207656_10051594 3300025321 Bacteria 1779
153 Ga0207688_11004015 3300025901 Bacteria 527
154 Ga0207647_10000734 3300025904 Bacteria 25696
155 Ga0207647_10064875 3300025904 Bacteria 2218
156 Ga0207645_10339104 3300025907 Bacteria 1005
157 Ga0207645_10528536 3300025907 Bacteria 799
158 Ga0207705_10030370 3300025909 Bacteria 3856
159 Ga0207654_10163965 3300025911 Bacteria 1438
160 Ga0207707_10024697 3300025912 Bacteria 5258
161 Ga0207671_10142576 3300025914 Bacteria 1847
162 Ga0207693_10045428 3300025915 Bacteria 3451
163 Ga0207663_10188068 3300025916 Bacteria 1481
164 Ga0207660_10075034 3300025917 Bacteria 2469
165 Ga0207660_10248794 3300025917 Bacteria 1403
166 Ga0207657_10004676 3300025919 Bacteria 14449
167 Ga0207657_10093862 3300025919 Bacteria 2499
168 Ga0207649_10168651 3300025920 Bacteria 1523
169 Ga0207652_10006960 3300025921 Bacteria 9111
170 Ga0207694_10025994 3300025924 Bacteria 4451
171 Ga0207694_10081860 3300025924 Bacteria 2537
172 Ga0207694_10642205 3300025924 Bacteria 894
173 Ga0207659_10435763 3300025926 Bacteria 1102
174 Ga0207687_10656736 3300025927 Bacteria 887
175 Ga0207687_11688608 3300025927 Bacteria 543
176 Ga0207664_10042991 3300025929 Bacteria 3531
177 Ga0207644_10356401 3300025931 Bacteria 1189
178 Ga0207644_10566785 3300025931 Bacteria 941
179 Ga0207644_10853181 3300025931 Bacteria 763
180 Ga0207690_10452404 3300025932 Bacteria 1032
181 Ga0207706_10087388 3300025933 Bacteria 2741
182 Ga0207706_10291121 3300025933 Bacteria 1424
183 Ga0207686_10119000 3300025934 Bacteria 1795
184 Ga0207709_10095304 3300025935 Bacteria 1955
185 Ga0207669_10017640 3300025937 Bacteria 3668
186 Ga0207669_10092648 3300025937 Bacteria 1972
187 Ga0207691_10194055 3300025940 Bacteria 1770
188 Ga0207667_10062727 3300025949 Bacteria 3885
189 Ga0207667_10077450 3300025949 Bacteria 3448
190 Ga0207667_10115611 3300025949 Bacteria 2765
191 Ga0207651_10236518 3300025960 Bacteria 1486
192 Ga0207712_10219632 3300025961 Bacteria 1519
193 Ga0207668_10014608 3300025972 Bacteria 4861
194 Ga0207668_10506128 3300025972 Bacteria 1040
195 Ga0207640_10053631 3300025981 Bacteria 2633
196 Ga0207658_10204420 3300025986 Bacteria 1651
197 Ga0207658_11163679 3300025986 Bacteria 705
198 Ga0207658_11260281 3300025986 Bacteria 676
199 Ga0207677_11785482 3300026023 Bacteria 571
200 Ga0207639_10017686 3300026041 Bacteria 5054
201 Ga0207639_10593145 3300026041 Bacteria 1021
202 Ga0207678_10015417 3300026067 Bacteria 6720
203 Ga0207708_10898118 3300026075 Bacteria 767
204 Ga0207702_10055499 3300026078 Bacteria 3360
205 Ga0207641_10894029 3300026088 Bacteria 882
206 Ga0207648_10008036 3300026089 Bacteria 10279
207 Ga0207674_10011037 3300026116 Bacteria 10160
208 Ga0207674_10077631 3300026116 Bacteria 3326
209 Ga0207675_100093709 3300026118 Bacteria 2825
210 Ga0207675_100480819 3300026118 Bacteria 1234
211 Ga0207683_10046847 3300026121 Bacteria 3785
212 Ga0207683_10146543 3300026121 Bacteria 2129
213 Ga0207683_10686645 3300026121 Bacteria 949
214 Ga0207683_11076193 3300026121 Bacteria 746
215 Ga0207698_10017948 3300026142 Bacteria 4811
216 Ga0207698_10108819 3300026142 Bacteria 2317
217 Ga0207698_10124496 3300026142 Bacteria 2189
218 Ga0207698_10183447 3300026142 Bacteria 1856
219 Ga0207698_11576563 3300026142 Bacteria 672
220 Ga0207428_10011586 3300027907 Bacteria 7784
221 Ga0207428_10295825 3300027907 Bacteria 1199
222 Ga0268264_10251998 3300028381 Bacteria 1640
223 Ga0307517_10281871 3300028786 Bacteria 947
224 Ga0265763_1012068 3300030763 Bacteria 819
225 Ga0265325_10008917 3300031241 Bacteria 5892
226 Ga0265339_10006059 3300031249 Bacteria 7984
227 Ga0265339_10109174 3300031249 Bacteria 1433
228 Ga0265339_10125023 3300031249 Bacteria 1319
229 Ga0265316_10143446 3300031344 Bacteria 1792
230 Ga0265316_11064402 3300031344 Bacteria 562
231 Ga0265313_10003021 3300031595 Bacteria 13990
232 Ga0307508_10074032 3300031616 Bacteria 2982
233 Ga0265314_10033010 3300031711 Bacteria 3802
234 Ga0265314_10492198 3300031711 Bacteria 647
235 Ga0265342_10000912 3300031712 Bacteria 29335
236 Ga0307516_10092759 3300031730 Bacteria 2846
237 Ga0307516_10182317 3300031730 Bacteria 1832
238 Ga0316577_10178946 3300031733 Bacteria 1198
239 Ga0307416_101168850 3300032002 Bacteria 875
240 Ga0373951_0293157 3300035091 Bacteria 500
241 Ga0373923_0108605 3300035111 Bacteria 1230
242 Ga0373923_0686773 3300035111 Bacteria 508
243 Ga0373936_0041945 3300035113 Bacteria 1836
244 Ga0373939_0093614 3300035114 Bacteria 1020
245 Ga0373945_0334692 3300035116 Bacteria 654
246 Ga0373945_0513384 3300035116 Bacteria 535
247 Ga0373954_0211914 3300035118 Bacteria 952
248 Ga0373957_0028813 3300035120 Bacteria 2026
249 Ga0373943_0067593 3300035170 Unclassified 1803
250 Ga0373955_0081348 3300035172 Bacteria 1831
251 Ga0373955_0089608 3300035172 Unclassified 1751
252 Ga0373955_0271670 3300035172 Bacteria 1019
253 Ga0373955_0297343 3300035172 Bacteria 973
