F437604

General Info

Members Datasets Scaffolds Average Seq Length
411 341 214 322

Family's Representative Sequence

Representative Sequence 3300046472|Ga0495580_0074265|Ga0495580_0074265_1149_2207
Length 352
Sequence MLIAAARHRSDVFHPRRNTTMLSIFHHRPFGRAALTLVASVAFVCALAAPDSAVAQQKFVTIGTGGVTGVYYAVGGAICRLVNKDRAKHGLRCSVESTGGSVYNVNTIKAGELDFGLSQSDVQYQSYKGTGPFKEAYGDLRAVMSVHPEPFTVVARKEANIKTFADFKGKRFNVGNPGSGTRSAMDELLIGLNMKISDFALASELKADEHGPALCDNKIDGFFYGVGHPSANIQDPTTACGAKLVSLTGPAIDDLVKKNPYYAYATIPGGMYANNPDPTKTYGVLATLVTSTKVPADVVYVITKAVFDNFDEFKKLHPAFANLDPKTMVQDGLSAPLHEGAARYYKEKGWIK

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
3 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
4 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
5 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
6 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
7 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
8 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
9 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
10 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
11 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
12 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
13 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
14 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
15 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
16 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
17 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
18 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
19 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
20 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
21 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
22 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
23 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
24 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
25 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
26 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
27 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
28 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
29 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
30 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
31 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
32 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
33 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
34 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
35 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
36 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
37 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
38 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
39 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
40 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
41 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
42 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
43 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
44 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
45 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
46 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
47 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
48 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
49 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
50 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
51 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
52 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
53 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
54 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
55 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
56 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
57 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
58 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
59 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
60 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
61 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
62 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
63 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
64 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
65 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
66 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
67 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
68 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
69 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
70 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
71 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
72 2932401849 Devosia sp. 2618 Isolate Rhizosphere
73 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
74 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
75 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
76 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
77 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
78 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
79 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
80 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
81 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
82 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
83 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
84 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
85 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
86 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
87 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
88 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
89 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
90 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
91 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
92 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
93 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
94 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
95 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
96 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
97 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
98 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
99 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
100 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
101 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
102 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
103 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
104 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
105 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
106 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
107 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
108 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
109 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
110 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
111 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
112 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
113 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
114 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
115 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
116 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
117 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
118 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
119 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
120 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
121 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
122 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
123 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
124 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
125 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
126 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
127 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
128 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
129 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
130 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
131 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
132 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
133 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
134 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
135 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
136 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
137 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
138 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
139 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
140 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
141 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
142 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
143 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
144 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
145 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
146 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
147 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
148 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
149 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
150 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
151 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
152 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
153 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
154 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
155 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
156 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
157 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
158 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
159 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
160 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
161 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
