F437617

General Info

Members Datasets Scaffolds Average Seq Length
411 201 409 198

Family's Representative Sequence

Representative Sequence 3300046691|Ga0495670_0006043|Ga0495670_0006043_2908_3624
Length 238
Sequence MGLCSNLIFFLYFLTCGCEFGGKFYFNENVNIFIGQLVLMVKVKTMDPDLIIKNVARHIQLNNDERNYFLSLLQEKKIKRRDYLLKPGEICRYEHFILQGCLRTYTIDDEGMEHIVMFGIEDWWVGDLYSFLTQTPANFFIDALEDTEILQISKSNLDNLYVKVPKFERLFRILFQNAFIAQQRRINQNLALTAEQRYMDFIEKFPMLEQRISQKQISSYLGITPVFLSMLRRKLAGK

Samples

Sample ID Description Type Environment
1 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
2 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
134 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
135 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
137 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
138 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
142 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
143 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
146 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
147 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
148 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
149 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
150 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
151 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
152 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
153 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
154 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
155 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
156 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
157 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
158 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
159 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
160 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
161 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
162 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
163 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
164 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
165 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
166 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
167 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
168 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
174 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
175 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
176 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
177 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
178 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
179 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
180 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
181 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
182 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
183 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
184 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
185 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
186 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
187 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
188 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
193 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
194 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
195 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
196 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
197 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
198 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
199 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
200 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
201 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0
Isolates 0.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.68
Nodule 0
Rhizoplane 0.97
Rhizosphere 93.92
Stem 0
Stem Tuber 0
Unclassified 2.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1005570 3300002738 Bacteria 1984
2 rootL2_10253079 3300003322 Bacteria 1746
3 rootL2_10256982 3300003322 Unclassified 4885
4 rootH1_10290926 3300003323 Bacteria 1419
5 rootH1_10364462 3300003323 Bacteria 1225
6 Ga0065704_10091266 3300005289 Bacteria 2724
7 Ga0065704_10363656 3300005289 Bacteria 794
8 Ga0065712_10071477 3300005290 Bacteria 5228
9 Ga0065707_10091224 3300005295 Bacteria 3984
10 Ga0070676_10051441 3300005328 Bacteria 2419
11 Ga0070676_10326164 3300005328 Bacteria 1048
12 Ga0070676_10418447 3300005328 Bacteria 936
13 Ga0070683_100003838 3300005329 Bacteria 12280
14 Ga0070683_100101385 3300005329 Bacteria 2711
15 Ga0070683_100450519 3300005329 Bacteria 1228
16 Ga0070690_100019565 3300005330 Bacteria 4112
17 Ga0070690_100773942 3300005330 Bacteria 742
18 Ga0070670_100009010 3300005331 Bacteria 8526
19 Ga0070670_100366446 3300005331 Bacteria 1268
20 Ga0068869_100003875 3300005334 Bacteria 9231
21 Ga0068869_100022514 3300005334 Bacteria 4343
22 Ga0068869_100051281 3300005334 Bacteria 2994
23 Ga0068869_100468877 3300005334 Unclassified 1047
24 Ga0068869_100481138 3300005334 Unclassified 1034
25 Ga0070666_10000045 3300005335 Bacteria 110131
26 Ga0070666_10007563 3300005335 Bacteria 6701
27 Ga0070666_10093807 3300005335 Bacteria 2064
28 Ga0070666_10169864 3300005335 Unclassified 1527
29 Ga0068868_100018774 3300005338 Bacteria 5172
30 Ga0068868_100075356 3300005338 Bacteria 2696
31 Ga0068868_100157666 3300005338 Bacteria 1873
32 Ga0070689_100017344 3300005340 Bacteria 5286
33 Ga0070689_100091099 3300005340 Bacteria 2403
34 Ga0070689_100271134 3300005340 Bacteria 1405
35 Ga0070691_10242501 3300005341 Unclassified 963
36 Ga0070687_100037595 3300005343 Bacteria 2421
37 Ga0070661_100045153 3300005344 Bacteria 3221
38 Ga0070668_100049931 3300005347 Bacteria 3219
39 Ga0070668_100155259 3300005347 Bacteria 1854
40 Ga0070669_100536487 3300005353 Bacteria 974
41 Ga0070671_100047640 3300005355 Bacteria 3563
42 Ga0070671_100088010 3300005355 Bacteria 2599
43 Ga0070671_100114796 3300005355 Bacteria 2264
44 Ga0070674_100491081 3300005356 Bacteria 1021
45 Ga0070673_100029845 3300005364 Bacteria 4071
46 Ga0070673_100030280 3300005364 Bacteria 4047
47 Ga0070673_101215671 3300005364 Bacteria 706
48 Ga0070688_100031287 3300005365 Bacteria 3201
49 Ga0070688_100103355 3300005365 Bacteria 1882
50 Ga0070688_100342678 3300005365 Bacteria 1092
51 Ga0070659_100008743 3300005366 Bacteria 7412
52 Ga0070667_100005964 3300005367 Bacteria 10127
53 Ga0070667_100055862 3300005367 Bacteria 3334
54 Ga0070667_100056312 3300005367 Bacteria 3321
55 Ga0070667_100163622 3300005367 Bacteria 1961
56 Ga0070667_100986210 3300005367 Unclassified 786
57 Ga0070700_100573344 3300005441 Bacteria 880
58 Ga0070663_100267350 3300005455 Bacteria 1358
59 Ga0070678_100003390 3300005456 Bacteria 8888
60 Ga0070678_100713707 3300005456 Bacteria 904
61 Ga0070662_100018008 3300005457 Bacteria 4771
62 Ga0070662_100020901 3300005457 Bacteria 4464
63 Ga0070681_10032393 3300005458 Bacteria 5245
64 Ga0070681_10041983 3300005458 Bacteria 4584
65 Ga0068867_100009497 3300005459 Bacteria 6861
66 Ga0068867_100099089 3300005459 Bacteria 2223
67 Ga0068867_100305955 3300005459 Bacteria 1312
68 Ga0068867_100638585 3300005459 Bacteria 933
69 Ga0070685_10005417 3300005466 Bacteria 6463
70 Ga0070685_10015557 3300005466 Bacteria 4041
71 Ga0070685_10576111 3300005466 Unclassified 807
72 Ga0070698_100003404 3300005471 Bacteria 17491
73 Ga0070698_100006731 3300005471 Bacteria 12461
74 Ga0070684_100051015 3300005535 Bacteria 3594
75 Ga0070684_100326382 3300005535 Bacteria 1410
76 Ga0068853_100003536 3300005539 Bacteria 11953
77 Ga0068853_100130625 3300005539 Bacteria 2248
78 Ga0068853_100773084 3300005539 Bacteria 918
79 Ga0070686_100005819 3300005544 Bacteria 6834
80 Ga0070686_100088871 3300005544 Bacteria 2063
81 Ga0070693_100143009 3300005547 Bacteria 1508
82 Ga0070665_100185859 3300005548 Bacteria 2079
83 Ga0068855_100062150 3300005563 Unclassified 4361
84 Ga0070664_100000779 3300005564 Bacteria 24595