254 Ga0373955_0921847 3300035172 Bacteria 538
255 Ga0373924_0209150 3300035410 Bacteria 861
256 Ga0373935_0071456 3300035692 Bacteria 2239
257 Ga0373935_0088504 3300035692 Bacteria 2023
258 Ga0373935_0291733 3300035692 Unclassified 1151
259 Ga0373927_0028230 3300035695 Bacteria 3660
260 Ga0373933_0086541 3300035724 Bacteria 1929
261 Ga0373947_0057877 3300035725 Bacteria 2347
262 Ga0373947_0067066 3300035725 Bacteria 2191
263 Ga0373947_0279403 3300035725 Bacteria 1110
264 Ga0373947_0304285 3300035725 Bacteria 1064
265 Ga0373937_0039704 3300036401 Bacteria 4289
266 Ga0373937_0135870 3300036401 Bacteria 2299
267 Ga0316582_0082963 3300036647 Bacteria 2096
268 Ga0373925_0043013 3300037068 Bacteria 3352
269 Ga0373925_0204363 3300037068 Bacteria 1572
270 Ga0373925_0333287 3300037068 Bacteria 1230
271 Ga0395905_1702174 3300037471 Bacteria 536
272 Ga0395901_0388625 3300038443 Bacteria 1435
273 Ga0436365_1772565 3300039437 Bacteria 1731
274 Ga0436363_0947573 3300039450 Bacteria 1836
275 Ga0436363_1241725 3300039450 Bacteria 2910
276 Ga0451789_0939681 3300041443 Bacteria 1226
277 Ga0451804_0274167 3300041463 Bacteria 864
278 Ga0451833_0676821 3300041491 Bacteria 1355
279 Ga0451855_1824513 3300041511 Bacteria 613
280 Ga0439463_108162 3300042016 Bacteria 718
281 Ga0466972_0010306 3300044658 Bacteria 4693
282 Ga0466963_0429363 3300044694 Bacteria 932
283 Ga0466967_0389608 3300045976 Unclassified 1354
284 Ga0495592_0110374 3300046454 Bacteria 1947
285 Ga0495592_0334126 3300046454 Bacteria 976
286 Ga0495603_0103512 3300046455 Bacteria 1662
287 Ga0495629_0064942 3300046459 Bacteria 2548
288 Ga0495629_0125132 3300046459 Unclassified 1791
289 Ga0495641_0337701 3300046461 Unclassified 681
290 Ga0495580_0089919 3300046472 Bacteria 2138
291 Ga0495580_0268017 3300046472 Unclassified 1167
292 Ga0495582_0138392 3300046473 Bacteria 1379
293 Ga0495582_0758032 3300046473 Bacteria 562
294 Ga0495639_0126045 3300046475 Bacteria 1224
295 Ga0495628_0639860 3300046516 Bacteria 756
296 Ga0495628_0854334 3300046516 Unclassified 634
297 Ga0495630_0116402 3300046517 Bacteria 2026
298 Ga0495630_0337742 3300046517 Bacteria 1152
299 Ga0495630_0957078 3300046517 Bacteria 651
300 Ga0495644_0191699 3300046523 Bacteria 787
301 Ga0495652_0865058 3300046529 Bacteria 598
302 Ga0495665_0195843 3300046531 Bacteria 1048
303 Ga0495640_0063313 3300046533 Bacteria 2506
304 Ga0495640_0074923 3300046533 Bacteria 2261
305 Ga0495640_0497836 3300046533 Bacteria 742
306 Ga0495587_0283748 3300046536 Bacteria 928
307 Ga0495645_0140559 3300046543 Bacteria 1685
308 Ga0495667_0367521 3300046559 Bacteria 908
309 Ga0495656_0150580 3300046615 Bacteria 1123
310 Ga0495634_0235800 3300046642 Bacteria 1124
311 Ga0495634_0777555 3300046642 Unclassified 547
312 Ga0495635_0145402 3300046663 Bacteria 1614
313 Ga0495635_0796731 3300046663 Unclassified 609
314 Ga0495599_0363439 3300046678 Bacteria 866
315 Ga0495646_0091746 3300046680 Bacteria 1753
316 Ga0495647_0158185 3300046681 Unclassified 975
317 Ga0495658_0071556 3300046683 Bacteria 2015
318 Ga0495658_0665040 3300046683 Bacteria 667
319 Ga0495669_0019490 3300046684 Bacteria 2928
320 Ga0495613_0078482 3300046689 Bacteria 2402
321 Ga0495624_0250811 3300046690 Bacteria 1070
322 Ga0495624_0630707 3300046690 Unclassified 638
323 Ga0495671_0258104 3300046692 Bacteria 841
324 Ga0495589_0060924 3300046794 Bacteria 1853
325 Ga0495581_0264949 3300047315 Bacteria 1005
326 Ga0495674_0015593 3300047319 Bacteria 7098
327 Ga0495674_0967713 3300047319 Unclassified 654
328 Ga0495677_0117723 3300047445 Bacteria 1012
329 Ga0495685_117353 3300047447 Bacteria 874
330 Ga0495684_0159352 3300047471 Bacteria 1684
331 Ga0495684_0250711 3300047471 Bacteria 1288
332 Ga0495684_0275726 3300047471 Bacteria 1215
333 Ga0495593_0116982 3300047673 Bacteria 1358
334 Ga0495614_0115468 3300048089 Bacteria 1181
335 Ga0496100_0718148 3300048903 Bacteria 780
336 Ga0496101_0176128 3300048904 Bacteria 1645
337 Ga0496102_0172360 3300048905 Bacteria 2037
338 Ga0496102_0418449 3300048905 Bacteria 1259
339 Ga0496105_0116129 3300048908 Bacteria 2208
340 Ga0496105_0884406 3300048908 Bacteria 674
341 Ga0496106_0219245 3300048909 Bacteria 1517
342 Ga0496106_0720885 3300048909 Bacteria 794
343 Ga0496112_0098341 3300048915 Bacteria 2896
344 Ga0496114_0300558 3300048917 Bacteria 1417
345 Ga0496115_0030075 3300048918 Bacteria 4270
346 Ga0496115_0135917 3300048918 Bacteria 2027
347 Ga0496126_0063844 3300048929 Bacteria 3300
348 Ga0501034_0184272 3300049571 Bacteria 2052
349 Ga0501034_0461465 3300049571 Bacteria 1187
350 Ga0501036_0728526 3300049572 Bacteria 819
351 Ga0501038_0229214 3300049574 Bacteria 1479
352 Ga0501043_0285538 3300049579 Bacteria 1264
353 Ga0501043_0458509 3300049579 Bacteria 957
354 Ga0501047_0014095 3300049581 Bacteria 7597
355 Ga0501047_0288852 3300049581 Bacteria 1484
356 Ga0501047_0310217 3300049581 Bacteria 1418
357 Ga0501070_0403904 3300049586 Bacteria 1105