162 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
163 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
164 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
165 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
166 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
167 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
168 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
169 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
170 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
171 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
172 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
173 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
174 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
175 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
176 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
177 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
178 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
179 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
180 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
181 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
182 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
183 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
184 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
185 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
186 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
187 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
188 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
189 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
190 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
191 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
192 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
193 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
194 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
195 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
196 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
197 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
198 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
199 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
200 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
201 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
202 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
203 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
204 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
205 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
206 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
207 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
208 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
209 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
210 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
211 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
212 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
213 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
214 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
215 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
216 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
217 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
218 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
219 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
220 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
221 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
222 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
223 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
224 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
225 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
226 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
227 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
238 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
240 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
241 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
242 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
244 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
245 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
246 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
247 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
248 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
249 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
250 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
251 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
252 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
253 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
254 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
255 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
256 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
257 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
258 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
259 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
260 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
261 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
262 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
263 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
264 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
265 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
266 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
267 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
268 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
269 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
270 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
271 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
272 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
273 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
274 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
275 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
276 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
277 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
278 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
279 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
280 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
281 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
282 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
283 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
284 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
285 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
286 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
287 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
288 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
289 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
290 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
291 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
292 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
293 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
294 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
295 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
296 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
297 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
298 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
299 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
300 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
301 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
314 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
315 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
316 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
317 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
318 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
319 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
320 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
321 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
322 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
324 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
325 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
326 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
327 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
328 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
329 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
330 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
331 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
332 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
333 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
334 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
335 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
336 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
337 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
338 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
339 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
340 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
341 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 52.07
Metatranscriptomes 0
Isolates 47.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.33
Nodule 48.42
Rhizoplane 1.95
Rhizosphere 42.34
Stem 0
Stem Tuber 0
Unclassified 0.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10161459 3300005327 Bacteria 1880
2 Ga0070668_100129308 3300005347 Bacteria 2026
3 Ga0070708_100011404 3300005445 Bacteria 7232
4 Ga0070663_100167063 3300005455 Bacteria 1698
5 Ga0070706_100082095 3300005467 Bacteria 2986
6 Ga0068855_100008578 3300005563 Bacteria 12358
7 Ga0068855_100106362 3300005563 Bacteria 3225
8 Ga0068859_100025284 3300005617 Bacteria 5956
9 Ga0068858_100371989 3300005842 Bacteria 1371
10 Ga0068860_100056089 3300005843 Bacteria 3747