85 Ga0070664_100009496 3300005564 Bacteria 7889
86 Ga0070664_100053653 3300005564 Bacteria 3418
87 Ga0070664_100365851 3300005564 Unclassified 1314
88 Ga0068857_100067650 3300005577 Bacteria 3179
89 Ga0068857_100124234 3300005577 Bacteria 2325
90 Ga0068857_100413090 3300005577 Bacteria 1257
91 Ga0068854_100260491 3300005578 Bacteria 1388
92 Ga0068854_100278078 3300005578 Bacteria 1347
93 Ga0068854_100340431 3300005578 Bacteria 1225
94 Ga0068856_100352543 3300005614 Bacteria 1490
95 Ga0068856_100679597 3300005614 Bacteria 1050
96 Ga0068856_100755925 3300005614 Bacteria 992
97 Ga0070702_100079373 3300005615 Bacteria 1961
98 Ga0070702_100177722 3300005615 Bacteria 1390
99 Ga0068852_100004253 3300005616 Bacteria 10109
100 Ga0068852_100184293 3300005616 Bacteria 1965
101 Ga0068852_100190906 3300005616 Bacteria 1933
102 Ga0068852_100755649 3300005616 Bacteria 985
103 Ga0068852_100786588 3300005616 Unclassified 965
104 Ga0068852_101555447 3300005616 Bacteria 684
105 Ga0068859_100000007 3300005617 Bacteria 390070
106 Ga0068859_100059975 3300005617 Bacteria 3834
107 Ga0068859_100185312 3300005617 Bacteria 2165
108 Ga0068864_100005298 3300005618 Bacteria 10555
109 Ga0068864_100005541 3300005618 Bacteria 10352
110 Ga0068864_100065998 3300005618 Unclassified 3140
111 Ga0068864_100180485 3300005618 Bacteria 1930
112 Ga0068864_100190296 3300005618 Bacteria 1881
113 Ga0068866_10060181 3300005718 Bacteria 1968
114 Ga0068866_10260411 3300005718 Bacteria 1065
115 Ga0068861_100171187 3300005719 Bacteria 1800
116 Ga0068861_100402318 3300005719 Unclassified 1215
117 Ga0068861_100508103 3300005719 Bacteria 1091
118 Ga0068851_10086264 3300005834 Bacteria 1647
119 Ga0068851_10142528 3300005834 Bacteria 1304
120 Ga0068863_100013652 3300005841 Bacteria 7834
121 Ga0068863_100267118 3300005841 Bacteria 1655
122 Ga0068863_100312917 3300005841 Bacteria 1524
123 Ga0068863_100476000 3300005841 Bacteria 1227
124 Ga0068858_100034007 3300005842 Bacteria 4728
125 Ga0068858_100044117 3300005842 Bacteria 4134
126 Ga0068858_100180039 3300005842 Bacteria 1995
127 Ga0068858_101183579 3300005842 Unclassified 751
128 Ga0068860_100000003 3300005843 Bacteria 575741
129 Ga0068860_100018146 3300005843 Bacteria 6848
130 Ga0068860_100221629 3300005843 Bacteria 1837
131 Ga0068860_100930645 3300005843 Bacteria 886
132 Ga0068862_100049087 3300005844 Unclassified 3604
133 Ga0068862_100111762 3300005844 Unclassified 2399
134 Ga0097621_100020694 3300006237 Bacteria 5073
135 Ga0097621_100046958 3300006237 Bacteria 3496
136 Ga0068871_100026918 3300006358 Bacteria 4492
137 Ga0068871_100061628 3300006358 Bacteria 3064
138 Ga0068871_100224382 3300006358 Unclassified 1629
139 Ga0068871_100420735 3300006358 Bacteria 1193
140 Ga0068871_100748416 3300006358 Bacteria 898
141 Ga0068871_101075260 3300006358 Bacteria 751
142 Ga0075428_100180980 3300006844 Bacteria 2281
143 Ga0068865_100059767 3300006881 Bacteria 2667
144 Ga0068865_100217119 3300006881 Bacteria 1493
145 Ga0097620_100000007 3300006931 Bacteria 390070
146 Ga0097620_100059975 3300006931 Bacteria 3834
147 Ga0097620_100185312 3300006931 Bacteria 2165
148 Ga0075435_100391316 3300007076 Bacteria 1195
149 Ga0105240_10000723 3300009093 Bacteria 60353
150 Ga0105240_10052057 3300009093 Bacteria 5148
151 Ga0105240_10132259 3300009093 Bacteria 2991
152 Ga0105240_10382561 3300009093 Unclassified 1589
153 Ga0105240_10648058 3300009093 Unclassified 1158
154 Ga0111539_10526710 3300009094 Bacteria 1377
155 Ga0105245_11190206 3300009098 Bacteria 810
156 Ga0105247_10001987 3300009101 Bacteria 14198
157 Ga0105247_10109219 3300009101 Bacteria 1778
158 Ga0105247_10329088 3300009101 Bacteria 1068
159 Ga0105243_10704408 3300009148 Bacteria 985
160 Ga0105243_10709194 3300009148 Unclassified 982
161 Ga0105241_10000277 3300009174 Bacteria 38322
162 Ga0105241_10003686 3300009174 Bacteria 11382
163 Ga0105241_10309555 3300009174 Bacteria 1358
164 Ga0105241_10417769 3300009174 Unclassified 1180
165 Ga0105242_10006460 3300009176 Bacteria 9029
166 Ga0105242_10026933 3300009176 Bacteria 4560
167 Ga0105242_10060471 3300009176 Bacteria 3113
168 Ga0105248_10113955 3300009177 Bacteria 3049
169 Ga0105248_10615679 3300009177 Bacteria 1225
170 Ga0105237_10001817 3300009545 Bacteria 27514
171 Ga0105237_10042232 3300009545 Bacteria 4600
172 Ga0105237_10048881 3300009545 Bacteria 4252
173 Ga0105237_10089469 3300009545 Bacteria 3068
174 Ga0105237_10320026 3300009545 Bacteria 1555
175 Ga0105238_10020774 3300009551 Bacteria 6687
176 Ga0105238_10978292 3300009551 Bacteria 867
177 Ga0105249_10001363 3300009553 Bacteria 21359
178 Ga0105249_10025159 3300009553 Bacteria 5357
179 Ga0105249_10041574 3300009553 Bacteria 4179
180 Ga0105249_10121889 3300009553 Bacteria 2479
181 Ga0105249_10586826 3300009553 Bacteria 1168
182 Ga0105249_10830374 3300009553 Bacteria 989
183 Ga0105239_10014209 3300010375 Bacteria 8836
184 Ga0105239_10014979 3300010375 Bacteria 8595
185 Ga0105239_10176725 3300010375 Bacteria 2388
186 Ga0105239_10185248 3300010375 Bacteria 2330
187 Ga0105239_10186130 3300010375 Bacteria 2324
188 Ga0105246_10013930 3300011119 Bacteria 5048
189 Ga0157373_10031316 3300013100 Unclassified 3829
190 Ga0157374_10000013 3300013296 Bacteria 461240
191 Ga0157374_10036779 3300013296 Bacteria 4487
192 Ga0157374_10102156 3300013296 Bacteria 2749
193 Ga0157374_10708029 3300013296 Bacteria 1020
194 Ga0157378_10005099 3300013297 Bacteria 11534
195 Ga0157378_10102265 3300013297 Bacteria 2617
196 Ga0157378_10163921 3300013297 Bacteria 2081
197 Ga0157378_10511743 3300013297 Bacteria 1201
198 Ga0163162_10000889 3300013306 Bacteria 27815
199 Ga0163162_10001040 3300013306 Bacteria 25805
200 Ga0163162_10007852 3300013306 Bacteria 10396
201 Ga0163162_10022675 3300013306 Bacteria 6189
202 Ga0163162_10088881 3300013306 Bacteria 3169
203 Ga0163162_10139372 3300013306 Bacteria 2538
204 Ga0157372_10019033 3300013307 Bacteria 7391
205 Ga0157372_10213231 3300013307 Bacteria 2238
206 Ga0157372_10424271 3300013307 Bacteria 1550
207 Ga0157372_10510246 3300013307 Bacteria 1402
208 Ga0157375_10005684 3300013308 Bacteria 10851
209 Ga0157375_10361922 3300013308 Bacteria 1617
210 Ga0157375_10643246 3300013308 Bacteria 1217
211 Ga0157375_10889756 3300013308 Bacteria 1035
212 Ga0157375_11070707 3300013308 Bacteria 943
213 Ga0163163_10504849 3300014325 Bacteria 1271
214 Ga0157377_10048943 3300014745 Unclassified 2374
215 Ga0157377_10115649 3300014745 Bacteria 1618
216 Ga0157379_10012610 3300014968 Bacteria 7383
217 Ga0157379_10128403 3300014968 Bacteria 2281
218 Ga0157379_10238266 3300014968 Bacteria 1650
219 Ga0157379_10576258 3300014968 Bacteria 1049
220 Ga0157376_10000349 3300014969 Bacteria 30853
221 Ga0157376_10004129 3300014969 Bacteria 10064
222 Ga0157376_10031103 3300014969 Bacteria 4270
223 Ga0157376_10050716 3300014969 Bacteria 3444
224 Ga0157376_10165192 3300014969 Bacteria 2011
225 Ga0163161_10003235 3300017792 Bacteria 11447
226 Ga0209646_1000923 3300025246 Bacteria 9404
227 Ga0207656_10051053 3300025321 Bacteria 1787
228 Ga0207642_10013348 3300025899 Bacteria 2996
229 Ga0207642_10111569 3300025899 Bacteria 1393
230 Ga0207710_10013541 3300025900 Bacteria 3432
231 Ga0207680_10000043 3300025903 Bacteria 64325
232 Ga0207680_10019803 3300025903 Unclassified 3607
233 Ga0207680_10109037 3300025903 Bacteria 1792
234 Ga0207685_10111593 3300025905 Bacteria 1186
235 Ga0207645_10005155 3300025907 Bacteria 9550
236 Ga0207645_10171480 3300025907 Bacteria 1422
237 Ga0207645_10338698 3300025907 Bacteria 1005
238 Ga0207654_10000590 3300025911 Bacteria 20481
239 Ga0207654_10013563 3300025911 Bacteria 4194
240 Ga0207707_10013216 3300025912 Bacteria 7195
241 Ga0207707_10038124 3300025912 Bacteria 4200
242 Ga0207695_10000648 3300025913 Bacteria 69088
243 Ga0207695_10092594 3300025913 Bacteria 3033
244 Ga0207695_10300285 3300025913 Bacteria 1497
245 Ga0207671_10001567 3300025914 Bacteria 26106
