metagRoot

F437641

General Info

Members	Datasets	Scaffolds	Average Seq Length
411	320	329	278

Family's Representative Sequence

Representative Sequence	3300049570\|Ga0501033_0007982\|Ga0501033_0007982_2899_3867
Length	322
Sequence	MTIAADFEQRGGRWIARVSVAGDRWPTAAVALDRRRYLQEITMTAVQMAVRAPAPLPDLAAVKTRQQGAWSSGDYAVIGATLQIVGEDLCEALDLRAGQKVLDVAAGNGNVTLAAARRWCEVTSTDYVPALLERGRIRADADGLRINFREADAEALPFADQSFDAVVSTFGVMFTPHQDKAAAELVRVCRSGGKIGLANWTPGGFIGRVFKIIGKHLPPPAGVKSPLLWGTRASIEEMFGADAAAIVAQPRDFMFRYRSAEHWLDMFKTYYGPMLKTFAALAPDGQAALRDDLFALIREFNRSGDATMVVPGEYLEIVVIRR

Samples

	Sample ID	Description	Type	Environment
1	2507262055	Bradyrhizobium sp. WSM1417	Isolate	Nodule
2	2508501009	Bradyrhizobium sp. WSM471	Isolate	Nodule
3	2511231028	Bradyrhizobium sp. YR681	Isolate	Rhizosphere
4	2513237092	Bradyrhizobium sp. WSM1743	Isolate	Nodule
5	2513237102	Bradyrhizobium japonicum USDA 135	Isolate	Nodule
6	2513237104	Bradyrhizobium sp. EC3.3	Isolate	Nodule
7	2517093001	Bradyrhizobium japonicum USDA 124	Isolate	Nodule
8	2524023205	Bradyrhizobium sp. Cp5.3	Isolate	Nodule
9	2599185292	Achromobacter sp. NFACC18-2	Isolate	Rhizoplane
10	2617270741	Bradyrhizobium yuanmingense CCBAU 10071	Isolate	Nodule
11	2643221569	Achromobacter sp. Root565	Isolate	Unclassified
12	2643221594	Achromobacter sp. Root170	Isolate	Unclassified
13	2744054633	Bradyrhizobium neotropicale BR 10247	Isolate	Unclassified
14	2808606395	Achromobacter sp. SLBN-14	Isolate	Unclassified
15	2824600985	Bradyrhizobium sp.HAMBI 2135	Isolate	Unclassified
16	2824609381	Bradyrhizobium sp. HAMBI 2134	Isolate	Unclassified
17	2824617872	Bradyrhizobium sp. HAMBI 2133	Isolate	Unclassified
18	2824626560	Bradyrhizobium sp. HAMBI 2149	Isolate	Unclassified
19	2824635225	Bradyrhizobium sp. HAMBI 2136	Isolate	Unclassified
20	2824644064	Bradyrhizobium sp. HAMBI 2137	Isolate	Unclassified
21	2824653114	Bradyrhizobium sp. HAMBI 2142	Isolate	Unclassified
22	2824661429	Bradyrhizobium sp. HAMBI 2115	Isolate	Unclassified
23	2824679649	Bradyrhizobium sp.HAMBI 2116	Isolate	Unclassified
24	2824714736	Bradyrhizobium sp. HAMBI 2151	Isolate	Unclassified
25	2824723954	Bradyrhizobium sp. HAMBI 2152	Isolate	Unclassified
26	2824732956	Bradyrhizobium sp. HAMBI 2153	Isolate	Unclassified
27	2824746037	Bradyrhizobium sp. HAMBI 2299	Isolate	Unclassified
28	2855730933	Achromobacter sp. HZ28	Isolate	Nodule
29	2855767633	Achromobacter sp. HZ34	Isolate	Nodule
30	2857509624	Bradyrhizobium sp. R-73088	Isolate	Unclassified
31	2857537821	Achromobacter sp. R-71975	Isolate	Unclassified
32	2876761206	Bradyrhizobium centrolobii BR 10245	Isolate	Nodule
33	2879099564	Bradyrhizobium japonicum UBMA197	Isolate	Nodule
34	2881364244	Bradyrhizobium sp. RP6	Isolate	Unclassified
35	2885366525	Bradyrhizobium sp. LVM 105	Isolate	Unclassified
36	2888419890	Bradyrhizobium sp. 1(2017) 63S1MB	Isolate	Unclassified
37	2908775508	Bradyrhizobium sp. SUTN9-2	Isolate	Unclassified
38	2922368715
39	2922393267	Bradyrhizobium sp. WBAH10	Isolate	Nodule
40	2929615660	Bradyrhizobium japonicum TXVA	Isolate	Nodule
41	2929624759	Bradyrhizobium japonicum TXEA	Isolate	Nodule
42	2932784394	Bradyrhizobium sp. S3.2.12	Isolate	Nodule
43	2932809354	Bradyrhizobium sp. S3.5.5	Isolate	Nodule
44	2932818245	Bradyrhizobium sp. S3.9.1	Isolate	Nodule
45	2932828146	Bradyrhizobium sp. S3.9.2	Isolate	Nodule
46	2933577622	Bradyrhizobium japonicum SEMIA 417	Isolate	Nodule
47	2935616580	Bradyrhizobium sp. RT7a	Isolate	Nodule
48	2935638405	Bradyrhizobium sp. JR19.8	Isolate	Nodule
49	2935665750	Bradyrhizobium sp. JR7.2	Isolate	Nodule
50	2935675223	Bradyrhizobium sp. LA2.1	Isolate	Nodule
51	2935684952	Bradyrhizobium sp. LA3.X	Isolate	Nodule
52	2935694250	Bradyrhizobium sp. LA6.1	Isolate	Nodule
53	2935703347	Bradyrhizobium sp. LA6.10	Isolate	Nodule
54	2935713505	Bradyrhizobium sp. LA6.12	Isolate	Nodule
55	2935722832	Bradyrhizobium sp. LA6.3	Isolate	Nodule
56	2935732158	Bradyrhizobium sp. LA6.4	Isolate	Nodule
57	2935741537	Bradyrhizobium sp. LA6.7	Isolate	Nodule
58	2935750917	Bradyrhizobium sp. LA6.8	Isolate	Nodule
59	2935760218	Bradyrhizobium sp. LA7.1	Isolate	Nodule
60	2935801545	Bradyrhizobium sp. RT10b	Isolate	Nodule
61	2935810662	Bradyrhizobium sp. RT3a	Isolate	Nodule
62	2935827899	Bradyrhizobium sp. RT4a	Isolate	Nodule
63	2935837841	Bradyrhizobium sp. RT4b	Isolate	Nodule
64	2935855204	Bradyrhizobium sp. RT7b	Isolate	Nodule
65	2935864058	Bradyrhizobium sp. RT9a	Isolate	Nodule
66	2935873716	Bradyrhizobium sp. RT9b	Isolate	Nodule
67	2935959822	Bradyrhizobium sp. F1.4.3	Isolate	Nodule
68	2935992306	Bradyrhizobium sp. I1.7.5	Isolate	Nodule
69	2936002035	Bradyrhizobium sp. I1.8.5	Isolate	Nodule
70	2936037263	Bradyrhizobium sp. JR18.2	Isolate	Nodule
71	2940556831	Bradyrhizobium sp. LA8.1	Isolate	Nodule
72	2941538514	Bradyrhizobium sp. RT11b	Isolate	Nodule
73	3005506211	Bradyrhizobium diazoefficiens SZCCT0449	Isolate	Unclassified
74	3005587118	Bradyrhizobium glycinis CNPSo 4016	Isolate	Unclassified
75	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
76	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
77	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
78	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
79	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
80	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
81	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
82	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
83	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
84	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
85	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
86	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
87	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
88	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
89	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
90	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
91	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
92	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
93	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
94	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
95	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
96	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
97	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
98	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
99	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
100	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
101	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
102	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
103	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
104	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
105	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
106	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
107	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
108	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
109	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
110	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
111	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
112	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
113	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
114	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
115	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
116	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
117	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
118	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
119	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
120	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
121	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
122	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
123	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
124	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
125	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
126	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
127	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
128	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
129	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
130	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
131	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
132	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
133	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
134	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
135	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
136	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
137	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
138	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
139	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
140	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
141	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
142	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
143	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
144	3300021321	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1	Metagenome	Nodule
145	3300021324	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4	Metagenome	Nodule
146	3300021327	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2	Metagenome	Nodule
147	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
148	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
149	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
150	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
151	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
152	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
153	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
154	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
155	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
156	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
157	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
170	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
172	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
173	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
174	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
175	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
176	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
177	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
178	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
179	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
180	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
181	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
182	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
183	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
184	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
185	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
186	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
187	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
188	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
189	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
190	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
191	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
192	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
193	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
194	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
195	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
196	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
197	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
198	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
199	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
200	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
201	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
202	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
203	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
204	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
205	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
206	3300041505	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG	Metagenome	Unclassified
207	3300042126	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87	Metagenome	Rhizosphere
208	3300042127	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91	Metagenome	Rhizosphere
209	3300042129	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95	Metagenome	Rhizosphere
210	3300042130	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97	Metagenome	Rhizosphere
211	3300042532	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92	Metagenome	Rhizosphere
212	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
213	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
214	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
215	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
216	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
217	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
218	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
219	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
220	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
221	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
222	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
223	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
224	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
225	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
226	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
227	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
228	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
229	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
230	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
231	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
232	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
233	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
234	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
235	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
236	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
237	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
238	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
239	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
240	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
241	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
242	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
243	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
244	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
245	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
246	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
247	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
248	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
249	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
250	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
251	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
252	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
253	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
254	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
255	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
256	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
257	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
258	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
259	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
260	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
261	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
262	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
263	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
264	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
265	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
266	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
267	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
268	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
269	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
270	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
271	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
272	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
273	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
274	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
275	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
276	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
277	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
278	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
279	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
280	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
281	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
282	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
283	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
284	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
285	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
286	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
287	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
288	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
289	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
290	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
291	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
292	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
293	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
294	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
295	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
296	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
297	3300053095	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere	Metagenome	Endosphere
298	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
299	3300053105	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere	Metagenome	Endosphere
300	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
301	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
302	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
303	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
304	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
305	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
306	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
307	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
308	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
309	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
310	3300053736	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere	Metagenome	Endosphere
311	3300053737	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere	Metagenome	Endosphere
312	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
313	8006926726	Bradyrhizobium guangdongense SM32	Isolate	Unclassified
314	8016511872	Bradyrhizobium sp. S3.14.4	Isolate	Nodule
315	8017057580	Bradyrhizobium sp. S3.7.6	Isolate	Nodule
316	8019576017	Bradyrhizobium sp. i1.7.7	Isolate	Nodule
317	8019586578	Bradyrhizobium sp. i1.4.4	Isolate	Nodule
318	8019597564	Bradyrhizobium sp. i1.3.6	Isolate	Nodule
319	8019608314	Bradyrhizobium sp. i1.3.1	Isolate	Nodule
320	8055742211	Bradyrhizobium japonicum 5038	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	80.24
Metatranscriptomes	0
Isolates	19.76