358 Ga0501073_0033942 3300049589 Bacteria 3632
359 Ga0501073_0056541 3300049589 Bacteria 2744
360 Ga0501073_0066578 3300049589 Bacteria 2511
361 Ga0501074_0043786 3300049590 Bacteria 3240
362 Ga0501080_0829451 3300049742 Bacteria 809
363 Ga0501080_1125784 3300049742 Bacteria 677
364 Ga0501080_1458686 3300049742 Bacteria 582
365 Ga0501083_0163690 3300049744 Bacteria 1455
366 Ga0501035_0172435 3300049822 Bacteria 1868
367 Ga0501035_0350762 3300049822 Bacteria 1235
368 Ga0501044_0024082 3300049823 Bacteria 6468
369 Ga0501044_0762407 3300049823 Bacteria 849
370 Ga0501044_0773985 3300049823 Bacteria 840
371 nmdc:mga06z11_42211_c1 3300050494 Bacteria 2286
372 nmdc:mga04h51_347735_c1 3300050495 Bacteria 612
373 nmdc:mga05p37_1088629_c1 3300050507 Bacteria 838
374 nmdc:mga05p37_1872811_c1 3300050507 Bacteria 574
375 nmdc:mga05p37_515745_c1 3300050507 Bacteria 1369
376 nmdc:mga09592_20908_c1 3300050508 Bacteria 5390
377 nmdc:mga0qj67_12287_c1 3300050509 Bacteria 6449
378 nmdc:mga06r32_1214783_c1 3300050510 Bacteria 700
379 nmdc:mga06r32_202713_c1 3300050510 Bacteria 1972
380 nmdc:mga06r32_82264_c1 3300050510 Bacteria 3136
381 nmdc:mga08y16_43969_c1 3300050511 Bacteria 4680
382 nmdc:mga08y16_455898_c1 3300050511 Unclassified 1304
383 nmdc:mga0n895_24628_c1 3300050512 Bacteria 5675
384 nmdc:mga0n895_298744_c1 3300050512 Bacteria 1632
385 nmdc:mga0n895_305436_c1 3300050512 Bacteria 1613
386 nmdc:mga0n895_568599_c1 3300050512 Bacteria 1138
387 nmdc:mga0n895_88820_c1 3300050512 Bacteria 3091
388 nmdc:mga0n895_925823_c1 3300050512 Bacteria 856
389 nmdc:mga0rr50_783357_c1 3300050513 Bacteria 814
390 nmdc:mga08x19_35_c1 3300050514 Bacteria 185171
391 nmdc:mga0a205_242488_c1 3300050515 Bacteria 1683
392 nmdc:mga0a205_55312_c1 3300050515 Bacteria 3833
393 nmdc:mga0a205_97802_c1 3300050515 Bacteria 2834
394 Ga0495601_0125374 3300053077 Unclassified 1670
395 Ga0495601_0201453 3300053077 Unclassified 1300
396 Ga0495601_0212512 3300053077 Bacteria 1264
397 Ga0495601_0244759 3300053077 Bacteria 1171
398 Ga0495612_0092017 3300053078 Unclassified 1285
399 Ga0495595_0430072 3300053084 Unclassified 670
400 Ga0495619_0370124 3300053085 Bacteria 990
401 Ga0500644_0436382 3300053088 Bacteria 573
402 Ga0500646_0040983 3300053090 Bacteria 1304
403 Ga0500650_0261568 3300053098 Bacteria 774
404 Ga0500642_0000752 3300053130 Bacteria 9515
405 Ga0500658_0092179 3300053134 Bacteria 1312
406 Ga0500568_0004493 3300053139 Bacteria 7433
407 Ga0500588_0001355 3300053146 Bacteria 4628
408 Ga0500633_0262882 3300053160 Bacteria 640
409 Ga0500609_001735 3300053731 Bacteria 3161
410 Ga0587109_194091 3300059624 Bacteria 525
411 Ga0501082_0000544 3300060353 Bacteria 33528

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025907 Ga0207645_10339104 Ga0207645_103391042 129
2 3300001989 JGI24739J22299_10000180 JGI24739J22299_100001803 141
3 3300001990 JGI24737J22298_10000337 JGI24737J22298_100003374 141
4 3300002067 JGI24735J21928_10009625 JGI24735J21928_100096252 141
5 3300005327 Ga0070658_11046956 Ga0070658_110469561 141
6 3300005328 Ga0070676_10194925 Ga0070676_101949253 141
7 3300005330 Ga0070690_100589027 Ga0070690_1005890271 141
8 3300005330 Ga0070690_100793934 Ga0070690_1007939341 141
9 3300005336 Ga0070680_100010256 Ga0070680_1000102567 141
10 3300005337 Ga0070682_100068134 Ga0070682_1000681344 141
11 3300005338 Ga0068868_100994881 Ga0068868_1009948812 141
12 3300005339 Ga0070660_100003272 Ga0070660_1000032728 141
13 3300005339 Ga0070660_100250731 Ga0070660_1002507314 141
14 3300005340 Ga0070689_100418091 Ga0070689_1004180913 141
15 3300005340 Ga0070689_100882099 Ga0070689_1008820991 141
16 3300005344 Ga0070661_100335216 Ga0070661_1003352162 141
17 3300005344 Ga0070661_101532467 Ga0070661_1015324671 141
18 3300005345 Ga0070692_10512583 Ga0070692_105125832 141
19 3300005347 Ga0070668_100019814 Ga0070668_1000198143 141
20 3300005353 Ga0070669_100840989 Ga0070669_1008409891 141
21 3300005355 Ga0070671_100130694 Ga0070671_1001306942 141
22 3300005356 Ga0070674_100139514 Ga0070674_1001395143 141
23 3300005356 Ga0070674_100206065 Ga0070674_1002060651 141
24 3300005364 Ga0070673_100184546 Ga0070673_1001845461 141
25 3300005365 Ga0070688_101076683 Ga0070688_1010766831 141
26 3300005366 Ga0070659_100000803 Ga0070659_10000080310 141
27 3300005367 Ga0070667_101052437 Ga0070667_1010524372 141
28 3300005434 Ga0070709_10299567 Ga0070709_102995672 141
29 3300005435 Ga0070714_100135975 Ga0070714_1001359752 141
30 3300005436 Ga0070713_100965259 Ga0070713_1009652591 141
31 3300005436 Ga0070713_101577538 Ga0070713_1015775381 141
32 3300005440 Ga0070705_100250011 Ga0070705_1002500112 141
33 3300005441 Ga0070700_100119183 Ga0070700_1001191832 141
34 3300005455 Ga0070663_100077872 Ga0070663_1000778721 141
35 3300005456 Ga0070678_100036614 Ga0070678_1000366143 141
36 3300005456 Ga0070678_100237439 Ga0070678_1002374394 141
37 3300005457 Ga0070662_100145874 Ga0070662_1001458742 141