246 Ga0207671_10016863 3300025914 Bacteria 5657
247 Ga0207671_10030357 3300025914 Unclassified 4031
248 Ga0207671_10048831 3300025914 Bacteria 3132
249 Ga0207662_10357394 3300025918 Bacteria 982
250 Ga0207649_10022195 3300025920 Bacteria 3666
251 Ga0207646_10206559 3300025922 Bacteria 1774
252 Ga0207694_10145332 3300025924 Bacteria 1909
253 Ga0207694_10389051 3300025924 Bacteria 1158
254 Ga0207650_10070561 3300025925 Unclassified 2626
255 Ga0207650_10084163 3300025925 Bacteria 2417
256 Ga0207650_10193343 3300025925 Bacteria 1626
257 Ga0207650_10305128 3300025925 Bacteria 1301
258 Ga0207659_10134434 3300025926 Bacteria 1913
259 Ga0207659_10243001 3300025926 Unclassified 1457
260 Ga0207644_10120449 3300025931 Bacteria 1997
261 Ga0207644_10294969 3300025931 Bacteria 1305
262 Ga0207644_10670124 3300025931 Bacteria 864
263 Ga0207706_10001460 3300025933 Bacteria 23640
264 Ga0207706_10064042 3300025933 Bacteria 3237
265 Ga0207706_10143086 3300025933 Unclassified 2104
266 Ga0207686_10000812 3300025934 Bacteria 19072
267 Ga0207686_10045394 3300025934 Bacteria 2703
268 Ga0207709_10455646 3300025935 Bacteria 990
269 Ga0207670_10004956 3300025936 Bacteria 7248
270 Ga0207670_10023633 3300025936 Bacteria 3830
271 Ga0207670_10165184 3300025936 Bacteria 1656
272 Ga0207689_10000603 3300025942 Bacteria 34426
273 Ga0207689_10040626 3300025942 Bacteria 3849
274 Ga0207689_10048442 3300025942 Bacteria 3505
275 Ga0207689_10088616 3300025942 Bacteria 2542
276 Ga0207661_10053889 3300025944 Bacteria 3221
277 Ga0207661_11001803 3300025944 Unclassified 769
278 Ga0207679_10024807 3300025945 Bacteria 4115
279 Ga0207679_10034725 3300025945 Bacteria 3561
280 Ga0207679_10072621 3300025945 Bacteria 2600
281 Ga0207679_10123632 3300025945 Unclassified 2064
282 Ga0207667_10074684 3300025949 Unclassified 3521
283 Ga0207651_10048169 3300025960 Bacteria 2879
284 Ga0207712_10022069 3300025961 Bacteria 4188
285 Ga0207712_10029576 3300025961 Bacteria 3677
286 Ga0207712_10216868 3300025961 Bacteria 1528
287 Ga0207712_10587565 3300025961 Unclassified 962
288 Ga0207668_10269522 3300025972 Bacteria 1391
289 Ga0207640_10043478 3300025981 Unclassified 2872
290 Ga0207640_10422316 3300025981 Bacteria 1091
291 Ga0207658_10022589 3300025986 Bacteria 4382
292 Ga0207658_10050188 3300025986 Bacteria 3069
293 Ga0207658_10963640 3300025986 Bacteria 778
294 Ga0207677_10074724 3300026023 Bacteria 2406
295 Ga0207677_10313854 3300026023 Bacteria 1300
296 Ga0207677_10473029 3300026023 Bacteria 1078
297 Ga0207703_10002720 3300026035 Bacteria 15152
298 Ga0207703_10099325 3300026035 Bacteria 2463
299 Ga0207703_10123228 3300026035 Bacteria 2228
300 Ga0207703_10778662 3300026035 Bacteria 912
301 Ga0207639_10326733 3300026041 Bacteria 1363
302 Ga0207678_10296934 3300026067 Bacteria 1388
303 Ga0207702_10207402 3300026078 Bacteria 1820
304 Ga0207702_10729603 3300026078 Bacteria 977
305 Ga0207641_10000234 3300026088 Bacteria 71612
306 Ga0207641_10000380 3300026088 Bacteria 52801
307 Ga0207641_10456796 3300026088 Unclassified 1235
308 Ga0207648_10004687 3300026089 Bacteria 13985
309 Ga0207648_10085025 3300026089 Bacteria 2759
310 Ga0207648_10140673 3300026089 Unclassified 2127
311 Ga0207676_10005726 3300026095 Bacteria 8793
312 Ga0207676_10032233 3300026095 Bacteria 3947
313 Ga0207676_10055554 3300026095 Bacteria 3109
314 Ga0207676_10137933 3300026095 Bacteria 2084
315 Ga0207674_10034693 3300026116 Bacteria 5271
316 Ga0207674_10116290 3300026116 Bacteria 2646
317 Ga0207674_10228297 3300026116 Bacteria 1810
318 Ga0207674_10382020 3300026116 Bacteria 1362
319 Ga0207675_100011702 3300026118 Bacteria 8205
320 Ga0207675_100046756 3300026118 Bacteria 4043
321 Ga0207675_100740051 3300026118 Bacteria 994
322 Ga0207683_10020885 3300026121 Bacteria 5603
323 Ga0207683_10616279 3300026121 Unclassified 1005
324 Ga0207698_10011494 3300026142 Bacteria 5742
325 Ga0207698_10012152 3300026142 Bacteria 5619
326 Ga0207698_10081014 3300026142 Bacteria 2618
327 Ga0207698_10119298 3300026142 Bacteria 2229
328 Ga0207698_10274243 3300026142 Bacteria 1556
329 Ga0268266_10342989 3300028379 Bacteria 1402
330 Ga0268265_10099573 3300028380 Unclassified 2344
331 Ga0268265_10157321 3300028380 Bacteria 1925
332 Ga0268265_10573469 3300028380 Bacteria 1074
333 Ga0268264_10000063 3300028381 Bacteria 301702
334 Ga0268264_10001537 3300028381 Bacteria 21489
335 Ga0268264_10315983 3300028381 Bacteria 1475
336 Ga0268264_10516926 3300028381 Unclassified 1166
337 Ga0307509_10099578 3300031507 Bacteria 2948
338 Ga0307508_10001223 3300031616 Bacteria 29382
339 Ga0373936_0156945 3300035113 Bacteria 989
340 Ga0373956_0039138 3300035119 Bacteria 2101
341 Ga0373955_0060768 3300035172 Bacteria 2085
342 Ga0373924_0095054 3300035410 Bacteria 1278
343 Ga0373935_0262657 3300035692 Bacteria 1211
344 Ga0373937_0008408 3300036401 Bacteria 8970
345 Ga0373937_0467353 3300036401 Unclassified 1198
346 Ga0373937_0475673 3300036401 Bacteria 1187
347 Ga0451839_0573164 3300041496 Bacteria 1054
348 Ga0451843_1497077 3300041509 Unclassified 2064
349 Ga0466972_0000013 3300044658 Bacteria 229345
350 Ga0466972_0009123 3300044658 Bacteria 4981
351 Ga0466957_0387037 3300044842 Unclassified 954
352 Ga0495592_0235557 3300046454 Bacteria 1217
353 Ga0495653_0443062 3300046463 Bacteria 818
354 Ga0495594_0040813 3300046499 Bacteria 2541
355 Ga0495606_0003577 3300046507 Bacteria 16385
356 Ga0495628_0113306 3300046516 Bacteria 2084
357 Ga0495630_0037119 3300046517 Bacteria 3642
358 Ga0495648_0008089 3300046524 Bacteria 8314
359 Ga0495640_0358487 3300046533 Bacteria 899
360 Ga0495586_0214328 3300046535 Bacteria 1093
361 Ga0495667_0125941 3300046559 Bacteria 1653
362 Ga0495668_0003416 3300046616 Bacteria 11926
363 Ga0495625_0067929 3300046660 Bacteria 2507
364 Ga0495635_0146429 3300046663 Bacteria 1608
365 Ga0495657_0217435 3300046675 Bacteria 1160
366 Ga0495599_0130263 3300046678 Bacteria 1562
367 Ga0495613_0197605 3300046689 Bacteria 1419
368 Ga0495670_0006043 3300046691 Bacteria 5933
369 Ga0495581_0610219 3300047315 Unclassified 632
370 Ga0495604_0127927 3300047317 Bacteria 1829
371 Ga0495674_0121742 3300047319 Bacteria 2203
372 Ga0495680_0453633 3300047322 Bacteria 877
373 Ga0495687_000040 3300047443 Bacteria 230786
374 Ga0495684_0602495 3300047471 Bacteria 741
375 Ga0495686_0227762 3300047472 Bacteria 1057
376 Ga0496101_0402549 3300048904 Bacteria 1078
377 Ga0496106_0170723 3300048909 Bacteria 1724
378 Ga0496110_0071070 3300048913 Bacteria 3085
379 Ga0496115_0083660 3300048918 Unclassified 2601
380 Ga0501202_013382 3300049652 Bacteria 1559
381 Ga0501223_036235 3300049663 Bacteria 959
382 Ga0501235_022926 3300049669 Bacteria 1390
383 Ga0501242_002480 3300049674 Bacteria 1942
384 Ga0501243_007604 3300049675 Bacteria 1658
385 Ga0501246_010954 3300049676 Bacteria 835
386 Ga0501249_044644 3300049679 Bacteria 1010
387 Ga0501250_000850 3300049680 Unclassified 2277
388 Ga0501252_009140 3300049682 Bacteria 1151
389 Ga0501257_021557 3300049686 Unclassified 1520
390 Ga0501245_003601 3300049708 Unclassified 2109
391 Ga0501266_002195 3300049763 Bacteria 2467
392 Ga0501268_005648 3300049765 Unclassified 1805
393 Ga0501270_003442 3300049767 Bacteria 1708
394 Ga0501284_00003 3300050005 Bacteria 212116
395 nmdc:mga09592_436413_c1 3300050508 Bacteria 1130
396 nmdc:mga08y16_905646_c1 3300050511 Bacteria 868
397 nmdc:mga0n895_277549_c1 3300050512 Unclassified 1699
398 nmdc:mga0rr50_433021_c1 3300050513 Bacteria 1113
399 Ga0500646_0015172 3300053090 Unclassified 2006
400 Ga0500583_0003285 3300053092 Bacteria 5051
401 Ga0500572_028046 3300053111 Bacteria 1547
402 Ga0500642_0019638 3300053130 Bacteria 2640
403 Ga0500568_0009657 3300053139 Bacteria 4570
404 Ga0500568_0071264 3300053139 Bacteria 1331
405 Ga0500604_0003510 3300053151 Bacteria 4222
406 Ga0500616_0037613 3300053153 Bacteria 2619
407 Ga0500622_0005620 3300053156 Bacteria 7469
408 Ga0500636_0266520 3300053177 Bacteria 864
409 Ga0500645_084716 3300053730 Bacteria 902