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	13.63
Nodule	14.11
Rhizoplane	5.6
Rhizosphere	57.66
Stem	0
Stem Tuber	0
Unclassified	9

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25151J46595_10000189	3300003187	Bacteria	75938
2	JGI25153J46596_10003804	3300003215	Bacteria	8325
3	JGI25153J46596_10017099	3300003215	Bacteria	2872
4	JGI25160J50197_1016717	3300003354	Bacteria	2353
5	JGI25160J50197_1017552	3300003354	Bacteria	2261
6	Ga0055536_1012596	3300003781	Bacteria	3123
7	Ga0055531_10006884	3300003794	Bacteria	6338
8	Ga0065165_1003604	3300005262	Bacteria	10637
9	Ga0065165_1004069	3300005262	Bacteria	9485
10	Ga0065712_10068099	3300005290	Bacteria	14846
11	Ga0065712_10205611	3300005290	Bacteria	1092
12	Ga0070670_100188417	3300005331	Bacteria	1792
13	Ga0070680_100049060	3300005336	Bacteria	3441
14	Ga0070680_100153292	3300005336	Bacteria	1935
15	Ga0070689_100043701	3300005340	Bacteria	3445
16	Ga0070689_100199874	3300005340	Bacteria	1632
17	Ga0070689_100250595	3300005340	Bacteria	1461
18	Ga0070687_100182205	3300005343	Bacteria	1259
19	Ga0070668_100005869	3300005347	Bacteria	9103
20	Ga0070669_100103273	3300005353	Bacteria	2153
21	Ga0070675_100030965	3300005354	Bacteria	4321
22	Ga0070673_100004800	3300005364	Bacteria	8594
23	Ga0070688_100179336	3300005365	Bacteria	1468
24	Ga0070667_100104795	3300005367	Bacteria	2447
25	Ga0070714_100256875	3300005435	Bacteria	1617
26	Ga0070713_100163579	3300005436	Bacteria	1988
27	Ga0070713_100510002	3300005436	Bacteria	1136
28	Ga0070708_100581336	3300005445	Bacteria	1056
29	Ga0070663_100010209	3300005455	Bacteria	5848
30	Ga0070662_100028003	3300005457	Bacteria	3918
31	Ga0070681_10021467	3300005458	Bacteria	6473
32	Ga0070685_10063750	3300005466	Bacteria	2165
33	Ga0070706_100267733	3300005467	Bacteria	1595
34	Ga0070698_100691193	3300005471	Bacteria	962
35	Ga0070679_100006124	3300005530	Bacteria	11189
36	Ga0068853_100053785	3300005539	Bacteria	3468
37	Ga0070672_100000502	3300005543	Bacteria	22802
38	Ga0070665_100024180	3300005548	Bacteria	6118
39	Ga0070665_100082095	3300005548	Bacteria	3228
40	Ga0070665_100219660	3300005548	Bacteria	1901
41	Ga0070665_100593087	3300005548	Bacteria	1121
42	Ga0068855_100079034	3300005563	Bacteria	3816
43	Ga0068855_100265034	3300005563	Unclassified	1913
44	Ga0068857_100051010	3300005577	Bacteria	3669
45	Ga0068854_100397860	3300005578	Bacteria	1139
46	Ga0068859_100064272	3300005617	Bacteria	3702
47	Ga0068864_100012250	3300005618	Bacteria	7086
48	Ga0068864_100047127	3300005618	Bacteria	3701
49	Ga0068864_100576470	3300005618	Bacteria	1090
50	Ga0068861_100479718	3300005719	Bacteria	1120
51	Ga0068870_10040287	3300005840	Bacteria	2421
52	Ga0068863_100099531	3300005841	Bacteria	2762
53	Ga0068863_100575728	3300005841	Bacteria	1113
54	Ga0068858_100103828	3300005842	Bacteria	2652
55	Ga0068860_100775657	3300005843	Bacteria	971
56	Ga0068862_100050406	3300005844	Bacteria	3558
57	Ga0081455_10008195	3300005937	Bacteria	10895
58	Ga0081455_10123242	3300005937	Bacteria	2039
59	Ga0081455_10132051	3300005937	Bacteria	1951
60	Ga0070712_100485814	3300006175	Bacteria	1033
61	Ga0075369_10021413	3300006186	Bacteria	2657
62	Ga0075370_10053085	3300006353	Bacteria	2300
63	Ga0075428_100006080	3300006844	Bacteria	13420
64	Ga0075428_100693957	3300006844	Bacteria	1084
65	Ga0075430_100080837	3300006846	Bacteria	2722
66	Ga0075430_100089898	3300006846	Bacteria	2569
67	Ga0075431_100060118	3300006847	Bacteria	3921
68	Ga0075431_100127229	3300006847	Bacteria	2629
69	Ga0075431_100289384	3300006847	Bacteria	1658
70	Ga0075433_10434002	3300006852	Bacteria	1158
71	Ga0075433_10713869	3300006852	Bacteria	878
72	Ga0075434_100640558	3300006871	Bacteria	1081
73	Ga0075429_100537140	3300006880	Bacteria	1025
74	Ga0097620_100064273	3300006931	Bacteria	3702
75	Ga0105240_10012778	3300009093	Bacteria	11570
76	Ga0111539_10007174	3300009094	Bacteria	14286
77	Ga0111539_10184893	3300009094	Bacteria	2434
78	Ga0111539_10495138	3300009094	Bacteria	1424
79	Ga0105245_10105080	3300009098	Bacteria	2619
80	Ga0105247_10152717	3300009101	Unclassified	1523
81	Ga0105247_10161311	3300009101	Bacteria	1485
82	Ga0105247_10202421	3300009101	Bacteria	1335
83	Ga0105247_10294971	3300009101	Bacteria	1123
84	Ga0114129_10308939	3300009147	Bacteria	2105
85	Ga0114129_10370421	3300009147	Bacteria	1893
86	Ga0114129_11228984	3300009147	Bacteria	932
87	Ga0105243_10055132	3300009148	Bacteria	3158
88	Ga0105241_10385304	3300009174	Bacteria	1226
89	Ga0105237_10322925	3300009545	Bacteria	1547
90	Ga0105246_10077488	3300011119	Bacteria	2358
91	Ga0105246_10209288	3300011119	Bacteria	1521
92	Ga0105246_10276568	3300011119	Bacteria	1345
93	Ga0157370_10007034	3300013104	Bacteria	12283
94	Ga0157369_10274597	3300013105	Bacteria	1756
95	Ga0163162_10100137	3300013306	Bacteria	2989
96	Ga0163162_10199127	3300013306	Bacteria	2131
97	Ga0157372_10151822	3300013307	Bacteria	2674
98	Ga0157375_10033572	3300013308	Bacteria	4877
99	Ga0157375_10111011	3300013308	Bacteria	2840
100	Ga0163163_10188874	3300014325	Bacteria	2109
101	Ga0163163_10386166	3300014325	Bacteria	1458
102	Ga0163163_10562003	3300014325	Bacteria	1204
103	Ga0157379_10078270	3300014968	Bacteria	2961
104	Ga0163161_10015799	3300017792	Bacteria	5265
105	Ga0214542_1000007	3300021321	Bacteria	291816
106	Ga0214545_1000006	3300021324	Bacteria	291693
107	Ga0214545_1032025	3300021324	Bacteria	2059
108	Ga0214543_1000009	3300021327	Bacteria	384302
109	Ga0214543_1035933	3300021327	Bacteria	1579
110	Ga0207425_1009783	3300025245	Bacteria	2367
111	Ga0209130_1001807	3300025284	Bacteria	12466
112	Ga0209676_1000065	3300025292	Bacteria	318605
113	Ga0209676_1006007	3300025292	Bacteria	6128
114	Ga0209025_1000027	3300025294	Bacteria	505882
115	Ga0209564_1016955	3300025295	Bacteria	2868
116	Ga0209758_1000074	3300025297	Bacteria	275577
117	Ga0209758_1000595	3300025297	Bacteria	56364
118	Ga0209758_1000604	3300025297	Bacteria	55558
119	Ga0209758_1000932	3300025297	Bacteria	39573
120	Ga0209050_1007636	3300025298	Bacteria	5998
121	Ga0209050_1022361	3300025298	Bacteria	2267
122	Ga0209256_1019434	3300025299	Bacteria	2162
123	Ga0207426_1000235	3300025302	Bacteria	126601
124	Ga0207426_1000500	3300025302	Bacteria	58181
125	Ga0207426_1003118	3300025302	Bacteria	9460
126	Ga0207426_1008389	3300025302	Bacteria	4180
127	Ga0207426_1011795	3300025302	Bacteria	3308
128	Ga0209257_1001945	3300025304	Bacteria	22296
129	Ga0207710_10010498	3300025900	Bacteria	3902
130	Ga0207643_10123591	3300025908	Bacteria	1535
131	Ga0207684_10186854	3300025910	Bacteria	1787
132	Ga0207707_10006926	3300025912	Bacteria	9891
133	Ga0207707_10037270	3300025912	Bacteria	4249
134	Ga0207660_10049541	3300025917	Bacteria	2978
135	Ga0207652_10018187	3300025921	Bacteria	5761
136	Ga0207659_10084579	3300025926	Bacteria	2354
137	Ga0207700_10544166	3300025928	Bacteria	1030
138	Ga0207700_10717710	3300025928	Bacteria	893
139	Ga0207644_10119938	3300025931	Bacteria	2001
140	Ga0207706_10037909	3300025933	Bacteria	4277
141	Ga0207709_10266717	3300025935	Bacteria	1258
142	Ga0207670_10216795	3300025936	Bacteria	1463
143	Ga0207670_10373489	3300025936	Bacteria	1134
144	Ga0207704_10087003	3300025938	Bacteria	2040
145	Ga0207691_10000842	3300025940	Bacteria	30582
146	Ga0207689_10014305	3300025942	Bacteria	6753
147	Ga0207679_10447563	3300025945	Bacteria	1145
148	Ga0207651_10738186	3300025960	Bacteria	870
149	Ga0207668_10017120	3300025972	Bacteria	4535
150	Ga0207668_10431445	3300025972	Bacteria	1121
151	Ga0207668_10552624	3300025972	Bacteria	997
152	Ga0207703_10074636	3300026035	Bacteria	2809
153	Ga0207639_10203512	3300026041	Unclassified	1700
154	Ga0207639_10407069	3300026041	Bacteria	1227
155	Ga0207678_10023755	3300026067	Bacteria	5361
156	Ga0207702_10444759	3300026078	Bacteria	1257
157	Ga0207641_10199432	3300026088	Bacteria	1844
158	Ga0207641_10476815	3300026088	Bacteria	1209
159	Ga0207641_10490368	3300026088	Bacteria	1192
160	Ga0207676_10175213	3300026095	Bacteria	1872
161	Ga0207674_10058459	3300026116	Bacteria	3906
162	Ga0207675_100119163	3300026118	Bacteria	2496
