F437575

General Info

Members Datasets Scaffolds Average Seq Length
411 217 411 171

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0403506|Ga0395905_0403506_11_544
Length 177
Sequence MTAARAAEAGKAGLLLFLAAIVQVSILGDIDILGGTPDLLLVMLVAIALLRGSLFGAAGGFFAGLVVDTATLGTLGLTSLLLTVAGYWIGRYGETTGRDRGHAPFLSVAVVTLLYAVGALLVHFMFGRHAPAGTVLRDVWPAIVLNLVLTAPVYVACRRLLRPLEWGERSQEVRLLG

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
97 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
98 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
99 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
100 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
101 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
102 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
103 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
104 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
105 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
106 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
107 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
108 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
109 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
110 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
111 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
112 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
113 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
114 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
115 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
116 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
117 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
118 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
121 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
122 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
123 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
133 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
134 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
135 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
136 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
137 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
138 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
139 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
144 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
145 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
148 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
149 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
150 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
151 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
152 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
153 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
154 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
155 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
156 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
157 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
158 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
159 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
160 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
161 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
162 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
163 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
164 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
165 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
166 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
167 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
168 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
169 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
170 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
171 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
172 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
175 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
176 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
177 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
178 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
179 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
201 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
202 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
203 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
204 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
205 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
206 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
207 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
211 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
212 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
213 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
214 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
215 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
217 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0.49
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.49
Nodule 0
Rhizoplane 16.3
Rhizosphere 82.97
Stem 0
Stem Tuber 0
Unclassified 0.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10248898 3300005327 Bacteria 1507
2 Ga0070683_100016747 3300005329 Bacteria 6466
3 Ga0070683_100022133 3300005329 Bacteria 5678
4 Ga0070682_100013407 3300005337 Bacteria 4714
5 Ga0070682_100071937 3300005337 Archaea 2215
6 Ga0070682_100080655 3300005337 Bacteria 2105
7 Ga0068868_100346272 3300005338 Bacteria 1272
8 Ga0070660_100156574 3300005339 Bacteria 1834
9 Ga0070660_100178208 3300005339 Archaea 1719
10 Ga0070691_10087927 3300005341 Archaea 1529
11 Ga0070692_10832261 3300005345 Unclassified 633
12 Ga0070671_100086494 3300005355 Bacteria 2623
13 Ga0070671_100116372 3300005355 Bacteria 2248
14 Ga0070674_101051900 3300005356 Bacteria 717
15 Ga0070673_101041420 3300005364 Bacteria 763
16 Ga0070659_100593493 3300005366 Bacteria 951
17 Ga0070667_100119877 3300005367 Bacteria 2288
18 Ga0070709_10137168 3300005434 Unclassified 1677
19 Ga0070714_100006822 3300005435 Bacteria 8848
20 Ga0070714_100270879 3300005435 Unclassified 1574
21 Ga0070714_100673434 3300005435 Bacteria 997
22 Ga0070713_100011668 3300005436 Bacteria 6411
23 Ga0070713_100022491 3300005436 Bacteria 4873
24 Ga0070711_100290814 3300005439 Bacteria 1296
25 Ga0070711_100420541 3300005439 Unclassified 1089
26 Ga0070678_100032480 3300005456 Bacteria 3613
27 Ga0070678_100060278 3300005456 Bacteria 2792
28 Ga0070678_100517417 3300005456 Bacteria 1055
29 Ga0070681_10008931 3300005458 Bacteria 9851
30 Ga0070681_10069297 3300005458 Bacteria 3493
31 Ga0068867_100939874 3300005459 Unclassified 780
32 Ga0070707_100294062 3300005468 Unclassified 1578
33 Ga0070698_100885960 3300005471 Bacteria 838
34 Ga0070679_100054246 3300005530 Bacteria 3990
35 Ga0070684_100001346 3300005535 Bacteria 17608
36 Ga0070684_100155056 3300005535 Unclassified 2076
37 Ga0070684_100921553 3300005535 Unclassified 819
38 Ga0070684_100926123 3300005535 Bacteria 817
39 Ga0070697_100092822 3300005536 Bacteria 2498
40 Ga0070686_100198636 3300005544 Unclassified 1436
41 Ga0070686_100305904 3300005544 Bacteria 1181
42 Ga0070693_100004489 3300005547 Bacteria 6604
43 Ga0070693_100419086 3300005547 Unclassified 932
44 Ga0068855_100065446 3300005563 Bacteria 4238
45 Ga0068855_100282506 3300005563 Archaea 1843
46 Ga0068856_100104415 3300005614 Bacteria 2827
47 Ga0068856_100143236 3300005614 Bacteria 2397
48 Ga0068856_100301670 3300005614 Unclassified 1619
49 Ga0068856_102033324 3300005614 Bacteria 585
50 Ga0070702_100216811 3300005615 Unclassified 1277
51 Ga0068852_100295618 3300005616 Bacteria 1566
52 Ga0068864_101297547 3300005618 Bacteria 728