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006881 Ga0068865_100059767 Ga0068865_1000597673 188
2 3300025907 Ga0207645_10171480 Ga0207645_101714802 188
3 3300025972 Ga0207668_10269522 Ga0207668_102695221 188
4 3300009545 Ga0105237_10048881 Ga0105237_100488814 189
5 3300010375 Ga0105239_10014979 Ga0105239_100149792 189
6 3300005441 Ga0070700_100573344 Ga0070700_1005733441 191
7 3300006844 Ga0075428_100180980 Ga0075428_1001809804 191
8 3300036401 Ga0373937_0475673 Ga0373937_0475673_38_613 191
9 3300041509 Ga0451843_1497077 Ga0451843_1497077_769_1344 191
10 3300046507 Ga0495606_0003577 Ga0495606_0003577_9513_10184 191
11 3300047472 Ga0495686_0227762 Ga0495686_0227762_42_617 191
12 3300009148 Ga0105243_10709194 Ga0105243_107091941 192
13 3300031616 Ga0307508_10001223 Ga0307508_1000122331 192
14 3300046616 Ga0495668_0003416 Ga0495668_0003416_4010_4600 192
15 3300049652 Ga0501202_013382 Ga0501202_013382_914_1498 192
16 3300049663 Ga0501223_036235 Ga0501223_036235_195_779 192
17 3300049669 Ga0501235_022926 Ga0501235_022926_727_1311 192
18 3300049674 Ga0501242_002480 Ga0501242_002480_219_803 192
19 3300049675 Ga0501243_007604 Ga0501243_007604_167_751 192
20 3300049676 Ga0501246_010954 Ga0501246_010954_62_646 192
21 3300049679 Ga0501249_044644 Ga0501249_044644_186_770 192
22 3300049680 Ga0501250_000850 Ga0501250_000850_1242_1826 192
23 3300049682 Ga0501252_009140 Ga0501252_009140_265_849 192
24 3300049686 Ga0501257_021557 Ga0501257_021557_302_886 192
25 3300049708 Ga0501245_003601 Ga0501245_003601_1235_1819 192
26 3300049763 Ga0501266_002195 Ga0501266_002195_972_1556 192
27 3300049765 Ga0501268_005648 Ga0501268_005648_798_1382 192
28 3300049767 Ga0501270_003442 Ga0501270_003442_870_1454 192
29 3300053151 Ga0500604_0003510 Ga0500604_0003510_887_1477 192
30 3300002738 JGI25154J39366_1005570 JGI25154J39366_10055702 193
31 3300003322 rootL2_10253079 rootL2_102530792 193
32 3300003322 rootL2_10256982 rootL2_102569823 193
33 3300003323 rootH1_10290926 rootH1_102909262 193
34 3300003323 rootH1_10364462 rootH1_103644622 193
35 3300005289 Ga0065704_10091266 Ga0065704_100912663 193
36 3300005289 Ga0065704_10363656 Ga0065704_103636561 193
37 3300005290 Ga0065712_10071477 Ga0065712_100714772 193
38 3300005295 Ga0065707_10091224 Ga0065707_100912242 193
39 3300005328 Ga0070676_10051441 Ga0070676_100514412 193
40 3300005328 Ga0070676_10326164 Ga0070676_103261641 193
41 3300005328 Ga0070676_10418447 Ga0070676_104184471 193
42 3300005329 Ga0070683_100003838 Ga0070683_10000383814 193
43 3300005329 Ga0070683_100101385 Ga0070683_1001013851 193
44 3300005329 Ga0070683_100450519 Ga0070683_1004505192 193
45 3300005330 Ga0070690_100019565 Ga0070690_1000195655 193
46 3300005330 Ga0070690_100773942 Ga0070690_1007739421 193
47 3300005331 Ga0070670_100009010 Ga0070670_1000090101 193
48 3300005331 Ga0070670_100366446 Ga0070670_1003664462 193
49 3300005334 Ga0068869_100003875 Ga0068869_1000038752 193
50 3300005334 Ga0068869_100022514 Ga0068869_1000225144 193
51 3300005334 Ga0068869_100051281 Ga0068869_1000512812 193
52 3300005334 Ga0068869_100468877 Ga0068869_1004688771 193
53 3300005334 Ga0068869_100481138 Ga0068869_1004811382 193
54 3300005335 Ga0070666_10000045 Ga0070666_1000004537 193
55 3300005335 Ga0070666_10007563 Ga0070666_100075634 193
56 3300005335 Ga0070666_10093807 Ga0070666_100938072 193
57 3300005335 Ga0070666_10169864 Ga0070666_101698642 193
58 3300005338 Ga0068868_100018774 Ga0068868_1000187745 193
59 3300005338 Ga0068868_100075356 Ga0068868_1000753561 193
60 3300005338 Ga0068868_100157666 Ga0068868_1001576662 193
61 3300005340 Ga0070689_100017344 Ga0070689_1000173445 193
62 3300005340 Ga0070689_100091099 Ga0070689_1000910993 193
63 3300005340 Ga0070689_100271134 Ga0070689_1002711341 193
64 3300005341 Ga0070691_10242501 Ga0070691_102425011 193
65 3300005343 Ga0070687_100037595 Ga0070687_1000375953 193
66 3300005344 Ga0070661_100045153 Ga0070661_1000451534 193
67 3300005347 Ga0070668_100049931 Ga0070668_1000499312 193
68 3300005347 Ga0070668_100155259 Ga0070668_1001552592 193
69 3300005353 Ga0070669_100536487 Ga0070669_1005364871 193
70 3300005355 Ga0070671_100047640 Ga0070671_1000476405 193
71 3300005355 Ga0070671_100088010 Ga0070671_1000880102 193
72 3300005355 Ga0070671_100114796 Ga0070671_1001147962 193
73 3300005356 Ga0070674_100491081 Ga0070674_1004910812 193
74 3300005364 Ga0070673_100029845 Ga0070673_1000298452 193
75 3300005364 Ga0070673_100030280 Ga0070673_1000302803 193
76 3300005364 Ga0070673_101215671 Ga0070673_1012156711 193
77 3300005365 Ga0070688_100031287 Ga0070688_1000312873 193
78 3300005365 Ga0070688_100103355 Ga0070688_1001033552 193
79 3300005365 Ga0070688_100342678 Ga0070688_1003426781 193
80 3300005366 Ga0070659_100008743 Ga0070659_10000874310 193
81 3300005367 Ga0070667_100005964 Ga0070667_10000596410 193
82 3300005367 Ga0070667_100055862 Ga0070667_1000558624 193
83 3300005367 Ga0070667_100056312 Ga0070667_1000563125 193
84 3300005367 Ga0070667_100163622 Ga0070667_1001636222 193
85 3300005367 Ga0070667_100986210 Ga0070667_1009862101 193
86 3300005455 Ga0070663_100267350 Ga0070663_1002673502 193
87 3300005456 Ga0070678_100003390 Ga0070678_1000033904 193
88 3300005456 Ga0070678_100713707 Ga0070678_1007137071 193
89 3300005457 Ga0070662_100018008 Ga0070662_1000180084 193
90 3300005457 Ga0070662_100020901 Ga0070662_1000209012 193
91 3300005458 Ga0070681_10032393 Ga0070681_100323932 193
92 3300005458 Ga0070681_10041983 Ga0070681_100419837 193
93 3300005459 Ga0068867_100009497 Ga0068867_1000094973 193
94 3300005459 Ga0068867_100099089 Ga0068867_1000990893 193
95 3300005459 Ga0068867_100305955 Ga0068867_1003059552 193
96 3300005459 Ga0068867_100638585 Ga0068867_1006385851 193
97 3300005466 Ga0070685_10005417 Ga0070685_100054173 193
98 3300005466 Ga0070685_10015557 Ga0070685_100155573 193
99 3300005466 Ga0070685_10576111 Ga0070685_105761111 193
100 3300005471 Ga0070698_100003404 Ga0070698_10000340421 193
101 3300005471 Ga0070698_100006731 Ga0070698_10000673111 193
102 3300005535 Ga0070684_100051015 Ga0070684_1000510155 193
103 3300005535 Ga0070684_100326382 Ga0070684_1003263821 193