38 3300005458 Ga0070681_10008467 Ga0070681_1000846710 141
39 3300005458 Ga0070681_10129251 Ga0070681_101292515 141
40 3300005459 Ga0068867_100077081 Ga0068867_1000770813 141
41 3300005459 Ga0068867_100544349 Ga0068867_1005443492 141
42 3300005530 Ga0070679_100026893 Ga0070679_1000268938 141
43 3300005535 Ga0070684_101835972 Ga0070684_1018359721 141
44 3300005536 Ga0070697_100001453 Ga0070697_1000014539 141
45 3300005539 Ga0068853_100026753 Ga0068853_1000267532 141
46 3300005539 Ga0068853_100069270 Ga0068853_1000692702 141
47 3300005539 Ga0068853_100922729 Ga0068853_1009227291 141
48 3300005539 Ga0068853_101104966 Ga0068853_1011049661 141
49 3300005543 Ga0070672_100059953 Ga0070672_1000599533 141
50 3300005543 Ga0070672_100210920 Ga0070672_1002109202 141
51 3300005544 Ga0070686_100160792 Ga0070686_1001607921 141
52 3300005544 Ga0070686_101018943 Ga0070686_1010189431 141
53 3300005545 Ga0070695_100698641 Ga0070695_1006986411 141
54 3300005546 Ga0070696_101736027 Ga0070696_1017360271 141
55 3300005548 Ga0070665_100292286 Ga0070665_1002922862 141
56 3300005563 Ga0068855_100040189 Ga0068855_1000401893 141
57 3300005563 Ga0068855_100132240 Ga0068855_1001322402 141
58 3300005563 Ga0068855_100160886 Ga0068855_1001608862 141
59 3300005563 Ga0068855_100179118 Ga0068855_1001791184 141
60 3300005577 Ga0068857_100002427 Ga0068857_1000024274 141
61 3300005578 Ga0068854_100154061 Ga0068854_1001540612 141
62 3300005614 Ga0068856_100151309 Ga0068856_1001513092 141
63 3300005614 Ga0068856_100286955 Ga0068856_1002869553 141
64 3300005614 Ga0068856_101746284 Ga0068856_1017462841 141
65 3300005615 Ga0070702_100199978 Ga0070702_1001999782 141
66 3300005616 Ga0068852_100037903 Ga0068852_1000379032 141
67 3300005616 Ga0068852_100050766 Ga0068852_1000507663 141
68 3300005616 Ga0068852_101137101 Ga0068852_1011371011 141
69 3300005719 Ga0068861_100141575 Ga0068861_1001415753 141
70 3300005834 Ga0068851_10163014 Ga0068851_101630142 141
71 3300005842 Ga0068858_100914162 Ga0068858_1009141621 141
72 3300005843 Ga0068860_100461522 Ga0068860_1004615223 141
73 3300005937 Ga0081455_10032460 Ga0081455_100324602 141
74 3300006163 Ga0070715_10893990 Ga0070715_108939902 141
75 3300006194 Ga0075427_10006965 Ga0075427_100069654 141
76 3300006237 Ga0097621_100649593 Ga0097621_1006495932 141
77 3300006358 Ga0068871_100614434 Ga0068871_1006144342 141
78 3300006844 Ga0075428_100023699 Ga0075428_1000236998 141
79 3300006846 Ga0075430_100188735 Ga0075430_1001887353 141
80 3300006846 Ga0075430_100200005 Ga0075430_1002000052 141
81 3300006847 Ga0075431_100226293 Ga0075431_1002262932 141
82 3300006847 Ga0075431_100290731 Ga0075431_1002907312 141
83 3300006847 Ga0075431_100790752 Ga0075431_1007907522 141
84 3300006847 Ga0075431_101540936 Ga0075431_1015409361 141
85 3300006852 Ga0075433_10035178 Ga0075433_100351784 141
86 3300006852 Ga0075433_10221647 Ga0075433_102216472 141
87 3300006852 Ga0075433_10268113 Ga0075433_102681132 141
88 3300006871 Ga0075434_100065530 Ga0075434_1000655303 141
89 3300006871 Ga0075434_100221089 Ga0075434_1002210893 141
90 3300006871 Ga0075434_100304826 Ga0075434_1003048264 141
91 3300006871 Ga0075434_100859540 Ga0075434_1008595402 141
92 3300006880 Ga0075429_100096170 Ga0075429_1000961702 141
93 3300006880 Ga0075429_100350519 Ga0075429_1003505192 141
94 3300006881 Ga0068865_100294154 Ga0068865_1002941541 141
95 3300006881 Ga0068865_100980702 Ga0068865_1009807021 141
96 3300007076 Ga0075435_100059078 Ga0075435_1000590781 141
97 3300007076 Ga0075435_100487351 Ga0075435_1004873512 141
98 3300007788 Ga0099795_10025150 Ga0099795_100251502 141
99 3300009093 Ga0105240_10236328 Ga0105240_102363282 141
100 3300009093 Ga0105240_10266825 Ga0105240_102668252 141
101 3300009094 Ga0111539_11095934 Ga0111539_110959342 141
102 3300009098 Ga0105245_10353425 Ga0105245_103534253 141
103 3300009098 Ga0105245_10438427 Ga0105245_104384273 141
104 3300009147 Ga0114129_10810730 Ga0114129_108107302 141
105 3300009147 Ga0114129_11425183 Ga0114129_114251832 141
106 3300009147 Ga0114129_11922813 Ga0114129_119228131 141
107 3300009148 Ga0105243_10297453 Ga0105243_102974534 141
108 3300009174 Ga0105241_10055267 Ga0105241_100552675 141
109 3300009174 Ga0105241_10383708 Ga0105241_103837081 141
110 3300009174 Ga0105241_10666990 Ga0105241_106669901 141
111 3300009174 Ga0105241_11291262 Ga0105241_112912621 141
112 3300009176 Ga0105242_10047362 Ga0105242_100473624 141
113 3300009545 Ga0105237_10057394 Ga0105237_100573942 141
114 3300009545 Ga0105237_10749043 Ga0105237_107490431 141
115 3300009551 Ga0105238_10004368 Ga0105238_100043685 141
116 3300009551 Ga0105238_10013893 Ga0105238_100138934 141
117 3300009551 Ga0105238_12294631 Ga0105238_122946311 141
118 3300009553 Ga0105249_10411501 Ga0105249_104115012 141
119 3300010159 Ga0099796_10132001 Ga0099796_101320011 141
120 3300010375 Ga0105239_10002926 Ga0105239_1000292615 141