163	Ga0207683_10039752	3300026121	Bacteria	4104
164	Ga0207683_10520778	3300026121	Bacteria	1099
165	Ga0207698_10318682	3300026142	Bacteria	1455
166	Ga0209588_1001194	3300027671	Bacteria	6713
167	Ga0207428_10007551	3300027907	Bacteria	9906
168	Ga0207428_10377316	3300027907	Bacteria	1041
169	Ga0268266_10005168	3300028379	Bacteria	12298
170	Ga0268266_10153973	3300028379	Bacteria	2075
171	Ga0268265_10169132	3300028380	Bacteria	1866
172	Ga0268265_10431717	3300028380	Bacteria	1226
173	Ga0268265_10665218	3300028380	Bacteria	1002
174	Ga0316579_10098441	3300031691	Bacteria	1399
175	Ga0316576_10153347	3300031727	Bacteria	1736
176	Ga0307409_100305643	3300031995	Bacteria	1482
177	Ga0307414_10280809	3300032004	Bacteria	1399
178	Ga0307510_10006233	3300033180	Bacteria	14224
179	Ga0373936_0101658	3300035113	Bacteria	1213
180	Ga0373953_0028248	3300035117	Bacteria	2161
181	Ga0373943_0052666	3300035170	Bacteria	2007
182	Ga0316574_0000122	3300035398	Bacteria	24036
183	Ga0373924_0100765	3300035410	Bacteria	1242
184	Ga0373927_0042058	3300035695	Bacteria	2963
185	Ga0373933_0028962	3300035724	Bacteria	3198
186	Ga0373937_0001808	3300036401	Bacteria	17942
187	Ga0316582_0312304	3300036647	Bacteria	1080
188	Ga0316584_0026664	3300036712	Bacteria	4249
189	Ga0373925_0025910	3300037068	Bacteria	4287
190	Ga0395905_0004875	3300037471	Bacteria	13829
191	Ga0451849_1350183	3300041505	Bacteria	1242
192	Ga0450888_000523	3300042126	Bacteria	3626
193	Ga0450890_008970	3300042127	Bacteria	1279
194	Ga0450891_004010	3300042129	Bacteria	1390
195	Ga0450892_001245	3300042130	Bacteria	2590
196	Ga0450893_0001092	3300042532	Bacteria	4079
197	Ga0466972_0024344	3300044658	Bacteria	3004
198	Ga0466965_0095295	3300044683	Bacteria	1518
199	Ga0466964_0078413	3300044706	Bacteria	1412
200	Ga0466967_0323319	3300045976	Bacteria	1488
201	Ga0495603_0031343	3300046455	Bacteria	3201
202	Ga0495590_0036404	3300046457	Bacteria	1717
203	Ga0495629_0185249	3300046459	Bacteria	1442
204	Ga0495638_0016699	3300046460	Bacteria	4910
205	Ga0495650_0016042	3300046471	Bacteria	3814
206	Ga0495605_0036757	3300046474	Bacteria	2467
207	Ga0495608_0000796	3300046511	Bacteria	22162
208	Ga0495608_0046070	3300046511	Bacteria	2903
209	Ga0495628_0179099	3300046516	Bacteria	1604
210	Ga0495632_0043861	3300046519	Bacteria	2234
211	Ga0495648_0103536	3300046524	Bacteria	1565
212	Ga0495640_0060943	3300046533	Bacteria	2565
213	Ga0495640_0201432	3300046533	Bacteria	1261
214	Ga0495587_0042525	3300046536	Bacteria	2709
215	Ga0495667_0014686	3300046559	Bacteria	5292
216	Ga0495667_0015558	3300046559	Bacteria	5143
217	Ga0495634_0234538	3300046642	Bacteria	1128
218	Ga0495625_0018033	3300046660	Bacteria	5517
219	Ga0495613_0125200	3300046689	Bacteria	1844
220	Ga0495589_0025094	3300046794	Bacteria	3026
221	Ga0495600_0079813	3300046809	Bacteria	2136
222	Ga0495581_0265373	3300047315	Bacteria	1004
223	Ga0495604_0019758	3300047317	Bacteria	5390
224	Ga0495636_0098381	3300047318	Bacteria	1277
225	Ga0495674_0173651	3300047319	Bacteria	1797
226	Ga0495674_0314661	3300047319	Bacteria	1277
227	Ga0495675_0026247	3300047444	Bacteria	3715
228	Ga0495675_0175483	3300047444	Bacteria	1314
229	Ga0495673_0017602	3300047469	Bacteria	3622
230	Ga0495684_0318206	3300047471	Bacteria	1113
231	Ga0495686_0066713	3300047472	Bacteria	2223
232	Ga0495602_0180420	3300048088	Bacteria	1629
233	Ga0496100_0078585	3300048903	Bacteria	2221
234	Ga0496102_0064139	3300048905	Bacteria	3365
235	Ga0496102_0446501	3300048905	Bacteria	1213
236	Ga0496103_0199642	3300048906	Bacteria	1286
237	Ga0496104_0014714	3300048907	Bacteria	7070
238	Ga0496104_0015436	3300048907	Bacteria	6917
239	Ga0496105_0017752	3300048908	Bacteria	5708
240	Ga0496106_0027635	3300048909	Bacteria	4226
241	Ga0496107_0095768	3300048910	Bacteria	2172
242	Ga0496109_0097089	3300048912	Bacteria	2731
243	Ga0496109_0130908	3300048912	Bacteria	2341
244	Ga0496110_0252096	3300048913	Bacteria	1606
245	Ga0496110_0327484	3300048913	Bacteria	1395
246	Ga0496111_0078088	3300048914	Bacteria	2414
247	Ga0496112_0179097	3300048915	Bacteria	2084
248	Ga0496114_0061833	3300048917	Bacteria	3133
249	Ga0496114_0230181	3300048917	Bacteria	1628
250	Ga0496114_0557653	3300048917	Bacteria	1012
251	Ga0496115_0009707	3300048918	Bacteria	7166
252	Ga0496115_0012977	3300048918	Bacteria	6286
253	Ga0496115_0035997	3300048918	Bacteria	3918
254	Ga0496115_0062436	3300048918	Bacteria	3005
255	Ga0496116_0018120	3300048919	Bacteria	5439
256	Ga0496117_0112449	3300048920	Bacteria	1693
257	Ga0496118_0024496	3300048921	Bacteria	5205
258	Ga0496118_0140199	3300048921	Bacteria	1534
259	Ga0496121_0011784	3300048924	Bacteria	9641
260	Ga0496125_0018087	3300048928	Bacteria	6698
261	Ga0496126_0050862	3300048929	Bacteria	3775
262	Ga0496126_0326866	3300048929	Bacteria	1259
263	Ga0495678_077027	3300049459	Bacteria	1207
264	Ga0501031_0220290	3300049568	Bacteria	1236
265	Ga0501032_0298248	3300049569	Bacteria	1042
266	Ga0501033_0007982	3300049570	Bacteria	8198
267	Ga0501034_0098233	3300049571	Bacteria	2924
268	Ga0501038_0290646	3300049574	Bacteria	1284
269	Ga0501039_0378727	3300049575	Bacteria	1112
270	Ga0501042_0151052	3300049578	Bacteria	1675
271	Ga0501043_0098410	3300049579	Bacteria	2299
272	Ga0501047_0006619	3300049581	Bacteria	10900
273	Ga0501047_0246088	3300049581	Bacteria	1637
274	Ga0501070_0027186	3300049586	Bacteria	4799
275	Ga0501074_0307817	3300049590	Bacteria	1125
276	Ga0501080_0085801	3300049742	Bacteria	2925
277	Ga0501083_0142566	3300049744	Bacteria	1569
278	Ga0501035_0158767	3300049822	Bacteria	1958
279	Ga0501035_0345339	3300049822	Bacteria	1246
280	Ga0501044_0000315	3300049823	Bacteria	61159
281	Ga0501044_0004409	3300049823	Bacteria	15749
282	Ga0501044_0009028	3300049823	Bacteria	10898
283	Ga0501044_0065040	3300049823	Bacteria	3720
284	Ga0501044_0101598	3300049823	Bacteria	2893
285	nmdc:mga03683_53684_c1	3300050489	Bacteria	1687
286	nmdc:mga00v17_46596_c1	3300050491	Bacteria	2623
287	nmdc:mga06z11_177582_c1	3300050494	Bacteria	1226
288	nmdc:mga05p37_10564_c1	3300050507	Bacteria	10947
289	nmdc:mga05p37_948477_c1	3300050507	Bacteria	921
290	nmdc:mga09592_25936_c1	3300050508	Bacteria	4854
291	nmdc:mga0qj67_312202_c1	3300050509	Bacteria	1273
292	nmdc:mga06r32_164524_c1	3300050510	Bacteria	2201
293	nmdc:mga08y16_432858_c1	3300050511	Bacteria	1343
294	nmdc:mga08y16_5512_c1	3300050511	Bacteria	13242
295	nmdc:mga08y16_96353_c1	3300050511	Bacteria	3081
296	nmdc:mga0n895_610642_c1	3300050512	Bacteria	1092
297	nmdc:mga08x19_278172_c1	3300050514	Bacteria	1159
298	nmdc:mga0a205_387470_c1	3300050515	Bacteria	1262
299	nmdc:mga0sz30_24139_c1	3300050516	Bacteria	2480
300	nmdc:mga0sz30_51744_c1	3300050516	Bacteria	1743
301	Ga0495601_0014094	3300053077	Bacteria	4816
302	Ga0495601_0106054	3300053077	Bacteria	1817
303	Ga0495655_0033775	3300053083	Bacteria	1261
304	Ga0495595_0173658	3300053084	Bacteria	1067
305	Ga0495619_0007264	3300053085	Bacteria	7017
306	Ga0495619_0012283	3300053085	Bacteria	5389
307	Ga0495619_0024656	3300053085	Bacteria	3859
308	Ga0500643_000013	3300053087	Bacteria	324296
309	Ga0500583_0044122	3300053092	Bacteria	2040
310	Ga0500566_0002898	3300053094	Bacteria	10234
311	Ga0500566_0090085	3300053094	Bacteria	1696
312	Ga0500640_087061	3300053095	Bacteria	1315
313	Ga0500556_0009542	3300053104	Bacteria	2822
314	Ga0500557_000030	3300053105	Bacteria	76944
315	Ga0500562_026985	3300053108	Bacteria	1506
316	Ga0500569_005301	3300053109	Bacteria	2763
317	Ga0500594_0007037	3300053118	Bacteria	2539
318	Ga0500595_001029	3300053119	Bacteria	15582
319	Ga0500608_110552	3300053122	Bacteria	1260
320	Ga0500642_0000383	3300053130	Bacteria	14747
321	Ga0500642_0004300	3300053130	Bacteria	4439
322	Ga0500642_0008635	3300053130	Bacteria	3500
323	Ga0500658_0016273	3300053134	Bacteria	2770
324	Ga0500559_0120554	3300053136	Bacteria	1219
325	Ga0500622_0004598	3300053156	Bacteria	8579
326	Ga0500636_0008235	3300053177	Bacteria	6044
327	Ga0500599_001706	3300053736	Bacteria	2564
328	Ga0500601_000311	3300053737	Bacteria	9117
329	Ga0501082_0332253	3300060353	Bacteria	1324