53 Ga0068866_10831694 3300005718 Bacteria 644
54 Ga0068861_100708262 3300005719 Unclassified 936
55 Ga0081539_10019905 3300005985 Bacteria 4569
56 Ga0070717_10010285 3300006028 Bacteria 7053
57 Ga0070717_10026062 3300006028 Bacteria 4659
58 Ga0075365_10280466 3300006038 Unclassified 1172
59 Ga0070712_100329300 3300006175 Bacteria 1244
60 Ga0068871_100468449 3300006358 Unclassified 1132
61 Ga0068871_101283773 3300006358 Bacteria 688
62 Ga0075428_100002807 3300006844 Bacteria 18961
63 Ga0075431_100102152 3300006847 Bacteria 2959
64 Ga0075433_10037554 3300006852 Bacteria 4179
65 Ga0075433_10413488 3300006852 Unclassified 1190
66 Ga0075434_100032367 3300006871 Bacteria 5157
67 Ga0075434_100149624 3300006871 Bacteria 2355
68 Ga0075434_100351204 3300006871 Unclassified 1496
69 Ga0068865_101666254 3300006881 Bacteria 574
70 Ga0075436_100375791 3300006914 Bacteria 1027
71 Ga0075435_100006823 3300007076 Bacteria 8102
72 Ga0075435_100456836 3300007076 Bacteria 1102
73 Ga0105240_10321942 3300009093 Archaea 1762
74 Ga0111539_10084350 3300009094 Bacteria 3735
75 Ga0105245_10022175 3300009098 Bacteria 5576
76 Ga0105245_10128896 3300009098 Bacteria 2371
77 Ga0105245_10175164 3300009098 Bacteria 2045
78 Ga0105245_10564188 3300009098 Bacteria 1161
79 Ga0114129_10009882 3300009147 Bacteria 13602
80 Ga0114129_10025500 3300009147 Bacteria 8378
81 Ga0105243_10058844 3300009148 Bacteria 3064
82 Ga0105243_10410746 3300009148 Unclassified 1260
83 Ga0105243_10787707 3300009148 Unclassified 936
84 Ga0105241_10242989 3300009174 Unclassified 1523
85 Ga0105241_10804498 3300009174 Bacteria 866
86 Ga0105242_10122133 3300009176 Bacteria 2237
87 Ga0105242_10191952 3300009176 Unclassified 1809
88 Ga0105248_10026601 3300009177 Bacteria 6434
89 Ga0105238_11120260 3300009551 Bacteria 810
90 Ga0105249_10241591 3300009553 Unclassified 1786
91 Ga0105249_10509422 3300009553 Bacteria 1250
92 Ga0105239_10071854 3300010375 Bacteria 3802
93 Ga0105239_10111640 3300010375 Bacteria 3031
94 Ga0105246_10056427 3300011119 Unclassified 2715
95 Ga0157371_10358692 3300013102 Unclassified 1062
96 Ga0157369_10025501 3300013105 Bacteria 6563
97 Ga0157369_10894631 3300013105 Unclassified 910
98 Ga0157375_10088826 3300013308 Bacteria 3146
99 Ga0157375_10126959 3300013308 Bacteria 2667
100 Ga0163163_10211571 3300014325 Bacteria 1988
101 Ga0157377_10201549 3300014745 Unclassified 1264
102 Ga0157377_10224130 3300014745 Unclassified 1205
103 Ga0157379_10340255 3300014968 Unclassified 1372
104 Ga0163161_11165907 3300017792 Bacteria 665
105 Ga0206356_10531113 3300020070 Bacteria 2672
106 Ga0224712_10026332 3300022467 Bacteria 2054
107 Ga0207692_10518348 3300025898 Unclassified 758
108 Ga0207692_10616078 3300025898 Bacteria 699
109 Ga0207642_10534937 3300025899 Bacteria 722
110 Ga0207684_10494963 3300025910 Bacteria 1048
111 Ga0207654_10222274 3300025911 Bacteria 1253
112 Ga0207671_10569202 3300025914 Bacteria 903
113 Ga0207663_10211588 3300025916 Unclassified 1405
114 Ga0207660_10364673 3300025917 Unclassified 1159
115 Ga0207662_10307893 3300025918 Bacteria 1055
116 Ga0207657_10005839 3300025919 Bacteria 12826
117 Ga0207657_10140380 3300025919 Bacteria 1974
118 Ga0207652_10078087 3300025921 Bacteria 2890
119 Ga0207646_10467252 3300025922 Bacteria 1138
120 Ga0207687_10016152 3300025927 Bacteria 4901
121 Ga0207687_10063116 3300025927 Bacteria 2622
122 Ga0207687_10123292 3300025927 Bacteria 1941
123 Ga0207700_10188140 3300025928 Unclassified 1733
124 Ga0207664_10076733 3300025929 Bacteria 2706
125 Ga0207664_10120551 3300025929 Bacteria 2194
126 Ga0207664_10256874 3300025929 Bacteria 1527
127 Ga0207664_11469273 3300025929 Bacteria 603
128 Ga0207644_10107251 3300025931 Bacteria 2107
129 Ga0207644_10175372 3300025931 Unclassified 1677
130 Ga0207644_10602363 3300025931 Bacteria 912