121 3300010375 Ga0105239_10695716 Ga0105239_106957162 141
122 3300010375 Ga0105239_12345541 Ga0105239_123455411 141
123 3300011119 Ga0105246_11843085 Ga0105246_118430851 141
124 3300013100 Ga0157373_10010789 Ga0157373_100107894 141
125 3300013100 Ga0157373_10340969 Ga0157373_103409692 141
126 3300013102 Ga0157371_10006554 Ga0157371_100065548 141
127 3300013102 Ga0157371_10605255 Ga0157371_106052552 141
128 3300013104 Ga0157370_10120443 Ga0157370_101204432 141
129 3300013105 Ga0157369_10220326 Ga0157369_102203262 141
130 3300013105 Ga0157369_10830019 Ga0157369_108300191 141
131 3300013296 Ga0157374_10271211 Ga0157374_102712113 141
132 3300013297 Ga0157378_10375072 Ga0157378_103750722 141
133 3300013297 Ga0157378_10482110 Ga0157378_104821103 141
134 3300013297 Ga0157378_10518597 Ga0157378_105185971 141
135 3300013306 Ga0163162_10304626 Ga0163162_103046263 141
136 3300013306 Ga0163162_10382035 Ga0163162_103820351 141
137 3300013307 Ga0157372_10054142 Ga0157372_100541426 141
138 3300013307 Ga0157372_10124959 Ga0157372_101249592 141
139 3300013307 Ga0157372_10654443 Ga0157372_106544431 141
140 3300013307 Ga0157372_10982239 Ga0157372_109822392 141
141 3300013308 Ga0157375_10202769 Ga0157375_102027693 141
142 3300013308 Ga0157375_11836032 Ga0157375_118360322 141
143 3300014325 Ga0163163_11279282 Ga0163163_112792821 141
144 3300014326 Ga0157380_10134947 Ga0157380_101349473 141
145 3300014326 Ga0157380_10303508 Ga0157380_103035082 141
146 3300014969 Ga0157376_10085862 Ga0157376_100858622 141
147 3300014969 Ga0157376_10248424 Ga0157376_102484242 141
148 3300014969 Ga0157376_10919807 Ga0157376_109198072 141
149 3300021377 Ga0213874_10052117 Ga0213874_100521172 141
150 3300021384 Ga0213876_10094051 Ga0213876_100940511 141
151 3300024227 Ga0228598_1001607 Ga0228598_10016071 141
152 3300025315 Ga0207697_10447936 Ga0207697_104479361 141
153 3300025321 Ga0207656_10051594 Ga0207656_100515942 141
154 3300025901 Ga0207688_11004015 Ga0207688_110040151 141
155 3300025904 Ga0207647_10000734 Ga0207647_1000073422 141
156 3300025904 Ga0207647_10064875 Ga0207647_100648752 141
157 3300025907 Ga0207645_10528536 Ga0207645_105285361 141
158 3300025909 Ga0207705_10030370 Ga0207705_100303703 141
159 3300025911 Ga0207654_10163965 Ga0207654_101639652 141
160 3300025912 Ga0207707_10024697 Ga0207707_100246972 141
161 3300025914 Ga0207671_10142576 Ga0207671_101425761 141
162 3300025915 Ga0207693_10045428 Ga0207693_100454284 141
163 3300025916 Ga0207663_10188068 Ga0207663_101880682 141
164 3300025917 Ga0207660_10075034 Ga0207660_100750343 141
165 3300025917 Ga0207660_10248794 Ga0207660_102487941 141
166 3300025919 Ga0207657_10004676 Ga0207657_100046768 141
167 3300025919 Ga0207657_10093862 Ga0207657_100938621 141
168 3300025920 Ga0207649_10168651 Ga0207649_101686512 141
169 3300025921 Ga0207652_10006960 Ga0207652_100069602 141
170 3300025924 Ga0207694_10025994 Ga0207694_100259947 141
171 3300025924 Ga0207694_10081860 Ga0207694_100818602 141
172 3300025924 Ga0207694_10642205 Ga0207694_106422052 141
173 3300025926 Ga0207659_10435763 Ga0207659_104357632 141
174 3300025927 Ga0207687_10656736 Ga0207687_106567361 141
175 3300025927 Ga0207687_11688608 Ga0207687_116886081 141
176 3300025929 Ga0207664_10042991 Ga0207664_100429915 141
177 3300025931 Ga0207644_10356401 Ga0207644_103564011 141
178 3300025931 Ga0207644_10566785 Ga0207644_105667852 141
179 3300025931 Ga0207644_10853181 Ga0207644_108531812 141
180 3300025932 Ga0207690_10452404 Ga0207690_104524041 141
181 3300025933 Ga0207706_10087388 Ga0207706_100873883 141
182 3300025933 Ga0207706_10291121 Ga0207706_102911212 141
183 3300025934 Ga0207686_10119000 Ga0207686_101190001 141
184 3300025935 Ga0207709_10095304 Ga0207709_100953043 141
185 3300025937 Ga0207669_10017640 Ga0207669_100176403 141
186 3300025937 Ga0207669_10092648 Ga0207669_100926481 141
187 3300025940 Ga0207691_10194055 Ga0207691_101940552 141
188 3300025949 Ga0207667_10062727 Ga0207667_100627273 141
189 3300025949 Ga0207667_10077450 Ga0207667_100774504 141
190 3300025949 Ga0207667_10115611 Ga0207667_101156112 141
191 3300025960 Ga0207651_10236518 Ga0207651_102365183 141
192 3300025961 Ga0207712_10219632 Ga0207712_102196322 141
193 3300025972 Ga0207668_10014608 Ga0207668_100146083 141
194 3300025972 Ga0207668_10506128 Ga0207668_105061281 141
195 3300025981 Ga0207640_10053631 Ga0207640_100536312 141
196 3300025986 Ga0207658_10204420 Ga0207658_102044203 141
197 3300025986 Ga0207658_11163679 Ga0207658_111636791 141
198 3300025986 Ga0207658_11260281 Ga0207658_112602811 141
199 3300026023 Ga0207677_11785482 Ga0207677_117854821 141
200 3300026041 Ga0207639_10017686 Ga0207639_100176862 141
201 3300026041 Ga0207639_10593145 Ga0207639_105931452 141
202 3300026067 Ga0207678_10015417 Ga0207678_100154174 141
203 3300026075 Ga0207708_10898118 Ga0207708_108981181 141
204 3300026078 Ga0207702_10055499 Ga0207702_100554993 141
205 3300026088 Ga0207641_10894029 Ga0207641_108940292 141