104 3300005539 Ga0068853_100003536 Ga0068853_1000035368 193
105 3300005539 Ga0068853_100130625 Ga0068853_1001306252 193
106 3300005539 Ga0068853_100773084 Ga0068853_1007730841 193
107 3300005544 Ga0070686_100005819 Ga0070686_1000058193 193
108 3300005544 Ga0070686_100088871 Ga0070686_1000888712 193
109 3300005547 Ga0070693_100143009 Ga0070693_1001430092 193
110 3300005548 Ga0070665_100185859 Ga0070665_1001858592 193
111 3300005563 Ga0068855_100062150 Ga0068855_1000621504 193
112 3300005564 Ga0070664_100000779 Ga0070664_10000077922 193
113 3300005564 Ga0070664_100009496 Ga0070664_1000094968 193
114 3300005564 Ga0070664_100053653 Ga0070664_1000536533 193
115 3300005564 Ga0070664_100365851 Ga0070664_1003658512 193
116 3300005577 Ga0068857_100067650 Ga0068857_1000676504 193
117 3300005577 Ga0068857_100124234 Ga0068857_1001242341 193
118 3300005577 Ga0068857_100413090 Ga0068857_1004130902 193
119 3300005578 Ga0068854_100260491 Ga0068854_1002604912 193
120 3300005578 Ga0068854_100278078 Ga0068854_1002780781 193
121 3300005578 Ga0068854_100340431 Ga0068854_1003404312 193
122 3300005614 Ga0068856_100352543 Ga0068856_1003525433 193
123 3300005614 Ga0068856_100679597 Ga0068856_1006795971 193
124 3300005614 Ga0068856_100755925 Ga0068856_1007559251 193
125 3300005615 Ga0070702_100079373 Ga0070702_1000793731 193
126 3300005615 Ga0070702_100177722 Ga0070702_1001777221 193
127 3300005616 Ga0068852_100004253 Ga0068852_1000042537 193
128 3300005616 Ga0068852_100184293 Ga0068852_1001842933 193
129 3300005616 Ga0068852_100190906 Ga0068852_1001909062 193
130 3300005616 Ga0068852_100755649 Ga0068852_1007556491 193
131 3300005616 Ga0068852_100786588 Ga0068852_1007865882 193
132 3300005616 Ga0068852_101555447 Ga0068852_1015554471 193
133 3300005617 Ga0068859_100000007 Ga0068859_100000007293 193
134 3300005617 Ga0068859_100059975 Ga0068859_1000599751 193
135 3300005617 Ga0068859_100185312 Ga0068859_1001853123 193
136 3300005618 Ga0068864_100005298 Ga0068864_1000052983 193
137 3300005618 Ga0068864_100005541 Ga0068864_1000055415 193
138 3300005618 Ga0068864_100065998 Ga0068864_1000659983 193
139 3300005618 Ga0068864_100180485 Ga0068864_1001804852 193
140 3300005618 Ga0068864_100190296 Ga0068864_1001902962 193
141 3300005718 Ga0068866_10060181 Ga0068866_100601813 193
142 3300005718 Ga0068866_10260411 Ga0068866_102604111 193
143 3300005719 Ga0068861_100171187 Ga0068861_1001711872 193
144 3300005719 Ga0068861_100402318 Ga0068861_1004023182 193
145 3300005719 Ga0068861_100508103 Ga0068861_1005081032 193
146 3300005834 Ga0068851_10086264 Ga0068851_100862642 193
147 3300005834 Ga0068851_10142528 Ga0068851_101425283 193
148 3300005841 Ga0068863_100013652 Ga0068863_10001365210 193
149 3300005841 Ga0068863_100267118 Ga0068863_1002671182 193
150 3300005841 Ga0068863_100312917 Ga0068863_1003129173 193
151 3300005841 Ga0068863_100476000 Ga0068863_1004760001 193
152 3300005842 Ga0068858_100034007 Ga0068858_1000340073 193
153 3300005842 Ga0068858_100044117 Ga0068858_1000441172 193
154 3300005842 Ga0068858_100180039 Ga0068858_1001800392 193
155 3300005842 Ga0068858_101183579 Ga0068858_1011835791 193
156 3300005843 Ga0068860_100000003 Ga0068860_100000003215 193
157 3300005843 Ga0068860_100018146 Ga0068860_1000181463 193
158 3300005843 Ga0068860_100221629 Ga0068860_1002216292 193
159 3300005843 Ga0068860_100930645 Ga0068860_1009306451 193
160 3300005844 Ga0068862_100049087 Ga0068862_1000490871 193
161 3300005844 Ga0068862_100111762 Ga0068862_1001117622 193
162 3300006237 Ga0097621_100020694 Ga0097621_1000206947 193
163 3300006237 Ga0097621_100046958 Ga0097621_1000469584 193
164 3300006358 Ga0068871_100026918 Ga0068871_1000269185 193
165 3300006358 Ga0068871_100061628 Ga0068871_1000616284 193
166 3300006358 Ga0068871_100224382 Ga0068871_1002243822 193
167 3300006358 Ga0068871_100420735 Ga0068871_1004207352 193
168 3300006358 Ga0068871_100748416 Ga0068871_1007484162 193
169 3300006358 Ga0068871_101075260 Ga0068871_1010752601 193
170 3300006881 Ga0068865_100217119 Ga0068865_1002171192 193
171 3300006931 Ga0097620_100000007 Ga0097620_100000007294 193
172 3300006931 Ga0097620_100059975 Ga0097620_1000599751 193
173 3300006931 Ga0097620_100185312 Ga0097620_1001853122 193
174 3300007076 Ga0075435_100391316 Ga0075435_1003913161 193
175 3300009093 Ga0105240_10000723 Ga0105240_100007234 193
176 3300009093 Ga0105240_10052057 Ga0105240_100520574 193
177 3300009093 Ga0105240_10132259 Ga0105240_101322592 193
178 3300009093 Ga0105240_10382561 Ga0105240_103825612 193
179 3300009093 Ga0105240_10648058 Ga0105240_106480582 193
180 3300009094 Ga0111539_10526710 Ga0111539_105267102 193
181 3300009098 Ga0105245_11190206 Ga0105245_111902061 193
182 3300009101 Ga0105247_10001987 Ga0105247_100019875 193
183 3300009101 Ga0105247_10109219 Ga0105247_101092192 193
184 3300009101 Ga0105247_10329088 Ga0105247_103290881 193
185 3300009148 Ga0105243_10704408 Ga0105243_107044082 193
186 3300009174 Ga0105241_10000277 Ga0105241_1000027710 193
187 3300009174 Ga0105241_10003686 Ga0105241_100036869 193
188 3300009174 Ga0105241_10309555 Ga0105241_103095552 193
189 3300009174 Ga0105241_10417769 Ga0105241_104177692 193
190 3300009176 Ga0105242_10006460 Ga0105242_1000646011 193
191 3300009176 Ga0105242_10026933 Ga0105242_100269331 193
192 3300009176 Ga0105242_10060471 Ga0105242_100604713 193
193 3300009177 Ga0105248_10113955 Ga0105248_101139553 193
194 3300009177 Ga0105248_10615679 Ga0105248_106156792 193
195 3300009545 Ga0105237_10001817 Ga0105237_1000181720 193
196 3300009545 Ga0105237_10042232 Ga0105237_100422326 193
197 3300009545 Ga0105237_10089469 Ga0105237_100894694 193
198 3300009545 Ga0105237_10320026 Ga0105237_103200262 193
199 3300009551 Ga0105238_10020774 Ga0105238_100207746 193
200 3300009551 Ga0105238_10978292 Ga0105238_109782921 193
201 3300009553 Ga0105249_10001363 Ga0105249_1000136316 193
202 3300009553 Ga0105249_10025159 Ga0105249_100251592 193
203 3300009553 Ga0105249_10041574 Ga0105249_100415742 193
204 3300009553 Ga0105249_10121889 Ga0105249_101218891 193
205 3300009553 Ga0105249_10586826 Ga0105249_105868261 193
206 3300009553 Ga0105249_10830374 Ga0105249_108303742 193