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300048924	Ga0496121_0011784	Ga0496121_0011784_15_794	259
2	3300005563	Ga0068855_100265034	Ga0068855_1002650342	260
3	3300013105	Ga0157369_10274597	Ga0157369_102745972	260
4	3300046809	Ga0495600_0079813	Ga0495600_0079813_1290_2081	260
5	3300005336	Ga0070680_100049060	Ga0070680_1000490602	262
6	3300005436	Ga0070713_100163579	Ga0070713_1001635791	262
7	3300005458	Ga0070681_10021467	Ga0070681_100214678	262
8	3300005530	Ga0070679_100006124	Ga0070679_1000061249	262
9	3300009093	Ga0105240_10012778	Ga0105240_1001277810	262
10	3300013104	Ga0157370_10007034	Ga0157370_100070343	262
11	3300025912	Ga0207707_10006926	Ga0207707_100069268	262
12	3300025917	Ga0207660_10049541	Ga0207660_100495412	262
13	3300025921	Ga0207652_10018187	Ga0207652_100181873	262
14	3300005340	Ga0070689_100199874	Ga0070689_1001998742	264
15	3300005365	Ga0070688_100179336	Ga0070688_1001793361	264
16	3300009545	Ga0105237_10322925	Ga0105237_103229251	264
17	3300025936	Ga0207670_10216795	Ga0207670_102167952	264
18	3300025972	Ga0207668_10431445	Ga0207668_104314452	265
19	3300049571	Ga0501034_0098233	Ga0501034_0098233_1148_1996	266
20	3300049581	Ga0501047_0006619	Ga0501047_0006619_5318_6166	266
21	3300049823	Ga0501044_0004409	Ga0501044_0004409_6377_7225	266
22	3300009147	Ga0114129_11228984	Ga0114129_112289841	269
23	3300044706	Ga0466964_0078413	Ga0466964_0078413_364_1182	269
24	3300050507	nmdc:mga05p37_10564_c1	nmdc:mga05p37_10564_c1_9155_9976	269
25	3300005347	Ga0070668_100005869	Ga0070668_1000058696	270
26	3300005353	Ga0070669_100103273	Ga0070669_1001032733	270
27	3300005354	Ga0070675_100030965	Ga0070675_1000309653	270
28	3300005364	Ga0070673_100004800	Ga0070673_1000048002	270
29	3300005367	Ga0070667_100104795	Ga0070667_1001047952	270
30	3300005457	Ga0070662_100028003	Ga0070662_1000280034	270
31	3300005543	Ga0070672_100000502	Ga0070672_10000050212	270
32	3300005548	Ga0070665_100082095	Ga0070665_1000820952	270
33	3300005548	Ga0070665_100219660	Ga0070665_1002196602	270
34	3300005578	Ga0068854_100397860	Ga0068854_1003978602	270
35	3300005618	Ga0068864_100047127	Ga0068864_1000471272	270
36	3300005719	Ga0068861_100479718	Ga0068861_1004797182	270
37	3300005844	Ga0068862_100050406	Ga0068862_1000504065	270
38	3300013306	Ga0163162_10199127	Ga0163162_101991273	270
39	3300013308	Ga0157375_10033572	Ga0157375_100335723	270
40	3300017792	Ga0163161_10015799	Ga0163161_100157993	270
41	3300025926	Ga0207659_10084579	Ga0207659_100845792	270
42	3300025931	Ga0207644_10119938	Ga0207644_101199382	270
43	3300025933	Ga0207706_10037909	Ga0207706_100379091	270
44	3300025936	Ga0207670_10373489	Ga0207670_103734891	270
45	3300025938	Ga0207704_10087003	Ga0207704_100870033	270
46	3300025940	Ga0207691_10000842	Ga0207691_1000084212	270
47	3300025945	Ga0207679_10447563	Ga0207679_104475632	270
48	3300025960	Ga0207651_10738186	Ga0207651_107381861	270
49	3300025972	Ga0207668_10017120	Ga0207668_100171204	270
50	3300026095	Ga0207676_10175213	Ga0207676_101752132	270
51	3300026118	Ga0207675_100119163	Ga0207675_1001191632	270
52	3300026121	Ga0207683_10039752	Ga0207683_100397522	270
53	3300028379	Ga0268266_10153973	Ga0268266_101539732	270
54	3300028380	Ga0268265_10665218	Ga0268265_106652181	270
55	3300031691	Ga0316579_10098441	Ga0316579_100984411	270
56	3300031727	Ga0316576_10153347	Ga0316576_101533472	270
57	3300035398	Ga0316574_0000122	Ga0316574_0000122_3091_3951	270
58	3300035695	Ga0373927_0042058	Ga0373927_0042058_1795_2661	270
59	3300036647	Ga0316582_0312304	Ga0316582_0312304_38_898	270
60	3300036712	Ga0316584_0026664	Ga0316584_0026664_180_1040	270
61	3300048917	Ga0496114_0557653	Ga0496114_0557653_49_912	270
62	3300049578	Ga0501042_0151052	Ga0501042_0151052_841_1665	271
63	3300005435	Ga0070714_100256875	Ga0070714_1002568752	272
64	3300009147	Ga0114129_10308939	Ga0114129_103089392	272
65	3300042126	Ga0450888_000523	Ga0450888_000523_2661_3488	272
66	3300042127	Ga0450890_008970	Ga0450890_008970_60_887	272
67	3300042129	Ga0450891_004010	Ga0450891_004010_343_1170	272
68	3300042130	Ga0450892_001245	Ga0450892_001245_1204_2031	272
69	3300042532	Ga0450893_0001092	Ga0450893_0001092_2594_3421	272
70	3300046511	Ga0495608_0000796	Ga0495608_0000796_12663_13499	272
71	3300046516	Ga0495628_0179099	Ga0495628_0179099_135_959	272
72	3300046559	Ga0495667_0014686	Ga0495667_0014686_3143_3979	272
73	3300047317	Ga0495604_0019758	Ga0495604_0019758_774_1610	272
74	3300047444	Ga0495675_0026247	Ga0495675_0026247_1799_2635	272
75	3300050508	nmdc:mga09592_25936_c1	nmdc:mga09592_25936_c1_3839_4666	272
76	3300053077	Ga0495601_0106054	Ga0495601_0106054_842_1666	272
77	3300053085	Ga0495619_0024656	Ga0495619_0024656_1061_1885	272
78	iso_pu_bacteria	2507262055	2507511951	272
79	iso_pu_bacteria	2508501009	2508545616	272
80	iso_pu_bacteria	2511231028	2511398060	272
81	iso_pu_bacteria	2513237092	2513627408	272
82	iso_pu_bacteria	2513237102	2513699456	272
83	iso_pu_bacteria	2517093001	2517104429	272
84	iso_pu_bacteria	2617270741	2617376882	272
85	iso_pu_bacteria	2824600985	2824607162	272
86	iso_pu_bacteria	2824609381	2824615138	272
87	iso_pu_bacteria	2824617872	2824625644	272
88	iso_pu_bacteria	2824626560	2824633323	272
89	iso_pu_bacteria	2824635225	2824641836	272
90	iso_pu_bacteria	2824644064	2824649102	272
91	iso_pu_bacteria	2824653114	2824659909	272
92	iso_pu_bacteria	2824661429	2824668426	272
93	iso_pu_bacteria	2824679649	2824687721	272
94	iso_pu_bacteria	2824714736	2824721536	272
95	iso_pu_bacteria	2824723954	2824729364	272
96	iso_pu_bacteria	2824732956	2824740688	272
97	iso_pu_bacteria	2824746037	2824751336	272
98	iso_pu_bacteria	2857509624	2857515235	272
99	iso_pu_bacteria	2879099564	2879106359	272
100	iso_pu_bacteria	2881364244	2881371064	272
101	iso_pu_bacteria	2885366525	2885373993	272
102	iso_pu_bacteria	2888419890	2888426690	272
103	iso_pu_bacteria	2908775508	2908782780	272
104	iso_pu_bacteria	2922368715	2922370473	272
105	iso_pu_bacteria	2922393267	2922396510	272
106	iso_pu_bacteria	2929615660	2929620053	272
107	iso_pu_bacteria	2929624759	2929629366	272