11 Ga0068860_100516778 3300005843 Bacteria 1194
12 Ga0068862_100127534 3300005844 Bacteria 2248
13 Ga0081455_10000042 3300005937 Bacteria 133329
14 Ga0075365_10009157 3300006038 Bacteria 5673
15 Ga0075368_10022242 3300006042 Bacteria 2413
16 Ga0075368_10031205 3300006042 Bacteria 2065
17 Ga0075363_100004500 3300006048 Bacteria 6110
18 Ga0075363_100011530 3300006048 Bacteria 4235
19 Ga0075363_100014960 3300006048 Bacteria 3805
20 Ga0075364_10022692 3300006051 Bacteria 3967
21 Ga0075367_10002799 3300006178 Bacteria 8091
22 Ga0075367_10083951 3300006178 Bacteria 1930
23 Ga0075366_10120180 3300006195 Bacteria 1583
24 Ga0075366_10197214 3300006195 Bacteria 1224
25 Ga0075370_10002745 3300006353 Bacteria 8243
26 Ga0075428_100004374 3300006844 Bacteria 15594
27 Ga0075428_100103828 3300006844 Bacteria 3099
28 Ga0075431_100000021 3300006847 Bacteria 82774
29 Ga0075431_100001416 3300006847 Bacteria 22029
30 Ga0075431_100029012 3300006847 Bacteria 5691
31 Ga0075431_100079274 3300006847 Bacteria 3390
32 Ga0075433_10009462 3300006852 Bacteria 7788
33 Ga0075434_100002199 3300006871 Bacteria 16994
34 Ga0097620_100025285 3300006931 Bacteria 5956
35 Ga0105240_10003161 3300009093 Bacteria 25902
36 Ga0111539_10004677 3300009094 Bacteria 17885
37 Ga0111539_10083117 3300009094 Bacteria 3766
38 Ga0105245_10096672 3300009098 Bacteria 2726
39 Ga0114129_10000068 3300009147 Bacteria 93579
40 Ga0114129_10049204 3300009147 Bacteria 5924
41 Ga0114129_10222237 3300009147 Bacteria 2547
42 Ga0114129_10328678 3300009147 Bacteria 2031
43 Ga0105243_10031389 3300009148 Bacteria 4096
44 Ga0105238_10022264 3300009551 Bacteria 6461
45 Ga0105028_104332 3300009993 Bacteria 1478
46 Ga0157370_10090510 3300013104 Bacteria 2873
47 Ga0228710_1002119 3300022740 Bacteria 30942
48 Ga0207695_10278136 3300025913 Bacteria 1568
49 Ga0207662_10049307 3300025918 Bacteria 2498
50 Ga0207694_10154975 3300025924 Bacteria 1847
51 Ga0207709_10072567 3300025935 Bacteria 2190
52 Ga0207691_10221635 3300025940 Bacteria 1640
53 Ga0207667_10047282 3300025949 Bacteria 4554
54 Ga0207667_10135714 3300025949 Bacteria 2534
55 Ga0207712_10405421 3300025961 Bacteria 1147
56 Ga0207668_10073120 3300025972 Bacteria 2456
57 Ga0207678_10182652 3300026067 Bacteria 1791
58 Ga0207675_100051957 3300026118 Bacteria 3825
59 Ga0209281_1000111 3300027111 Bacteria 215615
60 Ga0209281_1000185 3300027111 Bacteria 144489
61 Ga0209981_1013706 3300027378 Bacteria 1129
62 Ga0209282_1000012 3300027666 Bacteria 215614
63 Ga0209813_10001117 3300027866 Bacteria 5987
64 Ga0209813_10006855 3300027866 Bacteria 2824
65 Ga0209813_10012717 3300027866 Bacteria 2232
66 Ga0207428_10001639 3300027907 Bacteria 23286
67 Ga0207428_10034478 3300027907 Bacteria 4147
68 Ga0268265_10071149 3300028380 Bacteria 2708
69 Ga0316575_10002137 3300031665 Bacteria 6594
70 Ga0316579_10000497 3300031691 Bacteria 12848
71 Ga0307413_10097292 3300031824 Bacteria 1935
72 Ga0307406_10399767 3300031901 Bacteria 1089
73 Ga0307412_10114977 3300031911 Bacteria 1928
74 Ga0307412_10164364 3300031911 Bacteria 1653
75 Ga0315914_1000007 3300031967 Bacteria 215597
76 Ga0307409_100033768 3300031995 Bacteria 3727
77 Ga0307409_100126986 3300031995 Bacteria 2171
78 Ga0307416_100021517 3300032002 Bacteria 4633
79 Ga0307416_100044003 3300032002 Bacteria 3502
80 Ga0307414_10162599 3300032004 Bacteria 1775
81 Ga0315913_1000003 3300033430 Bacteria 215608
82 Ga0315915_1000011 3300033464 Bacteria 215597
83 Ga0373938_0007198 3300034957 Bacteria 1951
84 Ga0373926_0111779 3300035083 Bacteria 1027
85 Ga0373940_0009132 3300035088 Bacteria 2297
86 Ga0373944_0037508 3300035089 Bacteria 1485
87 Ga0373932_0006856 3300035112 Bacteria 2705
88 Ga0373932_0028460 3300035112 Bacteria 1536
89 Ga0373939_0000554 3300035114 Bacteria 9348
90 Ga0373939_0037367 3300035114 Bacteria 1442
91 Ga0373945_0015011 3300035116 Bacteria 2602
92 Ga0373956_0070048 3300035119 Bacteria 1600
93 Ga0373946_0039979 3300035171 Bacteria 1917
94 Ga0373961_0045647 3300035241 Bacteria 1282
95 Ga0373962_0018221 3300035242 Bacteria 1826
96 Ga0373924_0003324 3300035410 Bacteria 5519
97 Ga0373931_0006231 3300035691 Bacteria 5560
98 Ga0373927_0017747 3300035695 Bacteria 4682
99 Ga0373947_0033118 3300035725 Bacteria 3049
100 Ga0373925_0023776 3300037068 Bacteria 4470
101 Ga0373925_0049880 3300037068 Bacteria 3121
102 Ga0373925_0064992 3300037068 Bacteria 2748
103 Ga0373925_0065530 3300037068 Bacteria 2736
104 Ga0395899_0003260 3300037312 Bacteria 12869
105 Ga0395899_0073319 3300037312 Bacteria 2504
106 Ga0395900_0006794 3300037418 Bacteria 11873
107 Ga0395898_0005852 3300037466 Bacteria 13224
108 Ga0395898_0036926 3300037466 Bacteria 4849
109 Ga0395898_0063122 3300037466 Bacteria 3595
110 Ga0395905_0000065 3300037471 Bacteria 184928
111 Ga0395905_0001297 3300037471 Bacteria 30740
112 Ga0395905_0018028 3300037471 Bacteria 6702
113 Ga0395901_0021275 3300038443 Bacteria 6643
114 Ga0395901_0070828 3300038443 Bacteria 3633
115 Ga0395901_0091345 3300038443 Bacteria 3187
116 Ga0395901_0193215 3300038443 Bacteria 2134
117 Ga0400483_002488 3300039062 Bacteria 2274
118 Ga0439445_0020350 3300042004 Bacteria 1661
119 Ga0439449_0002879 3300042007 Bacteria 6694
120 Ga0450898_023363 3300042134 Bacteria 1099
121 Ga0451577_0142889 3300042876 Bacteria 2151
122 Ga0453684_0395157 3300044712 Bacteria 1550
123 Ga0495629_0011489 3300046459 Bacteria 6432
124 Ga0495580_0025256 3300046472 Bacteria 4343
125 Ga0495580_0074265 3300046472 Bacteria 2373
126 Ga0495582_0011092 3300046473 Bacteria 4962
127 Ga0495665_0003868 3300046531 Bacteria 8099
128 Ga0495645_0006511 3300046543 Bacteria 8108
129 Ga0495599_0128691 3300046678 Bacteria 1573
130 Ga0495613_0020574 3300046689 Bacteria 4919
131 Ga0495581_0077111 3300047315 Bacteria 1928
132 Ga0495680_0252661 3300047322 Bacteria 1249
133 Ga0495684_0011709 3300047471 Bacteria 6772
134 Ga0495602_0063258 3300048088 Bacteria 3207
135 Ga0496102_0203299 3300048905 Bacteria 1867
136 Ga0496104_0000088 3300048907 Bacteria 88904
137 Ga0496105_0027570 3300048908 Bacteria 4642
138 Ga0496108_0012115 3300048911 Bacteria 7011
139 Ga0496109_0001545 3300048912 Bacteria 19142
140 Ga0496110_0001147 3300048913 Bacteria 18763
141 Ga0496111_0003689 3300048914 Bacteria 9519
142 Ga0496113_0012652 3300048916 Bacteria 5679
143 Ga0501292_016499 3300049515 Bacteria 1162
144 Ga0501033_0084253 3300049570 Bacteria 2330
145 Ga0501033_0422474 3300049570 Bacteria 928
146 Ga0501036_0177335 3300049572 Bacteria 1795
147 Ga0501037_0044401 3300049573 Bacteria 3264
148 Ga0501038_0094454 3300049574 Bacteria 2500
149 Ga0501039_0240071 3300049575 Bacteria 1425
150 Ga0501040_0000006 3300049576 Bacteria 97170
151 Ga0501041_0043019 3300049577 Bacteria 2746
152 Ga0501042_0002135 3300049578 Bacteria 12006
153 Ga0501042_0035142 3300049578 Bacteria 3555
154 Ga0501043_0000004 3300049579 Bacteria 291085
155 Ga0501043_0018173 3300049579 Bacteria 5513
156 Ga0501046_0000050 3300049580 Bacteria 134922
157 Ga0501046_0035237 3300049580 Bacteria 4034
158 Ga0501046_0173592 3300049580 Bacteria 1616
159 Ga0501047_0000012 3300049581 Bacteria 368824
160 Ga0501047_0006487 3300049581 Bacteria 11009
161 Ga0501048_0000348 3300049582 Bacteria 31936
162 Ga0501067_0108216 3300049583 Bacteria 1545
163 Ga0501068_0045361 3300049584 Bacteria 2648
164 Ga0501070_0051020 3300049586 Bacteria 3434
165 Ga0501072_0222604 3300049588 Bacteria 1504
166 Ga0501073_0100480 3300049589 Bacteria 2008
167 Ga0501075_0047874 3300049591 Bacteria 3213
168 Ga0501075_0123883 3300049591 Bacteria 1967
169 Ga0501076_0029432 3300049592 Bacteria 4272
170 Ga0501076_0224200 3300049592 Bacteria 1536
171 Ga0501076_0633514 3300049592 Bacteria 882
172 Ga0501080_0028294 3300049742 Bacteria 5213
173 Ga0501081_0033954 3300049743 Bacteria 3469
174 Ga0501044_0014573 3300049823 Bacteria 8480
175 Ga0501044_0030038 3300049823 Bacteria 5729
176 Ga0501044_0129657 3300049823 Bacteria 2517
177 Ga0501045_0157018 3300049824 Bacteria 1693
178 nmdc:mga03n38_16188_c1 3300050490 Bacteria 2897
179 nmdc:mga03n38_37719_c1 3300050490 Bacteria 2086
180 nmdc:mga03n38_893_c1 3300050490 Bacteria 7064
181 nmdc:mga00v17_18248_c1 3300050491 Bacteria 3982
182 nmdc:mga0k408_38252_c1 3300050493 Bacteria 2754
183 nmdc:mga06z11_3984_c1 3300050494 Bacteria 5764
184 nmdc:mga06z11_6880_c1 3300050494 Bacteria 4651
185 nmdc:mga04h51_1842_c1 3300050495 Bacteria 4959
186 nmdc:mga04h51_2385_c1 3300050495 Bacteria 4452
187 nmdc:mga07m45_4935_c1 3300050496 Bacteria 6574
188 nmdc:mga05p37_122252_c1 3300050507 Bacteria 3197
189 nmdc:mga05p37_368382_c1 3300050507 Bacteria 1687
190 nmdc:mga05p37_52_c1 3300050507 Bacteria 102932
191 nmdc:mga05p37_570527_c1 3300050507 Bacteria 1284
192 nmdc:mga06r32_33175_c1 3300050510 Bacteria 4861
193 nmdc:mga06r32_379415_c1 3300050510 Bacteria 1397
194 nmdc:mga06r32_4_c1 3300050510 Bacteria 144637
195 nmdc:mga06r32_68212_c1 3300050510 Bacteria 3435
196 nmdc:mga08y16_1102_c1 3300050511 Bacteria 26611
197 nmdc:mga08y16_73544_c1 3300050511 Bacteria 3562
198 nmdc:mga08y16_822_c1 3300050511 Bacteria 29788
199 nmdc:mga0n895_30122_c1 3300050512 Bacteria 5183
200 Ga0495619_0063358 3300053085 Bacteria 2463
201 Ga0500641_0020308 3300053096 Bacteria 2521
202 Ga0501084_0512052 3300054114 Bacteria 1014
203 Ga0590071_009788 3300059421 Bacteria 2249
204 Ga0590071_013752 3300059421 Bacteria 1896
205 Ga0590071_023935 3300059421 Bacteria 1446
206 Ga0501082_0005239 3300060353 Bacteria 11267
207 Ga0501082_0095824 3300060353 Bacteria 2565
208 Ga0501082_0127987 3300060353 Bacteria 2203
209 Ga0501082_0156460 3300060353 Bacteria 1980
210 Ga0501082_0374015 3300060353 Bacteria 1243
211 Ga0530510_0039467 3300061734 Bacteria 3408
212 Ga0530510_0104114 3300061734 Bacteria 2076
213 Ga0530510_0108028 3300061734 Bacteria 2037
214 Ga0530510_0312516 3300061734 Bacteria 1177