207 3300010375 Ga0105239_10014209 Ga0105239_100142093 193
208 3300010375 Ga0105239_10176725 Ga0105239_101767252 193
209 3300010375 Ga0105239_10185248 Ga0105239_101852482 193
210 3300010375 Ga0105239_10186130 Ga0105239_101861302 193
211 3300011119 Ga0105246_10013930 Ga0105246_100139305 193
212 3300013100 Ga0157373_10031316 Ga0157373_100313161 193
213 3300013296 Ga0157374_10000013 Ga0157374_10000013297 193
214 3300013296 Ga0157374_10036779 Ga0157374_100367794 193
215 3300013296 Ga0157374_10102156 Ga0157374_101021563 193
216 3300013296 Ga0157374_10708029 Ga0157374_107080292 193
217 3300013297 Ga0157378_10005099 Ga0157378_100050996 193
218 3300013297 Ga0157378_10102265 Ga0157378_101022654 193
219 3300013297 Ga0157378_10163921 Ga0157378_101639212 193
220 3300013297 Ga0157378_10511743 Ga0157378_105117432 193
221 3300013306 Ga0163162_10000889 Ga0163162_1000088910 193
222 3300013306 Ga0163162_10001040 Ga0163162_100010404 193
223 3300013306 Ga0163162_10007852 Ga0163162_100078528 193
224 3300013306 Ga0163162_10022675 Ga0163162_100226752 193
225 3300013306 Ga0163162_10088881 Ga0163162_100888812 193
226 3300013306 Ga0163162_10139372 Ga0163162_101393724 193
227 3300013307 Ga0157372_10019033 Ga0157372_100190337 193
228 3300013307 Ga0157372_10213231 Ga0157372_102132312 193
229 3300013307 Ga0157372_10424271 Ga0157372_104242712 193
230 3300013307 Ga0157372_10510246 Ga0157372_105102462 193
231 3300013308 Ga0157375_10005684 Ga0157375_100056844 193
232 3300013308 Ga0157375_10361922 Ga0157375_103619222 193
233 3300013308 Ga0157375_10643246 Ga0157375_106432462 193
234 3300013308 Ga0157375_10889756 Ga0157375_108897561 193
235 3300013308 Ga0157375_11070707 Ga0157375_110707072 193
236 3300014325 Ga0163163_10504849 Ga0163163_105048492 193
237 3300014745 Ga0157377_10048943 Ga0157377_100489432 193
238 3300014745 Ga0157377_10115649 Ga0157377_101156493 193
239 3300014968 Ga0157379_10012610 Ga0157379_100126107 193
240 3300014968 Ga0157379_10128403 Ga0157379_101284033 193
241 3300014968 Ga0157379_10238266 Ga0157379_102382661 193
242 3300014968 Ga0157379_10576258 Ga0157379_105762582 193
243 3300014969 Ga0157376_10000349 Ga0157376_1000034910 193
244 3300014969 Ga0157376_10004129 Ga0157376_100041295 193
245 3300014969 Ga0157376_10031103 Ga0157376_100311032 193
246 3300014969 Ga0157376_10050716 Ga0157376_100507166 193
247 3300014969 Ga0157376_10165192 Ga0157376_101651922 193
248 3300017792 Ga0163161_10003235 Ga0163161_1000323512 193
249 3300025246 Ga0209646_1000923 Ga0209646_100092310 193
250 3300025321 Ga0207656_10051053 Ga0207656_100510532 193
251 3300025899 Ga0207642_10013348 Ga0207642_100133483 193
252 3300025899 Ga0207642_10111569 Ga0207642_101115692 193
253 3300025900 Ga0207710_10013541 Ga0207710_100135412 193
254 3300025903 Ga0207680_10000043 Ga0207680_1000004319 193
255 3300025903 Ga0207680_10019803 Ga0207680_100198032 193
256 3300025903 Ga0207680_10109037 Ga0207680_101090372 193
257 3300025905 Ga0207685_10111593 Ga0207685_101115931 193
258 3300025907 Ga0207645_10005155 Ga0207645_100051556 193
259 3300025907 Ga0207645_10338698 Ga0207645_103386981 193
260 3300025911 Ga0207654_10000590 Ga0207654_1000059022 193
261 3300025911 Ga0207654_10013563 Ga0207654_100135635 193
262 3300025912 Ga0207707_10013216 Ga0207707_100132167 193
263 3300025912 Ga0207707_10038124 Ga0207707_100381245 193
264 3300025913 Ga0207695_10000648 Ga0207695_1000064848 193
265 3300025913 Ga0207695_10092594 Ga0207695_100925942 193
266 3300025913 Ga0207695_10300285 Ga0207695_103002853 193
267 3300025914 Ga0207671_10001567 Ga0207671_1000156720 193
268 3300025914 Ga0207671_10016863 Ga0207671_100168639 193
269 3300025914 Ga0207671_10030357 Ga0207671_100303575 193
270 3300025914 Ga0207671_10048831 Ga0207671_100488312 193
271 3300025918 Ga0207662_10357394 Ga0207662_103573941 193
272 3300025920 Ga0207649_10022195 Ga0207649_100221954 193
273 3300025922 Ga0207646_10206559 Ga0207646_102065592 193
274 3300025924 Ga0207694_10145332 Ga0207694_101453321 193
275 3300025924 Ga0207694_10389051 Ga0207694_103890512 193
276 3300025925 Ga0207650_10070561 Ga0207650_100705612 193
277 3300025925 Ga0207650_10084163 Ga0207650_100841633 193
278 3300025925 Ga0207650_10193343 Ga0207650_101933432 193
279 3300025925 Ga0207650_10305128 Ga0207650_103051282 193
280 3300025926 Ga0207659_10134434 Ga0207659_101344342 193
281 3300025926 Ga0207659_10243001 Ga0207659_102430012 193
282 3300025931 Ga0207644_10120449 Ga0207644_101204492 193
283 3300025931 Ga0207644_10294969 Ga0207644_102949692 193
284 3300025931 Ga0207644_10670124 Ga0207644_106701242 193
285 3300025933 Ga0207706_10001460 Ga0207706_1000146013 193
286 3300025933 Ga0207706_10064042 Ga0207706_100640422 193
287 3300025933 Ga0207706_10143086 Ga0207706_101430862 193
288 3300025934 Ga0207686_10000812 Ga0207686_100008126 193
289 3300025934 Ga0207686_10045394 Ga0207686_100453943 193
290 3300025935 Ga0207709_10455646 Ga0207709_104556461 193
291 3300025936 Ga0207670_10004956 Ga0207670_100049562 193
292 3300025936 Ga0207670_10023633 Ga0207670_100236333 193
293 3300025936 Ga0207670_10165184 Ga0207670_101651842 193
294 3300025942 Ga0207689_10000603 Ga0207689_100006037 193
295 3300025942 Ga0207689_10040626 Ga0207689_100406262 193
296 3300025942 Ga0207689_10048442 Ga0207689_100484422 193
297 3300025942 Ga0207689_10088616 Ga0207689_100886161 193
298 3300025944 Ga0207661_10053889 Ga0207661_100538891 193
299 3300025944 Ga0207661_11001803 Ga0207661_110018031 193
300 3300025945 Ga0207679_10024807 Ga0207679_100248074 193
301 3300025945 Ga0207679_10034725 Ga0207679_100347253 193
302 3300025945 Ga0207679_10072621 Ga0207679_100726213 193
303 3300025945 Ga0207679_10123632 Ga0207679_101236323 193
304 3300025949 Ga0207667_10074684 Ga0207667_100746843 193
305 3300025960 Ga0207651_10048169 Ga0207651_100481693 193
306 3300025961 Ga0207712_10022069 Ga0207712_100220694 193
307 3300025961 Ga0207712_10029576 Ga0207712_100295763 193
308 3300025961 Ga0207712_10216868 Ga0207712_102168682 193
309 3300025961 Ga0207712_10587565 Ga0207712_105875651 193
310 3300025981 Ga0207640_10043478 Ga0207640_100434783 193
311 3300025981 Ga0207640_10422316 Ga0207640_104223161 193