108	iso_pu_bacteria	2932784394	2932789504	272
109	iso_pu_bacteria	2932809354	2932814989	272
110	iso_pu_bacteria	2932818245	2932824154	272
111	iso_pu_bacteria	2932828146	2932834118	272
112	iso_pu_bacteria	2933577622	2933581971	272
113	iso_pu_bacteria	2935616580	2935623492	272
114	iso_pu_bacteria	2935638405	2935644860	272
115	iso_pu_bacteria	2935665750	2935671928	272
116	iso_pu_bacteria	2935675223	2935683144	272
117	iso_pu_bacteria	2935684952	2935689312	272
118	iso_pu_bacteria	2935694250	2935697428	272
119	iso_pu_bacteria	2935703347	2935711003	272
120	iso_pu_bacteria	2935713505	2935720258	272
121	iso_pu_bacteria	2935722832	2935728125	272
122	iso_pu_bacteria	2935732158	2935737278	272
123	iso_pu_bacteria	2935741537	2935746661	272
124	iso_pu_bacteria	2935750917	2935757628	272
125	iso_pu_bacteria	2935760218	2935764004	272
126	iso_pu_bacteria	2935801545	2935808592	272
127	iso_pu_bacteria	2935810662	2935817389	272
128	iso_pu_bacteria	2935827899	2935834294	272
129	iso_pu_bacteria	2935837841	2935844877	272
130	iso_pu_bacteria	2935855204	2935861901	272
131	iso_pu_bacteria	2935864058	2935868464	272
132	iso_pu_bacteria	2935873716	2935879238	272
133	iso_pu_bacteria	2935992306	2935998595	272
134	iso_pu_bacteria	2936002035	2936008944	272
135	iso_pu_bacteria	2936037263	2936044186	272
136	iso_pu_bacteria	2940556831	2940563550	272
137	iso_pu_bacteria	2941538514	2941545229	272
138	iso_pu_bacteria	3005506211	3005506835	272
139	iso_pu_bacteria	3005587118	3005591644	272
140	iso_pu_bacteria	8006926726	8006928114	272
141	iso_pu_bacteria	8016511872	8016519404	272
142	iso_pu_bacteria	8017057580	8017066116	272
143	iso_pu_bacteria	8019576017	8019578514	272
144	iso_pu_bacteria	8019586578	8019596563	272
145	iso_pu_bacteria	8019597564	8019605142	272
146	iso_pu_bacteria	8019608314	8019613398	272
147	iso_pu_bacteria	8055742211	8055750194	272
148	3300005937	Ga0081455_10132051	Ga0081455_101320511	273
149	3300006175	Ga0070712_100485814	Ga0070712_1004858141	273
150	3300009094	Ga0111539_10495138	Ga0111539_104951382	273
151	3300025928	Ga0207700_10717710	Ga0207700_107177101	273
152	3300048918	Ga0496115_0035997	Ga0496115_0035997_2722_3606	273
153	3300049459	Ga0495678_077027	Ga0495678_077027_316_1179	273
154	3300049823	Ga0501044_0101598	Ga0501044_0101598_1676_2515	273
155	3300050511	nmdc:mga08y16_432858_c1	nmdc:mga08y16_432858_c1_142_981	273
156	3300053077	Ga0495601_0014094	Ga0495601_0014094_341_1180	273
157	3300053085	Ga0495619_0007264	Ga0495619_0007264_2126_2965	273
158	iso_pu_bacteria	2513237104	2513717704	273
159	iso_pu_bacteria	2524023205	2524438398	273
160	iso_pu_bacteria	2744054633	2745078450	273
161	iso_pu_bacteria	2857537821	2857540932	273
162	iso_pu_bacteria	2876761206	2876767499	273
163	iso_pu_bacteria	2935959822	2935965696	273
164	3300006852	Ga0075433_10434002	Ga0075433_104340022	274
165	3300046519	Ga0495632_0043861	Ga0495632_0043861_508_1410	274
166	3300048918	Ga0496115_0012977	Ga0496115_0012977_827_1687	274
167	3300049569	Ga0501032_0298248	Ga0501032_0298248_154_981	274
168	3300005290	Ga0065712_10205611	Ga0065712_102056112	275
169	3300005331	Ga0070670_100188417	Ga0070670_1001884172	275
170	3300005340	Ga0070689_100250595	Ga0070689_1002505952	275
171	3300005466	Ga0070685_10063750	Ga0070685_100637501	275
172	3300005577	Ga0068857_100051010	Ga0068857_1000510104	275
173	3300005617	Ga0068859_100064272	Ga0068859_1000642722	275
174	3300005618	Ga0068864_100012250	Ga0068864_1000122509	275
175	3300005840	Ga0068870_10040287	Ga0068870_100402872	275
176	3300005841	Ga0068863_100099531	Ga0068863_1000995312	275
177	3300005842	Ga0068858_100103828	Ga0068858_1001038282	275
178	3300006931	Ga0097620_100064273	Ga0097620_1000642733	275
179	3300009098	Ga0105245_10105080	Ga0105245_101050802	275
180	3300009101	Ga0105247_10202421	Ga0105247_102024212	275
181	3300009148	Ga0105243_10055132	Ga0105243_100551321	275
182	3300011119	Ga0105246_10276568	Ga0105246_102765682	275
183	3300025900	Ga0207710_10010498	Ga0207710_100104984	275
184	3300025908	Ga0207643_10123591	Ga0207643_101235912	275
185	3300025942	Ga0207689_10014305	Ga0207689_100143053	275
186	3300026035	Ga0207703_10074636	Ga0207703_100746362	275
187	3300026088	Ga0207641_10199432	Ga0207641_101994321	275
188	3300026116	Ga0207674_10058459	Ga0207674_100584592	275
189	3300047318	Ga0495636_0098381	Ga0495636_0098381_210_1046	275
190	3300048915	Ga0496112_0179097	Ga0496112_0179097_474_1310	275
191	3300049744	Ga0501083_0142566	Ga0501083_0142566_680_1516	275
192	3300053177	Ga0500636_0008235	Ga0500636_0008235_2471_3304	275
193	iso_pu_bacteria	2599185292	2599905049	275
194	iso_pu_bacteria	2643221569	2643860307	275
195	iso_pu_bacteria	2643221594	2643979471	275
196	iso_pu_bacteria	2808606395	2809035742	275
197	3300003215	JGI25153J46596_10003804	JGI25153J46596_100038045	276
198	3300003354	JGI25160J50197_1017552	JGI25160J50197_10175522	276
199	3300003794	Ga0055531_10006884	Ga0055531_100068848	276
200	3300005262	Ga0065165_1003604	Ga0065165_10036043	276
201	3300005262	Ga0065165_1004069	Ga0065165_10040697	276
202	3300005336	Ga0070680_100153292	Ga0070680_1001532922	276
203	3300005455	Ga0070663_100010209	Ga0070663_1000102092	276
204	3300005539	Ga0068853_100053785	Ga0068853_1000537854	276
205	3300005548	Ga0070665_100024180	Ga0070665_1000241804	276
206	3300005563	Ga0068855_100079034	Ga0068855_1000790344	276
207	3300005618	Ga0068864_100576470	Ga0068864_1005764702	276
208	3300005841	Ga0068863_100575728	Ga0068863_1005757282	276
209	3300006186	Ga0075369_10021413	Ga0075369_100214132	276
210	3300006353	Ga0075370_10053085	Ga0075370_100530851	276
211	3300006846	Ga0075430_100089898	Ga0075430_1000898982	276
212	3300006847	Ga0075431_100289384	Ga0075431_1002893842	276
213	3300009101	Ga0105247_10152717	Ga0105247_101527172	276
214	3300009101	Ga0105247_10294971	Ga0105247_102949711	276
215	3300009174	Ga0105241_10385304	Ga0105241_103853041	276
216	3300011119	Ga0105246_10209288	Ga0105246_102092882	276
217	3300013306	Ga0163162_10100137	Ga0163162_101001373	276
218	3300013307	Ga0157372_10151822	Ga0157372_101518223	276