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037466 Ga0395898_0063122 Ga0395898_0063122_11_826 270
2 3300049570 Ga0501033_0422474 Ga0501033_0422474_60_881 271
3 3300049592 Ga0501076_0633514 Ga0501076_0633514_47_868 271
4 3300006042 Ga0075368_10022242 Ga0075368_100222422 299
5 3300006048 Ga0075363_100014960 Ga0075363_1000149602 299
6 3300006051 Ga0075364_10022692 Ga0075364_100226924 299
7 3300025961 Ga0207712_10405421 Ga0207712_104054211 299
8 3300027866 Ga0209813_10012717 Ga0209813_100127172 299
9 3300050490 nmdc:mga03n38_16188_c1 nmdc:mga03n38_16188_c1_541_1512 299
10 3300050490 nmdc:mga03n38_893_c1 nmdc:mga03n38_893_c1_4300_5277 299
11 3300050491 nmdc:mga00v17_18248_c1 nmdc:mga00v17_18248_c1_972_1949 299
12 3300050495 nmdc:mga04h51_1842_c1 nmdc:mga04h51_1842_c1_3306_4283 299
13 3300050495 nmdc:mga04h51_2385_c1 nmdc:mga04h51_2385_c1_1130_2101 299
14 3300005843 Ga0068860_100516778 Ga0068860_1005167781 300
15 3300050494 nmdc:mga06z11_6880_c1 nmdc:mga06z11_6880_c1_465_1442 300
16 3300005347 Ga0070668_100129308 Ga0070668_1001293083 301
17 3300005843 Ga0068860_100056089 Ga0068860_1000560893 301
18 3300005844 Ga0068862_100127534 Ga0068862_1001275342 301
19 3300006048 Ga0075363_100004500 Ga0075363_1000045005 301
20 3300006178 Ga0075367_10083951 Ga0075367_100839512 301
21 3300006844 Ga0075428_100103828 Ga0075428_1001038284 301
22 3300006847 Ga0075431_100029012 Ga0075431_1000290122 301
23 3300025972 Ga0207668_10073120 Ga0207668_100731203 301
24 3300026118 Ga0207675_100051957 Ga0207675_1000519572 301
25 3300027866 Ga0209813_10001117 Ga0209813_100011173 301
26 3300028380 Ga0268265_10071149 Ga0268265_100711492 301
27 3300009094 Ga0111539_10083117 Ga0111539_100831172 303
28 3300009147 Ga0114129_10049204 Ga0114129_100492042 303
29 3300050507 nmdc:mga05p37_122252_c1 nmdc:mga05p37_122252_c1_1083_2006 303
30 3300050510 nmdc:mga06r32_68212_c1 nmdc:mga06r32_68212_c1_928_1851 303
31 3300050511 nmdc:mga08y16_73544_c1 nmdc:mga08y16_73544_c1_1784_2707 303
32 3300009098 Ga0105245_10096672 Ga0105245_100966722 305
33 3300048905 Ga0496102_0203299 Ga0496102_0203299_37_1014 305
34 3300035083 Ga0373926_0111779 Ga0373926_0111779_34_963 306
35 3300049583 Ga0501067_0108216 Ga0501067_0108216_177_1127 306
36 3300027111 Ga0209281_1000185 Ga0209281_100018534 310
37 3300035089 Ga0373944_0037508 Ga0373944_0037508_107_1096 310
38 3300035116 Ga0373945_0015011 Ga0373945_0015011_1168_2157 310
39 3300037068 Ga0373925_0049880 Ga0373925_0049880_874_1863 310
40 3300047322 Ga0495680_0252661 Ga0495680_0252661_61_1125 310
41 3300061734 Ga0530510_0108028 Ga0530510_0108028_868_1848 310
42 3300035114 Ga0373939_0037367 Ga0373939_0037367_127_1077 313
43 3300035119 Ga0373956_0070048 Ga0373956_0070048_286_1359 313
44 3300049592 Ga0501076_0224200 Ga0501076_0224200_31_987 313
45 3300049743 Ga0501081_0033954 Ga0501081_0033954_859_1815 313
46 3300060353 Ga0501082_0127987 Ga0501082_0127987_409_1365 313
47 3300061734 Ga0530510_0039467 Ga0530510_0039467_20_976 313
48 iso_pu_bacteria 2932401849 2932404703 313
49 iso_pu_bacteria 2937843397 2937844935 313
50 3300006847 Ga0075431_100079274 Ga0075431_1000792742 314
51 3300032004 Ga0307414_10162599 Ga0307414_101625992 314
52 3300037068 Ga0373925_0064992 Ga0373925_0064992_771_1745 314
53 3300039062 Ga0400483_002488 Ga0400483_002488_523_1491 314
54 3300049577 Ga0501041_0043019 Ga0501041_0043019_715_1665 314
55 3300049580 Ga0501046_0035237 Ga0501046_0035237_1288_2283 314
56 3300050507 nmdc:mga05p37_570527_c1 nmdc:mga05p37_570527_c1_142_1122 314
57 3300060353 Ga0501082_0095824 Ga0501082_0095824_453_1448 314
58 3300061734 Ga0530510_0312516 Ga0530510_0312516_60_1055 314
59 3300042004 Ga0439445_0020350 Ga0439445_0020350_268_1254 315
60 3300025918 Ga0207662_10049307 Ga0207662_100493072 316
61 3300042134 Ga0450898_023363 Ga0450898_023363_75_1031 316
62 iso_pu_bacteria 2508501050 2508734792 317
63 3300049570 Ga0501033_0084253 Ga0501033_0084253_695_1657 318
64 3300049823 Ga0501044_0129657 Ga0501044_0129657_893_1870 318
65 3300053096 Ga0500641_0020308 Ga0500641_0020308_518_1492 318
66 3300006038 Ga0075365_10009157 Ga0075365_100091579 319
67 3300006847 Ga0075431_100001416 Ga0075431_10000141615 319
68 3300009147 Ga0114129_10222237 Ga0114129_102222372 319
69 3300009147 Ga0114129_10328678 Ga0114129_103286782 319
70 3300027378 Ga0209981_1013706 Ga0209981_10137062 319
71 3300048907 Ga0496104_0000088 Ga0496104_0000088_87803_88780 319
72 3300048908 Ga0496105_0027570 Ga0496105_0027570_3075_4052 319
73 3300048911 Ga0496108_0012115 Ga0496108_0012115_2008_2985 319
74 3300048912 Ga0496109_0001545 Ga0496109_0001545_2590_3567 319
75 3300048913 Ga0496110_0001147 Ga0496110_0001147_13997_14974 319
76 3300048914 Ga0496111_0003689 Ga0496111_0003689_6874_7851 319
77 3300048916 Ga0496113_0012652 Ga0496113_0012652_3151_4128 319
78 3300049572 Ga0501036_0177335 Ga0501036_0177335_556_1521 319
79 3300049574 Ga0501038_0094454 Ga0501038_0094454_171_1136 319
80 3300049575 Ga0501039_0240071 Ga0501039_0240071_422_1393 319
81 3300049576 Ga0501040_0000006 Ga0501040_0000006_47617_48597 319
82 3300049578 Ga0501042_0002135 Ga0501042_0002135_10567_11547 319
83 3300049578 Ga0501042_0035142 Ga0501042_0035142_1809_2789 319
84 3300049591 Ga0501075_0123883 Ga0501075_0123883_53_1024 319
85 3300049592 Ga0501076_0029432 Ga0501076_0029432_1486_2457 319
86 3300049824 Ga0501045_0157018 Ga0501045_0157018_94_1098 319
87 3300050507 nmdc:mga05p37_368382_c1 nmdc:mga05p37_368382_c1_639_1631 319
88 3300050510 nmdc:mga06r32_33175_c1 nmdc:mga06r32_33175_c1_926_1918 319
89 3300054114 Ga0501084_0512052 Ga0501084_0512052_23_988 319
90 3300059421 Ga0590071_013752 Ga0590071_013752_451_1431 319