312 3300025986 Ga0207658_10022589 Ga0207658_100225892 193
313 3300025986 Ga0207658_10050188 Ga0207658_100501884 193
314 3300025986 Ga0207658_10963640 Ga0207658_109636401 193
315 3300026023 Ga0207677_10074724 Ga0207677_100747242 193
316 3300026023 Ga0207677_10313854 Ga0207677_103138542 193
317 3300026023 Ga0207677_10473029 Ga0207677_104730292 193
318 3300026035 Ga0207703_10002720 Ga0207703_1000272017 193
319 3300026035 Ga0207703_10099325 Ga0207703_100993252 193
320 3300026035 Ga0207703_10123228 Ga0207703_101232282 193
321 3300026035 Ga0207703_10778662 Ga0207703_107786622 193
322 3300026041 Ga0207639_10326733 Ga0207639_103267331 193
323 3300026067 Ga0207678_10296934 Ga0207678_102969342 193
324 3300026078 Ga0207702_10207402 Ga0207702_102074021 193
325 3300026078 Ga0207702_10729603 Ga0207702_107296031 193
326 3300026088 Ga0207641_10000234 Ga0207641_100002343 193
327 3300026088 Ga0207641_10000380 Ga0207641_1000038052 193
328 3300026088 Ga0207641_10456796 Ga0207641_104567962 193
329 3300026089 Ga0207648_10004687 Ga0207648_100046876 193
330 3300026089 Ga0207648_10085025 Ga0207648_100850251 193
331 3300026089 Ga0207648_10140673 Ga0207648_101406732 193
332 3300026095 Ga0207676_10005726 Ga0207676_1000572610 193
333 3300026095 Ga0207676_10032233 Ga0207676_100322333 193
334 3300026095 Ga0207676_10055554 Ga0207676_100555542 193
335 3300026095 Ga0207676_10137933 Ga0207676_101379332 193
336 3300026116 Ga0207674_10034693 Ga0207674_100346934 193
337 3300026116 Ga0207674_10116290 Ga0207674_101162901 193
338 3300026116 Ga0207674_10228297 Ga0207674_102282972 193
339 3300026116 Ga0207674_10382020 Ga0207674_103820201 193
340 3300026118 Ga0207675_100011702 Ga0207675_10001170213 193
341 3300026118 Ga0207675_100046756 Ga0207675_1000467564 193
342 3300026118 Ga0207675_100740051 Ga0207675_1007400512 193
343 3300026121 Ga0207683_10020885 Ga0207683_100208853 193
344 3300026121 Ga0207683_10616279 Ga0207683_106162792 193
345 3300026142 Ga0207698_10011494 Ga0207698_100114942 193
346 3300026142 Ga0207698_10012152 Ga0207698_100121525 193
347 3300026142 Ga0207698_10081014 Ga0207698_100810142 193
348 3300026142 Ga0207698_10119298 Ga0207698_101192982 193
349 3300026142 Ga0207698_10274243 Ga0207698_102742432 193
350 3300028379 Ga0268266_10342989 Ga0268266_103429892 193
351 3300028380 Ga0268265_10099573 Ga0268265_100995732 193
352 3300028380 Ga0268265_10157321 Ga0268265_101573212 193
353 3300028380 Ga0268265_10573469 Ga0268265_105734691 193
354 3300028381 Ga0268264_10000063 Ga0268264_10000063133 193
355 3300028381 Ga0268264_10001537 Ga0268264_1000153724 193
356 3300028381 Ga0268264_10315983 Ga0268264_103159831 193
357 3300028381 Ga0268264_10516926 Ga0268264_105169261 193
358 3300031507 Ga0307509_10099578 Ga0307509_100995783 193
359 3300035113 Ga0373936_0156945 Ga0373936_0156945_105_719 193
360 3300035119 Ga0373956_0039138 Ga0373956_0039138_385_999 193
361 3300035172 Ga0373955_0060768 Ga0373955_0060768_1232_1846 193
362 3300035410 Ga0373924_0095054 Ga0373924_0095054_247_861 193
363 3300035692 Ga0373935_0262657 Ga0373935_0262657_340_954 193
364 3300036401 Ga0373937_0008408 Ga0373937_0008408_2583_3197 193
365 3300036401 Ga0373937_0467353 Ga0373937_0467353_549_1130 193
366 3300041496 Ga0451839_0573164 Ga0451839_0573164_165_755 193
367 3300044658 Ga0466972_0000013 Ga0466972_0000013_212844_213425 193
368 3300044658 Ga0466972_0009123 Ga0466972_0009123_277_867 193
369 3300044842 Ga0466957_0387037 Ga0466957_0387037_134_715 193
370 3300046454 Ga0495592_0235557 Ga0495592_0235557_443_1057 193
371 3300046463 Ga0495653_0443062 Ga0495653_0443062_193_807 193
372 3300046499 Ga0495594_0040813 Ga0495594_0040813_403_993 193
373 3300046516 Ga0495628_0113306 Ga0495628_0113306_985_1599 193
374 3300046517 Ga0495630_0037119 Ga0495630_0037119_1129_1743 193
375 3300046524 Ga0495648_0008089 Ga0495648_0008089_4456_5040 193
376 3300046533 Ga0495640_0358487 Ga0495640_0358487_153_767 193
377 3300046535 Ga0495586_0214328 Ga0495586_0214328_257_871 193
378 3300046559 Ga0495667_0125941 Ga0495667_0125941_1015_1629 193
379 3300046660 Ga0495625_0067929 Ga0495625_0067929_1334_1924 193
380 3300046663 Ga0495635_0146429 Ga0495635_0146429_139_753 193
381 3300046675 Ga0495657_0217435 Ga0495657_0217435_223_837 193
382 3300046678 Ga0495599_0130263 Ga0495599_0130263_320_934 193
383 3300046689 Ga0495613_0197605 Ga0495613_0197605_646_1260 193
384 3300046691 Ga0495670_0006043 Ga0495670_0006043_2908_3624 193
385 3300047315 Ga0495581_0610219 Ga0495581_0610219_14_604 193
386 3300047317 Ga0495604_0127927 Ga0495604_0127927_834_1448 193
387 3300047319 Ga0495674_0121742 Ga0495674_0121742_1543_2157 193
388 3300047322 Ga0495680_0453633 Ga0495680_0453633_166_780 193
389 3300047443 Ga0495687_000040 Ga0495687_000040_160676_161266 193
390 3300047471 Ga0495684_0602495 Ga0495684_0602495_79_693 193
391 3300048904 Ga0496101_0402549 Ga0496101_0402549_402_1016 193
392 3300048909 Ga0496106_0170723 Ga0496106_0170723_330_944 193
393 3300048913 Ga0496110_0071070 Ga0496110_0071070_231_839 193
394 3300048918 Ga0496115_0083660 Ga0496115_0083660_1956_2546 193
395 3300050005 Ga0501284_00003 Ga0501284_00003_46739_47374 193
396 3300050508 nmdc:mga09592_436413_c1 nmdc:mga09592_436413_c1_499_1089 193
397 3300050511 nmdc:mga08y16_905646_c1 nmdc:mga08y16_905646_c1_165_770 193
398 3300050512 nmdc:mga0n895_277549_c1 nmdc:mga0n895_277549_c1_807_1397 193
399 3300050513 nmdc:mga0rr50_433021_c1 nmdc:mga0rr50_433021_c1_81_695 193
400 3300053090 Ga0500646_0015172 Ga0500646_0015172_775_1359 193
401 3300053092 Ga0500583_0003285 Ga0500583_0003285_1579_2163 193
402 3300053111 Ga0500572_028046 Ga0500572_028046_956_1537 193
403 3300053130 Ga0500642_0019638 Ga0500642_0019638_796_1380 193
404 3300053139 Ga0500568_0009657 Ga0500568_0009657_1524_2114 193
405 3300053139 Ga0500568_0071264 Ga0500568_0071264_461_1051 193
406 3300053153 Ga0500616_0037613 Ga0500616_0037613_749_1339 193
407 3300053156 Ga0500622_0005620 Ga0500622_0005620_360_944 193
408 3300053177 Ga0500636_0266520 Ga0500636_0266520_11_592 193
409 3300053730 Ga0500645_084716 Ga0500645_084716_205_795 193
410 iso_pu_bacteria 2919186247 2919191405 193
411 iso_pu_bacteria 2939664404 2939669676 193