219	3300013308	Ga0157375_10111011	Ga0157375_101110112	276
220	3300014325	Ga0163163_10188874	Ga0163163_101888742	276
221	3300014325	Ga0163163_10386166	Ga0163163_103861662	276
222	3300014325	Ga0163163_10562003	Ga0163163_105620031	276
223	3300021321	Ga0214542_1000007	Ga0214542_100000727	276
224	3300021324	Ga0214545_1000006	Ga0214545_1000006265	276
225	3300021324	Ga0214545_1032025	Ga0214545_10320251	276
226	3300021327	Ga0214543_1000009	Ga0214543_1000009354	276
227	3300021327	Ga0214543_1035933	Ga0214543_10359332	276
228	3300025245	Ga0207425_1009783	Ga0207425_10097833	276
229	3300025295	Ga0209564_1016955	Ga0209564_10169554	276
230	3300025297	Ga0209758_1000595	Ga0209758_100059532	276
231	3300025297	Ga0209758_1000604	Ga0209758_100060427	276
232	3300025299	Ga0209256_1019434	Ga0209256_10194342	276
233	3300025302	Ga0207426_1000500	Ga0207426_100050041	276
234	3300025302	Ga0207426_1003118	Ga0207426_10031185	276
235	3300025302	Ga0207426_1008389	Ga0207426_10083893	276
236	3300025302	Ga0207426_1011795	Ga0207426_10117952	276
237	3300025304	Ga0209257_1001945	Ga0209257_10019457	276
238	3300025912	Ga0207707_10037270	Ga0207707_100372705	276
239	3300025935	Ga0207709_10266717	Ga0207709_102667172	276
240	3300025972	Ga0207668_10552624	Ga0207668_105526241	276
241	3300026041	Ga0207639_10203512	Ga0207639_102035121	276
242	3300026041	Ga0207639_10407069	Ga0207639_104070691	276
243	3300026067	Ga0207678_10023755	Ga0207678_100237552	276
244	3300026088	Ga0207641_10476815	Ga0207641_104768151	276
245	3300026121	Ga0207683_10520778	Ga0207683_105207782	276
246	3300026142	Ga0207698_10318682	Ga0207698_103186822	276
247	3300028379	Ga0268266_10005168	Ga0268266_100051689	276
248	3300033180	Ga0307510_10006233	Ga0307510_100062334	276
249	3300037471	Ga0395905_0004875	Ga0395905_0004875_158_997	276
250	3300041505	Ga0451849_1350183	Ga0451849_1350183_364_1194	276
251	3300045976	Ga0466967_0323319	Ga0466967_0323319_339_1178	276
252	3300046455	Ga0495603_0031343	Ga0495603_0031343_1373_2212	276
253	3300046457	Ga0495590_0036404	Ga0495590_0036404_158_997	276
254	3300046460	Ga0495638_0016699	Ga0495638_0016699_20_859	276
255	3300046471	Ga0495650_0016042	Ga0495650_0016042_1444_2283	276
256	3300046474	Ga0495605_0036757	Ga0495605_0036757_980_1819	276
257	3300046524	Ga0495648_0103536	Ga0495648_0103536_332_1171	276
258	3300046660	Ga0495625_0018033	Ga0495625_0018033_391_1230	276
259	3300046794	Ga0495589_0025094	Ga0495589_0025094_912_1751	276
260	3300047315	Ga0495581_0265373	Ga0495581_0265373_147_986	276
261	3300047469	Ga0495673_0017602	Ga0495673_0017602_2431_3270	276
262	3300047472	Ga0495686_0066713	Ga0495686_0066713_588_1421	276
263	3300048903	Ga0496100_0078585	Ga0496100_0078585_233_1072	276
264	3300048905	Ga0496102_0446501	Ga0496102_0446501_10_849	276
265	3300048906	Ga0496103_0199642	Ga0496103_0199642_276_1115	276
266	3300048907	Ga0496104_0014714	Ga0496104_0014714_4623_5462	276
267	3300048908	Ga0496105_0017752	Ga0496105_0017752_3951_4790	276
268	3300048909	Ga0496106_0027635	Ga0496106_0027635_3363_4202	276
269	3300048912	Ga0496109_0097089	Ga0496109_0097089_1851_2690	276
270	3300048913	Ga0496110_0252096	Ga0496110_0252096_225_1064	276
271	3300048914	Ga0496111_0078088	Ga0496111_0078088_1528_2367	276
272	3300048917	Ga0496114_0061833	Ga0496114_0061833_850_1689	276
273	3300048918	Ga0496115_0062436	Ga0496115_0062436_2048_2887	276
274	3300048919	Ga0496116_0018120	Ga0496116_0018120_1068_1907	276
275	3300048920	Ga0496117_0112449	Ga0496117_0112449_657_1496	276
276	3300048921	Ga0496118_0024496	Ga0496118_0024496_1632_2471	276
277	3300048921	Ga0496118_0140199	Ga0496118_0140199_348_1187	276
278	3300048928	Ga0496125_0018087	Ga0496125_0018087_1511_2350	276
279	3300048929	Ga0496126_0050862	Ga0496126_0050862_2672_3511	276
280	3300048929	Ga0496126_0326866	Ga0496126_0326866_293_1132	276
281	3300050489	nmdc:mga03683_53684_c1	nmdc:mga03683_53684_c1_798_1637	276
282	3300050491	nmdc:mga00v17_46596_c1	nmdc:mga00v17_46596_c1_500_1339	276
283	3300050494	nmdc:mga06z11_177582_c1	nmdc:mga06z11_177582_c1_20_853	276
284	3300050509	nmdc:mga0qj67_312202_c1	nmdc:mga0qj67_312202_c1_176_1033	276
285	3300050510	nmdc:mga06r32_164524_c1	nmdc:mga06r32_164524_c1_1007_1864	276
286	3300050516	nmdc:mga0sz30_24139_c1	nmdc:mga0sz30_24139_c1_1630_2469	276
287	3300050516	nmdc:mga0sz30_51744_c1	nmdc:mga0sz30_51744_c1_248_1081	276
288	3300053087	Ga0500643_000013	Ga0500643_000013_272921_273760	276
289	3300053092	Ga0500583_0044122	Ga0500583_0044122_587_1426	276
290	3300053094	Ga0500566_0002898	Ga0500566_0002898_3811_4650	276
291	3300053094	Ga0500566_0090085	Ga0500566_0090085_834_1667	276
292	3300053095	Ga0500640_087061	Ga0500640_087061_458_1291	276
293	3300053104	Ga0500556_0009542	Ga0500556_0009542_211_1050	276
294	3300053105	Ga0500557_000030	Ga0500557_000030_52063_52902	276
295	3300053108	Ga0500562_026985	Ga0500562_026985_57_896	276
296	3300053109	Ga0500569_005301	Ga0500569_005301_1708_2541	276
297	3300053122	Ga0500608_110552	Ga0500608_110552_143_976	276
298	3300053130	Ga0500642_0000383	Ga0500642_0000383_2902_3738	276
299	3300053134	Ga0500658_0016273	Ga0500658_0016273_764_1597	276
300	3300053136	Ga0500559_0120554	Ga0500559_0120554_126_959	276
301	3300053156	Ga0500622_0004598	Ga0500622_0004598_699_1538	276
302	3300053736	Ga0500599_001706	Ga0500599_001706_1683_2522	276
303	3300053737	Ga0500601_000311	Ga0500601_000311_1127_1960	276
304	iso_pu_bacteria	2855730933	2855737002	276
305	iso_pu_bacteria	2855767633	2855767712	276
306	3300006871	Ga0075434_100640558	Ga0075434_1006405581	277
307	3300026078	Ga0207702_10444759	Ga0207702_104447591	277
308	3300031995	Ga0307409_100305643	Ga0307409_1003056432	277
309	3300032004	Ga0307414_10280809	Ga0307414_102808092	277
310	3300049575	Ga0501039_0378727	Ga0501039_0378727_62_904	277
311	3300049822	Ga0501035_0345339	Ga0501035_0345339_381_1223	277
312	3300050512	nmdc:mga0n895_610642_c1	nmdc:mga0n895_610642_c1_71_904	277
313	3300050514	nmdc:mga08x19_278172_c1	nmdc:mga08x19_278172_c1_255_1088	277
314	3300060353	Ga0501082_0332253	Ga0501082_0332253_112_954	277