131 Ga0207690_10132927 3300025932 Bacteria 1823
132 Ga0207706_10167593 3300025933 Unclassified 1930
133 Ga0207686_10037393 3300025934 Bacteria 2929
134 Ga0207709_10108935 3300025935 Bacteria 1848
135 Ga0207709_10381087 3300025935 Unclassified 1073
136 Ga0207669_10071005 3300025937 Unclassified 2186
137 Ga0207669_11019661 3300025937 Unclassified 696
138 Ga0207704_10438650 3300025938 Archaea 1040
139 Ga0207704_10459450 3300025938 Unclassified 1018
140 Ga0207689_10118208 3300025942 Bacteria 2180
141 Ga0207661_10001315 3300025944 Bacteria 16624
142 Ga0207661_10242666 3300025944 Archaea 1599
143 Ga0207667_10117660 3300025949 Bacteria 2739
144 Ga0207667_10358013 3300025949 Bacteria 1488
145 Ga0207712_10197908 3300025961 Bacteria 1591
146 Ga0207658_10096350 3300025986 Bacteria 2307
147 Ga0207677_10036658 3300026023 Bacteria 3199
148 Ga0207702_10018431 3300026078 Bacteria 5775
149 Ga0207702_10069863 3300026078 Bacteria 3020
150 Ga0207702_10150244 3300026078 Bacteria 2118
151 Ga0207702_11122094 3300026078 Bacteria 780
152 Ga0207683_10055613 3300026121 Bacteria 3470
153 Ga0207683_10079570 3300026121 Bacteria 2906
154 Ga0265337_1104977 3300028556 Unclassified 768
155 Ga0265326_10012715 3300028558 Unclassified 2469
156 Ga0265319_1003634 3300028563 Bacteria 7974
157 Ga0265334_10002143 3300028573 Bacteria 9307
158 Ga0265334_10006821 3300028573 Unclassified 4902
159 Ga0265334_10156365 3300028573 Unclassified 803
160 Ga0265318_10000445 3300028577 Bacteria 31168
161 Ga0265318_10130273 3300028577 Bacteria 925
162 Ga0265323_10010132 3300028653 Bacteria 3826
163 Ga0265322_10007423 3300028654 Bacteria 3200
164 Ga0265336_10036878 3300028666 Bacteria 1504
165 Ga0265338_10004996 3300028800 Bacteria 17542
166 Ga0265338_10006808 3300028800 Bacteria 14398
167 Ga0265338_10010234 3300028800 Bacteria 11045
168 Ga0265338_10040072 3300028800 Bacteria 4405
169 Ga0265324_10009896 3300029957 Archaea 3702
170 Ga0265324_10019389 3300029957 Bacteria 2450
171 Ga0265324_10122480 3300029957 Unclassified 883
172 Ga0265330_10000419 3300031235 Bacteria 28979
173 Ga0265332_10015821 3300031238 Bacteria 3328
174 Ga0265328_10003874 3300031239 Bacteria 6580
175 Ga0265320_10025473 3300031240 Bacteria 3108
176 Ga0265325_10001635 3300031241 Bacteria 15599
177 Ga0265329_10056394 3300031242 Bacteria 1245
178 Ga0265340_10011366 3300031247 Bacteria 4733
179 Ga0265339_10004228 3300031249 Bacteria 9838
180 Ga0265331_10002612 3300031250 Bacteria 12094
181 Ga0265327_10018151 3300031251 Bacteria 4373
182 Ga0265327_10025127 3300031251 Bacteria 3480
183 Ga0265327_10076720 3300031251 Unclassified 1660
184 Ga0265316_10003234 3300031344 Bacteria 16552
185 Ga0265313_10029210 3300031595 Unclassified 2855
186 Ga0265342_10356196 3300031712 Unclassified 761
187 Ga0307416_100664523 3300032002 Bacteria 1128
188 Ga0373949_0114520 3300035090 Bacteria 751
189 Ga0373953_0060922 3300035117 Unclassified 1543
190 Ga0373956_0115549 3300035119 Bacteria 1251
191 Ga0373924_0028783 3300035410 Bacteria 2216
192 Ga0373935_0084584 3300035692 Bacteria 2067
193 Ga0373935_0121284 3300035692 Unclassified 1747
194 Ga0373947_0101315 3300035725 Bacteria 1810
195 Ga0373937_0170335 3300036401 Unclassified 2043
196 Ga0373937_0573094 3300036401 Unclassified 1072
197 Ga0395899_0111259 3300037312 Bacteria 1969
198 Ga0395900_0120111 3300037418 Bacteria 2697
199 Ga0395900_0321665 3300037418 Bacteria 1527
200 Ga0395900_0669901 3300037418 Bacteria 973
201 Ga0395898_0092574 3300037466 Bacteria 2907
202 Ga0395898_0117431 3300037466 Bacteria 2549
203 Ga0395898_0380562 3300037466 Unclassified 1346
204 Ga0395898_0939985 3300037466 Bacteria 802
205 Ga0395898_1761037 3300037466 Unclassified 541
206 Ga0395905_0289387 3300037471 Bacteria 1525
207 Ga0395905_0403506 3300037471 Bacteria 1262
208 Ga0395905_0483475 3300037471 Unclassified 1138