91 3300060353 Ga0501082_0156460 Ga0501082_0156460_914_1885 319
92 3300061734 Ga0530510_0104114 Ga0530510_0104114_894_1865 319
93 3300009993 Ga0105028_104332 Ga0105028_1043321 320
94 3300031901 Ga0307406_10399767 Ga0307406_103997671 320
95 3300005455 Ga0070663_100167063 Ga0070663_1001670632 321
96 3300006844 Ga0075428_100004374 Ga0075428_10000437411 321
97 3300006847 Ga0075431_100000021 Ga0075431_10000002145 321
98 3300026067 Ga0207678_10182652 Ga0207678_101826522 321
99 3300035112 Ga0373932_0028460 Ga0373932_0028460_55_1029 321
100 3300035242 Ga0373962_0018221 Ga0373962_0018221_435_1409 321
101 3300035691 Ga0373931_0006231 Ga0373931_0006231_1700_2674 321
102 3300049579 Ga0501043_0018173 Ga0501043_0018173_622_1599 321
103 3300049586 Ga0501070_0051020 Ga0501070_0051020_804_1781 321
104 3300049823 Ga0501044_0030038 Ga0501044_0030038_795_1772 321
105 3300059421 Ga0590071_023935 Ga0590071_023935_108_1079 321
106 3300060353 Ga0501082_0374015 Ga0501082_0374015_236_1213 321
107 iso_pu_bacteria 2510065057 2510303081 321
108 iso_pu_bacteria 2511231052 2511497079 321
109 iso_pu_bacteria 2512047086 2512529546 321
110 iso_pu_bacteria 2512875026 2512968892 321
111 iso_pu_bacteria 2513237086 2513582751 321
112 iso_pu_bacteria 2513237089 2513606892 321
113 iso_pu_bacteria 2513237140 2513882320 321
114 iso_pu_bacteria 2513237143 2513901743 321
115 iso_pu_bacteria 2513237144 2513910848 321
116 iso_pu_bacteria 2513237156 2513988161 321
117 iso_pu_bacteria 2513237160 2514006057 321
118 iso_pu_bacteria 2515154107 2515611668 321
119 iso_pu_bacteria 2516653046 2516895691 321
120 iso_pu_bacteria 2517487022 2517566356 321
121 iso_pu_bacteria 2524023207 2524449325 321
122 iso_pu_bacteria 2551306084 2551678841 321
123 iso_pu_bacteria 2551306084 2551682079 321
124 iso_pu_bacteria 2551306085 2551683390 321
125 iso_pu_bacteria 2551306086 2551690676 321
126 iso_pu_bacteria 2551306087 2551700391 321
127 iso_pu_bacteria 2551306089 2551712459 321
128 iso_pu_bacteria 2551306090 2551719213 321
129 iso_pu_bacteria 2551306091 2551726065 321
130 iso_pu_bacteria 2551306092 2551733196 321
131 iso_pu_bacteria 2551306093 2551745962 321
132 iso_pu_bacteria 2802428858 2802719738 321
133 iso_pu_bacteria 2802428859 2802727740 321
134 iso_pu_bacteria 2802428860 2802733567 321
135 iso_pu_bacteria 2802428861 2802738798 321
136 iso_pu_bacteria 2802428862 2802745602 321
137 iso_pu_bacteria 2802428863 2802751367 321
138 iso_pu_bacteria 2855825444 2855829493 321
139 iso_pu_bacteria 2855839649 2855844592 321
140 iso_pu_bacteria 2858800743 2858805947 321
141 iso_pu_bacteria 2915980308 2915982148 321
142 iso_pu_bacteria 2915986958 2915988909 321
143 iso_pu_bacteria 2915993759 2916000466 321
144 iso_pu_bacteria 2916000859 2916003383 321
145 iso_pu_bacteria 2916007675 2916007792 321
146 iso_pu_bacteria 2916028427 2916031978 321
147 iso_pu_bacteria 2916035215 2916037391 321
148 iso_pu_bacteria 2916041962 2916042153 321
149 iso_pu_bacteria 2916048683 2916048925 321
150 iso_pu_bacteria 2916055098 2916059565 321
151 iso_pu_bacteria 2916061851 2916062503 321
152 iso_pu_bacteria 2916068649 2916069335 321
153 iso_pu_bacteria 2916076590 2916078968 321
154 iso_pu_bacteria 2920760137 2920767215 321
155 iso_pu_bacteria 2921201388 2921203138 321
156 iso_pu_bacteria 2921208531 2921212747 321
157 iso_pu_bacteria 2921237296 2921242176 321
158 iso_pu_bacteria 2921244191 2921246353 321
159 iso_pu_bacteria 2921250672 2921256692 321
160 iso_pu_bacteria 2921257292 2921259320 321
161 iso_pu_bacteria 2921263974 2921269750 321
162 iso_pu_bacteria 2921282425 2921286659 321
163 iso_pu_bacteria 2921289301 2921293642 321
164 iso_pu_bacteria 2921296804 2921303101 321
165 iso_pu_bacteria 2924144063 2924148008 321
166 iso_pu_bacteria 2924150972 2924155692 321
167 iso_pu_bacteria 2924158325 2924161842 321
168 iso_pu_bacteria 2924165586 2924165678 321
169 iso_pu_bacteria 2924172951 2924176271 321
170 iso_pu_bacteria 2924179722 2924184301 321
171 iso_pu_bacteria 2924186466 2924186638 321
172 iso_pu_bacteria 2924193448 2924196954 321
173 iso_pu_bacteria 2924200457 2924200671 321
174 iso_pu_bacteria 2924207177 2924207294 321
175 iso_pu_bacteria 2924214083 2924216397 321
176 iso_pu_bacteria 2924221636 2924224216 321
177 iso_pu_bacteria 2924228884 2924229011 321
178 iso_pu_bacteria 2936996657 2936997179 321
179 iso_pu_bacteria 2937009748 2937009983 321
180 iso_pu_bacteria 2937016420 2937020421 321
181 iso_pu_bacteria 2937023124 2937025302 321
182 iso_pu_bacteria 2937029754 2937033693 321
183 iso_pu_bacteria 2937036028 2937037591 321
184 iso_pu_bacteria 2937042894 2937048374 321
185 iso_pu_bacteria 2937049772 2937050618 321
186 iso_pu_bacteria 2937056579 2937060400 321
187 iso_pu_bacteria 2937063883 2937064061 321
188 iso_pu_bacteria 2937071275 2937071796 321
189 iso_pu_bacteria 2937078374 2937084569 321
190 iso_pu_bacteria 2937084907 2937091535 321
191 iso_pu_bacteria 2937091812 2937095772 321
192 iso_pu_bacteria 2937098957 2937100915 321
193 iso_pu_bacteria 2937106411 2937113168 321
194 iso_pu_bacteria 2937119839 2937119955 321
195 iso_pu_bacteria 2937126314 2937132445 321
196 iso_pu_bacteria 2957375807 2957381183 321
197 iso_pu_bacteria 2957382221 2957382410 321
198 iso_pu_bacteria 2957388812 2957395383 321
199 iso_pu_bacteria 2957395598 2957400081 321
200 iso_pu_bacteria 2957402308 2957404144 321
201 iso_pu_bacteria 2957408893 2957414923 321
202 iso_pu_bacteria 2957415311 2957419466 321
203 iso_pu_bacteria 2957422303 2957429446 321
204 iso_pu_bacteria 2957430029 2957432169 321
205 iso_pu_bacteria 2957437181 2957439087 321
206 iso_pu_bacteria 2957443900 2957445871 321
207 iso_pu_bacteria 2957450854 2957450973 321