315	3300003781	Ga0055536_1012596	Ga0055536_10125964	278
316	3300005548	Ga0070665_100593087	Ga0070665_1005930871	278
317	3300025292	Ga0209676_1000065	Ga0209676_1000065204	278
318	3300025298	Ga0209050_1022361	Ga0209050_10223612	278
319	3300028380	Ga0268265_10169132	Ga0268265_101691321	278
320	3300003215	JGI25153J46596_10017099	JGI25153J46596_100170992	279
321	3300003354	JGI25160J50197_1016717	JGI25160J50197_10167172	279
322	3300005290	Ga0065712_10068099	Ga0065712_100680999	279
323	3300005340	Ga0070689_100043701	Ga0070689_1000437012	279
324	3300005343	Ga0070687_100182205	Ga0070687_1001822051	279
325	3300005436	Ga0070713_100510002	Ga0070713_1005100021	279
326	3300005445	Ga0070708_100581336	Ga0070708_1005813361	279
327	3300005467	Ga0070706_100267733	Ga0070706_1002677331	279
328	3300005471	Ga0070698_100691193	Ga0070698_1006911931	279
329	3300005843	Ga0068860_100775657	Ga0068860_1007756571	279
330	3300005937	Ga0081455_10008195	Ga0081455_100081958	279
331	3300005937	Ga0081455_10123242	Ga0081455_101232422	279
332	3300006846	Ga0075430_100080837	Ga0075430_1000808373	279
333	3300006847	Ga0075431_100060118	Ga0075431_1000601183	279
334	3300006847	Ga0075431_100127229	Ga0075431_1001272293	279
335	3300006880	Ga0075429_100537140	Ga0075429_1005371401	279
336	3300025284	Ga0209130_1001807	Ga0209130_10018073	279
337	3300025292	Ga0209676_1006007	Ga0209676_10060074	279
338	3300025297	Ga0209758_1000074	Ga0209758_1000074210	279
339	3300025297	Ga0209758_1000932	Ga0209758_10009325	279
340	3300025298	Ga0209050_1007636	Ga0209050_10076362	279
341	3300025302	Ga0207426_1000235	Ga0207426_100023566	279
342	3300025910	Ga0207684_10186854	Ga0207684_101868542	279
343	3300025928	Ga0207700_10544166	Ga0207700_105441661	279
344	3300026088	Ga0207641_10490368	Ga0207641_104903682	279
345	3300028380	Ga0268265_10431717	Ga0268265_104317171	279
346	3300035113	Ga0373936_0101658	Ga0373936_0101658_289_1137	279
347	3300035117	Ga0373953_0028248	Ga0373953_0028248_1022_1870	279
348	3300035170	Ga0373943_0052666	Ga0373943_0052666_349_1197	279
349	3300035410	Ga0373924_0100765	Ga0373924_0100765_373_1221	279
350	3300035724	Ga0373933_0028962	Ga0373933_0028962_931_1779	279
351	3300036401	Ga0373937_0001808	Ga0373937_0001808_7884_8732	279
352	3300037068	Ga0373925_0025910	Ga0373925_0025910_1179_2027	279
353	3300044658	Ga0466972_0024344	Ga0466972_0024344_1674_2525	279
354	3300044683	Ga0466965_0095295	Ga0466965_0095295_209_1060	279
355	3300046511	Ga0495608_0046070	Ga0495608_0046070_1366_2214	279
356	3300046533	Ga0495640_0060943	Ga0495640_0060943_242_1090	279
357	3300046536	Ga0495587_0042525	Ga0495587_0042525_249_1097	279
358	3300046559	Ga0495667_0015558	Ga0495667_0015558_2438_3286	279
359	3300046642	Ga0495634_0234538	Ga0495634_0234538_72_920	279
360	3300046689	Ga0495613_0125200	Ga0495613_0125200_450_1298	279
361	3300047319	Ga0495674_0173651	Ga0495674_0173651_25_873	279
362	3300047444	Ga0495675_0175483	Ga0495675_0175483_89_937	279
363	3300047471	Ga0495684_0318206	Ga0495684_0318206_176_1024	279
364	3300048088	Ga0495602_0180420	Ga0495602_0180420_104_952	279
365	3300048905	Ga0496102_0064139	Ga0496102_0064139_335_1183	279
366	3300049570	Ga0501033_0007982	Ga0501033_0007982_2899_3867	279
367	3300049574	Ga0501038_0290646	Ga0501038_0290646_167_1009	279
368	3300049579	Ga0501043_0098410	Ga0501043_0098410_1399_2241	279
369	3300049581	Ga0501047_0246088	Ga0501047_0246088_109_951	279
370	3300049586	Ga0501070_0027186	Ga0501070_0027186_2406_3248	279
371	3300049590	Ga0501074_0307817	Ga0501074_0307817_114_956	279
372	3300049742	Ga0501080_0085801	Ga0501080_0085801_1032_1874	279
373	3300049822	Ga0501035_0158767	Ga0501035_0158767_424_1266	279
374	3300049823	Ga0501044_0009028	Ga0501044_0009028_7382_8224	279
375	3300049823	Ga0501044_0065040	Ga0501044_0065040_2714_3682	279
376	3300053084	Ga0495595_0173658	Ga0495595_0173658_119_967	279
377	3300053085	Ga0495619_0012283	Ga0495619_0012283_2967_3815	279
378	3300053130	Ga0500642_0004300	Ga0500642_0004300_184_1032	279
379	3300003187	JGI25151J46595_10000189	JGI25151J46595_1000018969	280
380	3300006844	Ga0075428_100006080	Ga0075428_1000060807	280
381	3300006844	Ga0075428_100693957	Ga0075428_1006939571	280
382	3300006852	Ga0075433_10713869	Ga0075433_107138691	280
383	3300009094	Ga0111539_10007174	Ga0111539_100071747	280
384	3300009094	Ga0111539_10184893	Ga0111539_101848931	280
385	3300009101	Ga0105247_10161311	Ga0105247_101613112	280
386	3300009147	Ga0114129_10370421	Ga0114129_103704212	280
387	3300011119	Ga0105246_10077488	Ga0105246_100774881	280
388	3300014968	Ga0157379_10078270	Ga0157379_100782702	280
389	3300025294	Ga0209025_1000027	Ga0209025_100002746	280
390	3300027671	Ga0209588_1001194	Ga0209588_10011942	280
391	3300027907	Ga0207428_10007551	Ga0207428_100075516	280
392	3300027907	Ga0207428_10377316	Ga0207428_103773161	280
393	3300046459	Ga0495629_0185249	Ga0495629_0185249_508_1368	280
394	3300046533	Ga0495640_0201432	Ga0495640_0201432_199_1059	280
395	3300047319	Ga0495674_0314661	Ga0495674_0314661_318_1178	280
396	3300048907	Ga0496104_0015436	Ga0496104_0015436_5776_6630	280
397	3300048910	Ga0496107_0095768	Ga0496107_0095768_744_1598	280
398	3300048912	Ga0496109_0130908	Ga0496109_0130908_1060_1914	280
399	3300048913	Ga0496110_0327484	Ga0496110_0327484_136_990	280
400	3300048917	Ga0496114_0230181	Ga0496114_0230181_295_1149	280
401	3300048918	Ga0496115_0009707	Ga0496115_0009707_3705_4559	280
402	3300049568	Ga0501031_0220290	Ga0501031_0220290_23_919	280
403	3300049823	Ga0501044_0000315	Ga0501044_0000315_2809_3669	280
404	3300050507	nmdc:mga05p37_948477_c1	nmdc:mga05p37_948477_c1_17_865	280
405	3300050511	nmdc:mga08y16_5512_c1	nmdc:mga08y16_5512_c1_4623_5477	280
406	3300050511	nmdc:mga08y16_96353_c1	nmdc:mga08y16_96353_c1_1580_2428	280
407	3300050515	nmdc:mga0a205_387470_c1	nmdc:mga0a205_387470_c1_12_860	280
408	3300053083	Ga0495655_0033775	Ga0495655_0033775_148_1008	280
409	3300053118	Ga0500594_0007037	Ga0500594_0007037_1305_2165	280
410	3300053119	Ga0500595_001029	Ga0500595_001029_6185_7045	280
411	3300053130	Ga0500642_0008635	Ga0500642_0008635_868_1728	280