206 3300026089 Ga0207648_10008036 Ga0207648_100080362 141
207 3300026116 Ga0207674_10011037 Ga0207674_100110374 141
208 3300026116 Ga0207674_10077631 Ga0207674_100776312 141
209 3300026118 Ga0207675_100093709 Ga0207675_1000937093 141
210 3300026118 Ga0207675_100480819 Ga0207675_1004808192 141
211 3300026121 Ga0207683_10046847 Ga0207683_100468475 141
212 3300026121 Ga0207683_10146543 Ga0207683_101465433 141
213 3300026121 Ga0207683_10686645 Ga0207683_106866452 141
214 3300026121 Ga0207683_11076193 Ga0207683_110761931 141
215 3300026142 Ga0207698_10017948 Ga0207698_100179484 141
216 3300026142 Ga0207698_10108819 Ga0207698_101088193 141
217 3300026142 Ga0207698_10124496 Ga0207698_101244962 141
218 3300026142 Ga0207698_10183447 Ga0207698_101834472 141
219 3300026142 Ga0207698_11576563 Ga0207698_115765631 141
220 3300027907 Ga0207428_10011586 Ga0207428_100115865 141
221 3300027907 Ga0207428_10295825 Ga0207428_102958252 141
222 3300028381 Ga0268264_10251998 Ga0268264_102519983 141
223 3300028786 Ga0307517_10281871 Ga0307517_102818711 141
224 3300030763 Ga0265763_1012068 Ga0265763_10120682 141
225 3300031241 Ga0265325_10008917 Ga0265325_100089174 141
226 3300031249 Ga0265339_10006059 Ga0265339_100060596 141
227 3300031249 Ga0265339_10109174 Ga0265339_101091742 141
228 3300031249 Ga0265339_10125023 Ga0265339_101250232 141
229 3300031344 Ga0265316_10143446 Ga0265316_101434462 141
230 3300031344 Ga0265316_11064402 Ga0265316_110644021 141
231 3300031595 Ga0265313_10003021 Ga0265313_100030217 141
232 3300031616 Ga0307508_10074032 Ga0307508_100740324 141
233 3300031711 Ga0265314_10033010 Ga0265314_100330102 141
234 3300031711 Ga0265314_10492198 Ga0265314_104921981 141
235 3300031712 Ga0265342_10000912 Ga0265342_1000091229 141
236 3300031730 Ga0307516_10092759 Ga0307516_100927593 141
237 3300031730 Ga0307516_10182317 Ga0307516_101823172 141
238 3300031733 Ga0316577_10178946 Ga0316577_101789462 141
239 3300032002 Ga0307416_101168850 Ga0307416_1011688501 141
240 3300035091 Ga0373951_0293157 Ga0373951_0293157_15_443 141
241 3300035111 Ga0373923_0108605 Ga0373923_0108605_402_827 141
242 3300035111 Ga0373923_0686773 Ga0373923_0686773_67_492 141
243 3300035113 Ga0373936_0041945 Ga0373936_0041945_301_726 141
244 3300035114 Ga0373939_0093614 Ga0373939_0093614_164_592 141
245 3300035116 Ga0373945_0334692 Ga0373945_0334692_26_451 141
246 3300035116 Ga0373945_0513384 Ga0373945_0513384_76_504 141
247 3300035118 Ga0373954_0211914 Ga0373954_0211914_176_601 141
248 3300035120 Ga0373957_0028813 Ga0373957_0028813_705_1133 141
249 3300035170 Ga0373943_0067593 Ga0373943_0067593_15_440 141
250 3300035172 Ga0373955_0081348 Ga0373955_0081348_659_1084 141
251 3300035172 Ga0373955_0089608 Ga0373955_0089608_1290_1715 141
252 3300035172 Ga0373955_0271670 Ga0373955_0271670_495_923 141
253 3300035172 Ga0373955_0297343 Ga0373955_0297343_336_761 141
254 3300035172 Ga0373955_0921847 Ga0373955_0921847_52_477 141
255 3300035410 Ga0373924_0209150 Ga0373924_0209150_78_503 141
256 3300035692 Ga0373935_0071456 Ga0373935_0071456_1196_1621 141
257 3300035692 Ga0373935_0088504 Ga0373935_0088504_1276_1701 141
258 3300035692 Ga0373935_0291733 Ga0373935_0291733_419_844 141
259 3300035695 Ga0373927_0028230 Ga0373927_0028230_2846_3271 141
260 3300035724 Ga0373933_0086541 Ga0373933_0086541_1268_1696 141
261 3300035725 Ga0373947_0057877 Ga0373947_0057877_1887_2312 141
262 3300035725 Ga0373947_0067066 Ga0373947_0067066_1178_1603 141
263 3300035725 Ga0373947_0279403 Ga0373947_0279403_365_790 141
264 3300035725 Ga0373947_0304285 Ga0373947_0304285_275_700 141
265 3300036401 Ga0373937_0039704 Ga0373937_0039704_2798_3223 141
266 3300036401 Ga0373937_0135870 Ga0373937_0135870_900_1328 141
267 3300036647 Ga0316582_0082963 Ga0316582_0082963_1200_1625 141
268 3300037068 Ga0373925_0043013 Ga0373925_0043013_2619_3044 141
269 3300037068 Ga0373925_0204363 Ga0373925_0204363_725_1150 141
270 3300037068 Ga0373925_0333287 Ga0373925_0333287_466_894 141
271 3300037471 Ga0395905_1702174 Ga0395905_1702174_40_468 141
272 3300038443 Ga0395901_0388625 Ga0395901_0388625_266_694 141
273 3300039437 Ga0436365_1772565 Ga0436365_1772565_1164_1589 141
274 3300039450 Ga0436363_0947573 Ga0436363_0947573_1051_1482 141
275 3300039450 Ga0436363_1241725 Ga0436363_1241725_1766_2197 141
276 3300041443 Ga0451789_0939681 Ga0451789_0939681_37_480 141
277 3300041463 Ga0451804_0274167 Ga0451804_0274167_119_547 141
278 3300041491 Ga0451833_0676821 Ga0451833_0676821_255_683 141
279 3300041511 Ga0451855_1824513 Ga0451855_1824513_157_585 141
280 3300042016 Ga0439463_108162 Ga0439463_108162_133_558 141
281 3300044658 Ga0466972_0010306 Ga0466972_0010306_504_950 141
282 3300044694 Ga0466963_0429363 Ga0466963_0429363_444_869 141
283 3300045976 Ga0466967_0389608 Ga0466967_0389608_568_993 141
284 3300046454 Ga0495592_0110374 Ga0495592_0110374_1212_1637 141