208 iso_pu_bacteria 2957457609 2957462844 321
209 iso_pu_bacteria 2957464669 2957465347 321
210 iso_pu_bacteria 2957471148 2957474916 321
211 iso_pu_bacteria 2957478035 2957478783 321
212 iso_pu_bacteria 2957484790 2957491360 321
213 iso_pu_bacteria 2957491536 2957496729 321
214 iso_pu_bacteria 2957498199 2957498583 321
215 iso_pu_bacteria 2957505466 2957505819 321
216 iso_pu_bacteria 2960584000 2960584145 321
217 iso_pu_bacteria 2960591022 2960596981 321
218 iso_pu_bacteria 2960603979 2960604023 321
219 iso_pu_bacteria 2960610863 2960611083 321
220 iso_pu_bacteria 2960617483 2960622445 321
221 iso_pu_bacteria 2960624210 2960625290 321
222 iso_pu_bacteria 2960631154 2960631518 321
223 iso_pu_bacteria 2960637947 2960640456 321
224 iso_pu_bacteria 2960645483 2960649204 321
225 iso_pu_bacteria 2960652885 2960657757 321
226 iso_pu_bacteria 2960660292 2960663829 321
227 iso_pu_bacteria 2960667422 2960667642 321
228 iso_pu_bacteria 2960674078 2960679250 321
229 iso_pu_bacteria 2960680706 2960682185 321
230 iso_pu_bacteria 2960687367 2960691907 321
231 iso_pu_bacteria 2960693952 2960698014 321
232 iso_pu_bacteria 2964607997 2964614998 321
233 iso_pu_bacteria 2964615318 2964620679 321
234 iso_pu_bacteria 2964621998 2964626753 321
235 iso_pu_bacteria 2964628898 2964629096 321
236 iso_pu_bacteria 2964636051 2964636205 321
237 iso_pu_bacteria 2964649959 2964653835 321
238 iso_pu_bacteria 2964656573 2964662059 321
239 iso_pu_bacteria 2964663802 2964663919 321
240 iso_pu_bacteria 2964670856 2964676896 321
241 iso_pu_bacteria 2964678106 2964678174 321
242 iso_pu_bacteria 2964685014 2964685245 321
243 iso_pu_bacteria 2964691889 2964694152 321
244 iso_pu_bacteria 2964705432 2964710804 321
245 iso_pu_bacteria 2964712639 2964716676 321
246 iso_pu_bacteria 2964719344 2964723427 321
247 iso_pu_bacteria 2967664464 2967666247 321
248 iso_pu_bacteria 2967671571 2967671688 321
249 iso_pu_bacteria 2967678726 2967681393 321
250 iso_pu_bacteria 2967686174 2967689491 321
251 iso_pu_bacteria 2967693043 2967698435 321
252 iso_pu_bacteria 2967699805 2967699886 321
253 iso_pu_bacteria 2967706974 2967708172 321
254 iso_pu_bacteria 2967714385 2967718507 321
255 iso_pu_bacteria 2967721400 2967721492 321
256 iso_pu_bacteria 2967728569 2967730261 321
257 iso_pu_bacteria 2967735183 2967737324 321
258 iso_pu_bacteria 2967742019 2967745207 321
259 iso_pu_bacteria 2967748971 2967749089 321
260 iso_pu_bacteria 2967755722 2967755840 321
261 iso_pu_bacteria 2967762386 2967762400 321
262 iso_pu_bacteria 2967769361 2967769535 321
263 iso_pu_bacteria 2967775926 2967776050 321
264 iso_pu_bacteria 2970019648 2970019831 321
265 iso_pu_bacteria 2970026789 2970028991 321
266 iso_pu_bacteria 2970033650 2970033767 321
267 iso_pu_bacteria 2970040964 2970043952 321
268 iso_pu_bacteria 2970047711 2970050165 321
269 iso_pu_bacteria 2970054988 2970055695 321
270 iso_pu_bacteria 2970061556 2970063769 321
271 iso_pu_bacteria 2970068827 2970068943 321
272 iso_pu_bacteria 2970076120 2970078098 321
273 iso_pu_bacteria 2970082768 2970084376 321
274 iso_pu_bacteria 2970088815 2970091988 321
275 iso_pu_bacteria 2970095765 2970095883 321
276 iso_pu_bacteria 2970102677 2970102795 321
277 iso_pu_bacteria 2970109326 2970111256 321
278 iso_pu_bacteria 2970116247 2970119140 321
279 iso_pu_bacteria 2970122695 2970125655 321
280 iso_pu_bacteria 2970129317 2970135246 321
281 iso_pu_bacteria 2970136068 2970136141 321
282 iso_pu_bacteria 2970143518 2970149481 321
283 iso_pu_bacteria 2970149975 2970152042 321
284 iso_pu_bacteria 2970156795 2970162494 321
285 iso_pu_bacteria 2970164137 2970165569 321
286 iso_pu_bacteria 2970170962 2970171079 321
287 iso_pu_bacteria 2970177841 2970180107 321
288 iso_pu_bacteria 2970184632 2970189578 321
289 iso_pu_bacteria 2970191845 2970191942 321
290 iso_pu_bacteria 2977516862 2977520578 321
291 iso_pu_bacteria 2977523885 2977525956 321
292 iso_pu_bacteria 2977530762 2977534570 321
293 iso_pu_bacteria 2977537788 2977539748 321
294 iso_pu_bacteria 2977544691 2977548879 321
295 iso_pu_bacteria 2977551784 2977556068 321
296 iso_pu_bacteria 2977558990 2977560594 321
297 iso_pu_bacteria 2977572785 2977573633 321
298 iso_pu_bacteria 2977579622 2977585113 321
299 iso_pu_bacteria 648276728 648735603 321
300 iso_pu_bacteria 8003999396 8004004827 321
301 3300005563 Ga0068855_100008578 Ga0068855_1000085782 322
302 3300006042 Ga0075368_10031205 Ga0075368_100312052 322
303 3300006048 Ga0075363_100011530 Ga0075363_1000115302 322
304 3300006178 Ga0075367_10002799 Ga0075367_100027994 322
305 3300006195 Ga0075366_10197214 Ga0075366_101972141 322
306 3300006353 Ga0075370_10002745 Ga0075370_100027454 322
307 3300009093 Ga0105240_10003161 Ga0105240_1000316120 322
308 3300009094 Ga0111539_10004677 Ga0111539_100046777 322
309 3300009551 Ga0105238_10022264 Ga0105238_100222643 322
310 3300025913 Ga0207695_10278136 Ga0207695_102781362 322
311 3300025924 Ga0207694_10154975 Ga0207694_101549752 322
312 3300025949 Ga0207667_10047282 Ga0207667_100472822 322
313 3300027866 Ga0209813_10006855 Ga0209813_100068552 322
314 3300027907 Ga0207428_10001639 Ga0207428_100016397 322
315 3300037312 Ga0395899_0003260 Ga0395899_0003260_3430_4398 322
316 3300037418 Ga0395900_0006794 Ga0395900_0006794_6622_7590 322
317 3300037466 Ga0395898_0036926 Ga0395898_0036926_2337_3305 322
318 3300037471 Ga0395905_0000065 Ga0395905_0000065_107552_108520 322
319 3300037471 Ga0395905_0001297 Ga0395905_0001297_26426_27394 322
320 3300037471 Ga0395905_0018028 Ga0395905_0018028_949_1917 322
321 3300038443 Ga0395901_0021275 Ga0395901_0021275_1045_2013 322
322 3300038443 Ga0395901_0091345 Ga0395901_0091345_1706_2674 322