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

102

197

0.99 PF13649

Methyltransf_25

Methyltransferase domain

101

193

0.95 PF13847

Methyltransf_31

Methyltransferase domain

95

201

0.94 PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

87

201

0.93 PF08242

Methyltransf_12

Methyltransferase domain

102

195

0.89 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
2nxe-assembly2.cif.gz_B	t. thermophilus ribosomal protein l11 methyltransferase (prma) in complex with s-adenosyl-l-methionine	0.85	44	156
2zbp-assembly1.cif.gz_A	crystal structure of ribosomal protein l11 methyltransferase from thermus thermophilus in complex with s-adenosyl-l-methionine	0.848	44	156
3cjt-assembly7.cif.gz_M	ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11	0.8475	43	156
2zbr-assembly1.cif.gz_A	crystal structure of ribosomal protein l11 methyltransferase from thermus thermophilus in complex with s-adenosyl-ornithine	0.8447	43	156
2zbq-assembly1.cif.gz_A	crystal structure of ribosomal protein l11 methyltransferase from thermus thermophilus in complex with s-adenosyl-l-homocysteine	0.8441	43	156

ID	Description	Score	Start	End	Superfamily
af_P9WLY9_5_208_3.40.50.150	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.9666	28	205	3.40.50.150
af_P9WLY7_8_274_3.40.50.150	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.9457	15	280	3.40.50.150
af_P9WLY7_8_274_3.40.50.150	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.9388	15	280	3.40.50.150
af_P25087_39_327_3.40.50.150	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.9226	44	159	3.40.50.150
af_Q4CM63_15_263_3.40.50.150	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39	0.9163	40	159	3.40.50.150

ID	Description	Score	Start	End	GO Terms
AF-A0A4R2CR44-F1-model_v4	Methyltransferase family protein	0.9783	11	280	GO:0008757 GO:0032259
AF-A0A4R2CR44-F1-model_v4	Methyltransferase family protein	0.9712	11	280	GO:0008757 GO:0032259
AF-A0A1I9YWI2-F1-model_v4	Class I SAM-dependent methyltransferase	0.9604	32	280	GO:0008757 GO:0032259
AF-A0A7G7MQX4-F1-model_v4	Class I SAM-dependent methyltransferase	0.9595	16	280	GO:0008168 GO:0032259
AF-A0A6G9Y7I9-F1-model_v4	Methyltransferase domain-containing protein	0.9554	18	279	GO:0008168 GO:0032259

Feature Viewer

pLDDT	pTM	Quality
94.05	0.9	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F437641

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF08241

Methyltransf_11

Methyltransferase domain

102

197

0.99

PF13649

Methyltransf_25

Methyltransferase domain

101

193

0.95

PF13847

Methyltransf_31

Methyltransferase domain

95

201

0.94

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

87

201

0.93

PF08242

Methyltransf_12

Methyltransferase domain

102

195

0.89

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map