285 3300046454 Ga0495592_0334126 Ga0495592_0334126_338_763 141
286 3300046455 Ga0495603_0103512 Ga0495603_0103512_1075_1500 141
287 3300046459 Ga0495629_0064942 Ga0495629_0064942_194_619 141
288 3300046459 Ga0495629_0125132 Ga0495629_0125132_459_887 141
289 3300046461 Ga0495641_0337701 Ga0495641_0337701_226_654 141
290 3300046472 Ga0495580_0089919 Ga0495580_0089919_76_501 141
291 3300046472 Ga0495580_0268017 Ga0495580_0268017_155_583 141
292 3300046473 Ga0495582_0138392 Ga0495582_0138392_389_814 141
293 3300046473 Ga0495582_0758032 Ga0495582_0758032_101_526 141
294 3300046475 Ga0495639_0126045 Ga0495639_0126045_77_502 141
295 3300046516 Ga0495628_0639860 Ga0495628_0639860_266_691 141
296 3300046516 Ga0495628_0854334 Ga0495628_0854334_29_490 141
297 3300046517 Ga0495630_0116402 Ga0495630_0116402_405_830 141
298 3300046517 Ga0495630_0337742 Ga0495630_0337742_516_941 141
299 3300046517 Ga0495630_0957078 Ga0495630_0957078_147_572 141
300 3300046523 Ga0495644_0191699 Ga0495644_0191699_262_687 141
301 3300046529 Ga0495652_0865058 Ga0495652_0865058_132_557 141
302 3300046531 Ga0495665_0195843 Ga0495665_0195843_584_1009 141
303 3300046533 Ga0495640_0063313 Ga0495640_0063313_425_850 141
304 3300046533 Ga0495640_0074923 Ga0495640_0074923_25_450 141
305 3300046533 Ga0495640_0497836 Ga0495640_0497836_119_547 141
306 3300046536 Ga0495587_0283748 Ga0495587_0283748_395_886 141
307 3300046543 Ga0495645_0140559 Ga0495645_0140559_50_475 141
308 3300046559 Ga0495667_0367521 Ga0495667_0367521_352_777 141
309 3300046615 Ga0495656_0150580 Ga0495656_0150580_611_1036 141
310 3300046642 Ga0495634_0235800 Ga0495634_0235800_516_941 141
311 3300046642 Ga0495634_0777555 Ga0495634_0777555_104_532 141
312 3300046663 Ga0495635_0145402 Ga0495635_0145402_109_534 141
313 3300046663 Ga0495635_0796731 Ga0495635_0796731_152_580 141
314 3300046678 Ga0495599_0363439 Ga0495599_0363439_395_820 141
315 3300046680 Ga0495646_0091746 Ga0495646_0091746_1039_1464 141
316 3300046681 Ga0495647_0158185 Ga0495647_0158185_202_627 141
317 3300046683 Ga0495658_0071556 Ga0495658_0071556_664_1089 141
318 3300046683 Ga0495658_0665040 Ga0495658_0665040_218_643 141
319 3300046684 Ga0495669_0019490 Ga0495669_0019490_1015_1440 141
320 3300046689 Ga0495613_0078482 Ga0495613_0078482_1774_2199 141
321 3300046690 Ga0495624_0250811 Ga0495624_0250811_368_793 141
322 3300046690 Ga0495624_0630707 Ga0495624_0630707_16_444 141
323 3300046692 Ga0495671_0258104 Ga0495671_0258104_85_510 141
324 3300046794 Ga0495589_0060924 Ga0495589_0060924_276_701 141
325 3300047315 Ga0495581_0264949 Ga0495581_0264949_335_760 141
326 3300047319 Ga0495674_0015593 Ga0495674_0015593_3183_3608 141
327 3300047319 Ga0495674_0967713 Ga0495674_0967713_166_594 141
328 3300047445 Ga0495677_0117723 Ga0495677_0117723_577_1002 141
329 3300047447 Ga0495685_117353 Ga0495685_117353_110_535 141
330 3300047471 Ga0495684_0159352 Ga0495684_0159352_510_935 141
331 3300047471 Ga0495684_0250711 Ga0495684_0250711_80_505 141
332 3300047471 Ga0495684_0275726 Ga0495684_0275726_684_1109 141
333 3300047673 Ga0495593_0116982 Ga0495593_0116982_803_1228 141
334 3300048089 Ga0495614_0115468 Ga0495614_0115468_589_1014 141
335 3300048903 Ga0496100_0718148 Ga0496100_0718148_142_567 141
336 3300048904 Ga0496101_0176128 Ga0496101_0176128_155_595 141
337 3300048905 Ga0496102_0172360 Ga0496102_0172360_233_658 141
338 3300048905 Ga0496102_0418449 Ga0496102_0418449_786_1226 141
339 3300048908 Ga0496105_0116129 Ga0496105_0116129_200_625 141
340 3300048908 Ga0496105_0884406 Ga0496105_0884406_105_530 141
341 3300048909 Ga0496106_0219245 Ga0496106_0219245_988_1413 141
342 3300048909 Ga0496106_0720885 Ga0496106_0720885_252_677 141
343 3300048915 Ga0496112_0098341 Ga0496112_0098341_1321_1746 141
344 3300048917 Ga0496114_0300558 Ga0496114_0300558_70_495 141
345 3300048918 Ga0496115_0030075 Ga0496115_0030075_2588_3028 141
346 3300048918 Ga0496115_0135917 Ga0496115_0135917_407_1069 141
347 3300048929 Ga0496126_0063844 Ga0496126_0063844_574_1056 141
348 3300049571 Ga0501034_0184272 Ga0501034_0184272_1507_1935 141
349 3300049571 Ga0501034_0461465 Ga0501034_0461465_383_832 141
350 3300049572 Ga0501036_0728526 Ga0501036_0728526_303_731 141
351 3300049574 Ga0501038_0229214 Ga0501038_0229214_327_755 141
352 3300049579 Ga0501043_0285538 Ga0501043_0285538_126_566 141
353 3300049579 Ga0501043_0458509 Ga0501043_0458509_309_737 141
354 3300049581 Ga0501047_0014095 Ga0501047_0014095_6993_7418 141
355 3300049581 Ga0501047_0288852 Ga0501047_0288852_840_1280 141
356 3300049581 Ga0501047_0310217 Ga0501047_0310217_234_662 141
357 3300049586 Ga0501070_0403904 Ga0501070_0403904_589_1038 141
358 3300049589 Ga0501073_0033942 Ga0501073_0033942_2896_3336 141
359 3300049589 Ga0501073_0056541 Ga0501073_0056541_1374_1802 141
360 3300049589 Ga0501073_0066578 Ga0501073_0066578_663_1112 141
361 3300049590 Ga0501074_0043786 Ga0501074_0043786_1535_1960 141
362 3300049742 Ga0501080_0829451 Ga0501080_0829451_46_495 141