323 3300049573 Ga0501037_0044401 Ga0501037_0044401_840_1808 322
324 3300049579 Ga0501043_0000004 Ga0501043_0000004_52253_53221 322
325 3300049580 Ga0501046_0000050 Ga0501046_0000050_129569_130537 322
326 3300049580 Ga0501046_0173592 Ga0501046_0173592_169_1146 322
327 3300049581 Ga0501047_0000012 Ga0501047_0000012_238295_239263 322
328 3300049581 Ga0501047_0006487 Ga0501047_0006487_3367_4344 322
329 3300049582 Ga0501048_0000348 Ga0501048_0000348_15091_16059 322
330 3300049584 Ga0501068_0045361 Ga0501068_0045361_1293_2270 322
331 3300049588 Ga0501072_0222604 Ga0501072_0222604_200_1177 322
332 3300049589 Ga0501073_0100480 Ga0501073_0100480_847_1824 322
333 3300049742 Ga0501080_0028294 Ga0501080_0028294_1981_2958 322
334 3300049823 Ga0501044_0014573 Ga0501044_0014573_2333_3310 322
335 3300050490 nmdc:mga03n38_37719_c1 nmdc:mga03n38_37719_c1_1024_2010 322
336 3300050494 nmdc:mga06z11_3984_c1 nmdc:mga06z11_3984_c1_3757_4743 322
337 3300050496 nmdc:mga07m45_4935_c1 nmdc:mga07m45_4935_c1_2265_3251 322
338 3300050510 nmdc:mga06r32_379415_c1 nmdc:mga06r32_379415_c1_143_1123 322
339 3300050511 nmdc:mga08y16_1102_c1 nmdc:mga08y16_1102_c1_4805_5782 322
340 3300060353 Ga0501082_0005239 Ga0501082_0005239_2191_3168 322
341 3300005617 Ga0068859_100025284 Ga0068859_1000252843 323
342 3300005842 Ga0068858_100371989 Ga0068858_1003719892 323
343 3300005937 Ga0081455_10000042 Ga0081455_1000004257 323
344 3300006852 Ga0075433_10009462 Ga0075433_100094622 323
345 3300006871 Ga0075434_100002199 Ga0075434_10000219919 323
346 3300006931 Ga0097620_100025285 Ga0097620_1000252853 323
347 3300027907 Ga0207428_10034478 Ga0207428_100344781 323
348 3300031911 Ga0307412_10114977 Ga0307412_101149771 323
349 3300031995 Ga0307409_100033768 Ga0307409_1000337681 323
350 3300034957 Ga0373938_0007198 Ga0373938_0007198_123_1103 323
351 3300035088 Ga0373940_0009132 Ga0373940_0009132_994_1974 323
352 3300035112 Ga0373932_0006856 Ga0373932_0006856_755_1735 323
353 3300035114 Ga0373939_0000554 Ga0373939_0000554_7389_8369 323
354 3300035241 Ga0373961_0045647 Ga0373961_0045647_140_1120 323
355 3300042876 Ga0451577_0142889 Ga0451577_0142889_39_1016 323
356 3300044712 Ga0453684_0395157 Ga0453684_0395157_350_1327 323
357 3300050512 nmdc:mga0n895_30122_c1 nmdc:mga0n895_30122_c1_3719_4699 323
358 3300059421 Ga0590071_009788 Ga0590071_009788_833_1816 323
359 3300005467 Ga0070706_100082095 Ga0070706_1000820953 324
360 3300006195 Ga0075366_10120180 Ga0075366_101201802 324
361 3300009148 Ga0105243_10031389 Ga0105243_100313893 324
362 3300022740 Ga0228710_1002119 Ga0228710_100211912 324
363 3300025935 Ga0207709_10072567 Ga0207709_100725672 324
364 3300027111 Ga0209281_1000111 Ga0209281_1000111123 324
365 3300027666 Ga0209282_1000012 Ga0209282_1000012123 324
366 3300031824 Ga0307413_10097292 Ga0307413_100972922 324
367 3300031911 Ga0307412_10164364 Ga0307412_101643642 324
368 3300031967 Ga0315914_1000007 Ga0315914_100000791 324
369 3300031995 Ga0307409_100126986 Ga0307409_1001269862 324
370 3300032002 Ga0307416_100021517 Ga0307416_1000215177 324
371 3300032002 Ga0307416_100044003 Ga0307416_1000440032 324
372 3300033430 Ga0315913_1000003 Ga0315913_1000003123 324
373 3300033464 Ga0315915_1000011 Ga0315915_100001191 324
374 3300037312 Ga0395899_0073319 Ga0395899_0073319_464_1447 324
375 3300037466 Ga0395898_0005852 Ga0395898_0005852_9631_10614 324
376 3300038443 Ga0395901_0070828 Ga0395901_0070828_704_1687 324
377 3300042007 Ga0439449_0002879 Ga0439449_0002879_2399_3382 324
378 3300049515 Ga0501292_016499 Ga0501292_016499_83_1063 324
379 3300049591 Ga0501075_0047874 Ga0501075_0047874_1048_2028 324
380 3300050493 nmdc:mga0k408_38252_c1 nmdc:mga0k408_38252_c1_1073_2065 324
381 3300035171 Ga0373946_0039979 Ga0373946_0039979_884_1876 326
382 3300035410 Ga0373924_0003324 Ga0373924_0003324_1863_2855 326
383 3300035725 Ga0373947_0033118 Ga0373947_0033118_689_1681 326
384 3300037068 Ga0373925_0023776 Ga0373925_0023776_1220_2212 326
385 3300037068 Ga0373925_0065530 Ga0373925_0065530_881_1873 326
386 3300038443 Ga0395901_0193215 Ga0395901_0193215_425_1405 326
387 3300046459 Ga0495629_0011489 Ga0495629_0011489_3317_4309 326
388 3300046472 Ga0495580_0025256 Ga0495580_0025256_3220_4212 326
389 3300046473 Ga0495582_0011092 Ga0495582_0011092_1363_2355 326
390 3300046531 Ga0495665_0003868 Ga0495665_0003868_3054_4046 326
391 3300046543 Ga0495645_0006511 Ga0495645_0006511_4702_5694 326
392 3300046678 Ga0495599_0128691 Ga0495599_0128691_561_1553 326
393 3300046689 Ga0495613_0020574 Ga0495613_0020574_1214_2206 326
394 3300047315 Ga0495581_0077111 Ga0495581_0077111_830_1822 326
395 3300047471 Ga0495684_0011709 Ga0495684_0011709_2912_3904 326
396 3300048088 Ga0495602_0063258 Ga0495602_0063258_1488_2480 326
397 3300053085 Ga0495619_0063358 Ga0495619_0063358_1322_2314 326
398 3300005445 Ga0070708_100011404 Ga0070708_1000114045 327
399 3300035695 Ga0373927_0017747 Ga0373927_0017747_1102_2100 327
400 3300046472 Ga0495580_0074265 Ga0495580_0074265_1149_2207 327
401 3300031665 Ga0316575_10002137 Ga0316575_100021372 329
402 3300025940 Ga0207691_10221635 Ga0207691_102216352 330
403 3300031691 Ga0316579_10000497 Ga0316579_100004977 330
404 3300005563 Ga0068855_100106362 Ga0068855_1001063622 331
405 3300009147 Ga0114129_10000068 Ga0114129_1000006818 331
406 3300013104 Ga0157370_10090510 Ga0157370_100905102 331
407 3300025949 Ga0207667_10135714 Ga0207667_101357142 331
408 3300050507 nmdc:mga05p37_52_c1 nmdc:mga05p37_52_c1_62120_63127 331
409 3300050510 nmdc:mga06r32_4_c1 nmdc:mga06r32_4_c1_11425_12432 331
410 3300050511 nmdc:mga08y16_822_c1 nmdc:mga08y16_822_c1_17441_18448 331
411 3300005327 Ga0070658_10161459 Ga0070658_101614592 332