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00027

cNMP_binding

Cyclic nucleotide-binding domain

75

163

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dn7-assembly1.cif.gz_A cyclic nucleotide binding regulatory protein from cytophaga hutchinsonii. 0.9284 1 146
3dn7-assembly1.cif.gz_A cyclic nucleotide binding regulatory protein from cytophaga hutchinsonii. 0.9224 1 146
5e44-assembly1.cif.gz_A-2 crystal structure of holo-fnr of a. fischeri 0.9064 14 191
3i54-assembly2.cif.gz_C crystal structure of mtbcrp in complex with camp 0.897 21 191
8qto-assembly1.cif.gz_A-2 crystal structure of holo-l28h-fnr of a. fischeri 0.8876 5 191
ID Description Score Start End Superfamily
3dn7A00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9316 2 141 2.60.120.10
3dn7A00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9007 2 141 2.60.120.10
5e44A01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8828 14 147 2.60.120.10
5cvrA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8812 29 147 2.60.120.10
af_E7F4S2_593_708_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8796 24 136 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7U4E715-F1-model_v4 Transcriptional regulator, Crp/Fnr family 0.9821 1 192
AF-A0A2T5RQN7-F1-model_v4 deleted 0.9816 8 189
AF-A0A3B8HYI5-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.98 2 190 GO:0016020
AF-A0A1Q3GLG7-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.9794 6 191 GO:0003700
GO:0005829
AF-L8JPR6-F1-model_v4 cAMP-binding protein 0.9792 1 188

Feature Viewer

pLDDT pTM Quality
94.53 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map