363 3300049742 Ga0501080_1125784 Ga0501080_1125784_140_565 141
364 3300049742 Ga0501080_1458686 Ga0501080_1458686_62_490 141
365 3300049744 Ga0501083_0163690 Ga0501083_0163690_285_734 141
366 3300049822 Ga0501035_0172435 Ga0501035_0172435_1393_1842 141
367 3300049822 Ga0501035_0350762 Ga0501035_0350762_120_548 141
368 3300049823 Ga0501044_0024082 Ga0501044_0024082_1486_1911 141
369 3300049823 Ga0501044_0762407 Ga0501044_0762407_291_719 141
370 3300049823 Ga0501044_0773985 Ga0501044_0773985_176_625 141
371 3300050494 nmdc:mga06z11_42211_c1 nmdc:mga06z11_42211_c1_666_1091 141
372 3300050495 nmdc:mga04h51_347735_c1 nmdc:mga04h51_347735_c1_135_560 141
373 3300050507 nmdc:mga05p37_1088629_c1 nmdc:mga05p37_1088629_c1_235_660 141
374 3300050507 nmdc:mga05p37_1872811_c1 nmdc:mga05p37_1872811_c1_28_483 141
375 3300050507 nmdc:mga05p37_515745_c1 nmdc:mga05p37_515745_c1_807_1235 141
376 3300050508 nmdc:mga09592_20908_c1 nmdc:mga09592_20908_c1_1063_1491 141
377 3300050509 nmdc:mga0qj67_12287_c1 nmdc:mga0qj67_12287_c1_3850_4278 141
378 3300050510 nmdc:mga06r32_1214783_c1 nmdc:mga06r32_1214783_c1_165_590 141
379 3300050510 nmdc:mga06r32_202713_c1 nmdc:mga06r32_202713_c1_505_933 141
380 3300050510 nmdc:mga06r32_82264_c1 nmdc:mga06r32_82264_c1_196_651 141
381 3300050511 nmdc:mga08y16_43969_c1 nmdc:mga08y16_43969_c1_2535_2960 141
382 3300050511 nmdc:mga08y16_455898_c1 nmdc:mga08y16_455898_c1_505_933 141
383 3300050512 nmdc:mga0n895_24628_c1 nmdc:mga0n895_24628_c1_3956_4384 141
384 3300050512 nmdc:mga0n895_298744_c1 nmdc:mga0n895_298744_c1_1055_1480 141
385 3300050512 nmdc:mga0n895_305436_c1 nmdc:mga0n895_305436_c1_413_841 141
386 3300050512 nmdc:mga0n895_568599_c1 nmdc:mga0n895_568599_c1_31_456 141
387 3300050512 nmdc:mga0n895_88820_c1 nmdc:mga0n895_88820_c1_898_1323 141
388 3300050512 nmdc:mga0n895_925823_c1 nmdc:mga0n895_925823_c1_384_809 141
389 3300050513 nmdc:mga0rr50_783357_c1 nmdc:mga0rr50_783357_c1_182_625 141
390 3300050514 nmdc:mga08x19_35_c1 nmdc:mga08x19_35_c1_100762_101187 141
391 3300050515 nmdc:mga0a205_242488_c1 nmdc:mga0a205_242488_c1_293_718 141
392 3300050515 nmdc:mga0a205_55312_c1 nmdc:mga0a205_55312_c1_965_1390 141
393 3300050515 nmdc:mga0a205_97802_c1 nmdc:mga0a205_97802_c1_1267_1695 141
394 3300053077 Ga0495601_0125374 Ga0495601_0125374_471_899 141
395 3300053077 Ga0495601_0201453 Ga0495601_0201453_701_1126 141
396 3300053077 Ga0495601_0212512 Ga0495601_0212512_180_605 141
397 3300053077 Ga0495601_0244759 Ga0495601_0244759_402_830 141
398 3300053078 Ga0495612_0092017 Ga0495612_0092017_72_497 141
399 3300053084 Ga0495595_0430072 Ga0495595_0430072_72_533 141
400 3300053085 Ga0495619_0370124 Ga0495619_0370124_91_516 141
401 3300053088 Ga0500644_0436382 Ga0500644_0436382_27_455 141
402 3300053090 Ga0500646_0040983 Ga0500646_0040983_188_715 141
403 3300053098 Ga0500650_0261568 Ga0500650_0261568_138_668 141
404 3300053130 Ga0500642_0000752 Ga0500642_0000752_6895_7425 141
405 3300053134 Ga0500658_0092179 Ga0500658_0092179_570_1100 141
406 3300053139 Ga0500568_0004493 Ga0500568_0004493_754_1182 141
407 3300053146 Ga0500588_0001355 Ga0500588_0001355_2878_3306 141
408 3300053160 Ga0500633_0262882 Ga0500633_0262882_43_573 141
409 3300053731 Ga0500609_001735 Ga0500609_001735_1147_1623 141
410 3300059624 Ga0587109_194091 Ga0587109_194091_56_481 141
411 3300060353 Ga0501082_0000544 Ga0501082_0000544_2582_3010 141

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

60

149

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wac-assembly1.cif.gz_A crystal structure of tarm 0.8461 58 85
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.8443 1 126
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.8381 5 102
1xa8-assembly1.cif.gz_A crystal structure analysis of glutathione-dependent formaldehyde-activating enzyme (gfa) 0.8185 3 113
7qnt-assembly1.cif.gz_AAA tarm(se) native 0.8011 60 85
ID Description Score Start End Superfamily
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.8649 2 126 3.90.1590.10
1xa8D00 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.8577 1 113 3.90.1590.10
af_Q54VC9_11_133_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8399 6 102 2.170.150.70
3facD00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8337 5 102 2.170.150.70
af_Q2FZM7_1_163_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8255 58 85 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A530AJC1-F1-model_v4 GFA family protein 0.9919 1 108 GO:0016846
GO:0046872
AF-A0A530GKI3-F1-model_v4 GFA family protein 0.9913 1 98 GO:0016846
GO:0046872
AF-A0A436RC34-F1-model_v4 GFA family protein 0.9874 2 86 GO:0016846
GO:0046872
AF-A0A524JSN6-F1-model_v4 GFA family protein 0.983 2 81 GO:0016846
GO:0046872
AF-A0A530GKI3-F1-model_v4 GFA family protein 0.9813 1 98 GO:0016846
GO:0046872

Feature Viewer

pLDDT pTM Quality
94.7 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map