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16868

NMT1_3

NMT1-like family

62

349

0.98

PF09084

NMT1

NMT1/THI5 like

87

240

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
1us5-assembly1.cif.gz_A putative glur0 ligand binding core with l-glutamate 0.9403 37 331
4ddd-assembly1.cif.gz_A crystal structure of an immunogenic protein from ehrlichia chaffeensis 0.9334 34 332
1us5-assembly1.cif.gz_A putative glur0 ligand binding core with l-glutamate 0.9312 37 331
4ddd-assembly1.cif.gz_A crystal structure of an immunogenic protein from ehrlichia chaffeensis 0.9275 34 332
5tpi-assembly1.cif.gz_A-2 1.47 angstrom crystal structure of the c-terminal substrate binding domain of lysr family transcriptional regulator from klebsiella pneumoniae. 0.7357 37 293
ID Description Score Start End Superfamily
4dddA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9529 127 264 3.40.190.10
1us4A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9409 127 264 3.40.190.10
4dddA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9397 127 264 3.40.190.10
1us4A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9279 127 264 3.40.190.10
4dddA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9167 34 332 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A7W0X3T7-F1-model_v4 TAXI family TRAP transporter solute-binding subunit 0.9919 119 332
AF-A0A7W0X3T7-F1-model_v4 TAXI family TRAP transporter solute-binding subunit 0.9873 119 332
AF-A0A661RTM8-F1-model_v4 deleted 0.9854 52 331
AF-A0A3N5HZ40-F1-model_v4 TAXI family TRAP transporter solute-binding subunit 0.9852 60 331
AF-A0A2N3CLB9-F1-model_v4 C4-dicarboxylate ABC transporter substrate-binding protein 0.9849 173 332

Feature Viewer

pLDDT pTM Quality
88.83 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map