209 Ga0395901_0033767 3300038443 Bacteria 5283
210 Ga0395901_0459002 3300038443 Unclassified 1302
211 Ga0395901_1055034 3300038443 Bacteria 785
212 Ga0395901_1085417 3300038443 Unclassified 772
213 Ga0451853_3997314 3300041512 Bacteria 1094
214 Ga0450905_012254 3300042142 Unclassified 1206
215 Ga0466965_0047065 3300044683 Bacteria 2135
216 Ga0466961_0018938 3300044693 Bacteria 4430
217 Ga0466963_0005588 3300044694 Bacteria 7373
218 Ga0466963_0010464 3300044694 Bacteria 5614
219 Ga0466963_0041187 3300044694 Unclassified 3029
220 Ga0466963_0218941 3300044694 Bacteria 1333
221 Ga0466964_0192416 3300044706 Bacteria 974
222 Ga0466971_0001907 3300044719 Bacteria 8843
223 Ga0466968_0018394 3300044735 Bacteria 2802
224 Ga0466968_0025536 3300044735 Bacteria 2419
225 Ga0466968_0043357 3300044735 Bacteria 1904
226 Ga0466957_0039236 3300044842 Bacteria 2856
227 Ga0466960_0012643 3300044901 Bacteria 3569
228 Ga0466959_0027454 3300045049 Bacteria 4223
229 Ga0466959_0074845 3300045049 Unclassified 2448
230 Ga0466958_0004948 3300045836 Bacteria 7109
231 Ga0495592_0038146 3300046454 Bacteria 3615
232 Ga0495603_0026598 3300046455 Bacteria 3495
233 Ga0495629_0022107 3300046459 Unclassified 4535
234 Ga0495629_0116361 3300046459 Bacteria 1863
235 Ga0495651_0007210 3300046462 Bacteria 8501
236 Ga0495651_0238220 3300046462 Bacteria 1249
237 Ga0495651_0426863 3300046462 Unclassified 861
238 Ga0495653_0034233 3300046463 Bacteria 4020
239 Ga0495653_0111378 3300046463 Unclassified 1966
240 Ga0495653_0273015 3300046463 Bacteria 1113
241 Ga0495662_0188981 3300046476 Bacteria 1016
242 Ga0495608_0064540 3300046511 Bacteria 2400
243 Ga0495608_0065917 3300046511 Bacteria 2371
244 Ga0495608_0196280 3300046511 Unclassified 1273
245 Ga0495608_0525640 3300046511 Unclassified 715
246 Ga0495618_0052309 3300046514 Unclassified 2581
247 Ga0495618_0113304 3300046514 Bacteria 1736
248 Ga0495618_0376417 3300046514 Bacteria 872
249 Ga0495628_0016137 3300046516 Bacteria 6231
250 Ga0495628_0096106 3300046516 Bacteria 2289
251 Ga0495628_0230879 3300046516 Bacteria 1387
252 Ga0495628_0461125 3300046516 Unclassified 922
253 Ga0495630_0066198 3300046517 Bacteria 2715
254 Ga0495666_0203309 3300046526 Bacteria 910
255 Ga0495652_0174091 3300046529 Bacteria 1658
256 Ga0495652_0187954 3300046529 Bacteria 1579
257 Ga0495665_0327227 3300046531 Bacteria 782
258 Ga0495640_0002277 3300046533 Bacteria 15392
259 Ga0495640_0169303 3300046533 Unclassified 1396
260 Ga0495586_0058532 3300046535 Bacteria 2093
261 Ga0495587_0093572 3300046536 Bacteria 1735
262 Ga0495645_0035444 3300046543 Bacteria 3637
263 Ga0495645_0298740 3300046543 Bacteria 1053
264 Ga0495667_0003124 3300046559 Bacteria 11113
265 Ga0495656_0223051 3300046615 Bacteria 943
266 Ga0495634_0018361 3300046642 Bacteria 4980
267 Ga0495634_0069436 3300046642 Unclassified 2325
268 Ga0495634_0070291 3300046642 Unclassified 2308
269 Ga0495634_0070495 3300046642 Bacteria 2304
270 Ga0495634_0091415 3300046642 Bacteria 1976
271 Ga0495635_0063925 3300046663 Bacteria 2527
272 Ga0495635_0079964 3300046663 Bacteria 2237
273 Ga0495635_0089217 3300046663 Unclassified 2109
274 Ga0495657_0021789 3300046675 Bacteria 4597
275 Ga0495657_0139348 3300046675 Unclassified 1513
276 Ga0495657_0266410 3300046675 Bacteria 1028
277 Ga0495599_0032685 3300046678 Bacteria 3266
278 Ga0495599_0648459 3300046678 Bacteria 612
279 Ga0495623_0066018 3300046679 Unclassified 2262
280 Ga0495646_0138414 3300046680 Bacteria 1363
281 Ga0495658_0481784 3300046683 Bacteria 793
282 Ga0495613_0067107 3300046689 Bacteria 2618
283 Ga0495613_0068716 3300046689 Bacteria 2584
284 Ga0495613_0331484 3300046689 Bacteria 1049
285 Ga0495600_0151548 3300046809 Bacteria 1501
286 Ga0495600_0252444 3300046809 Bacteria 1121
287 Ga0495600_0483765 3300046809 Bacteria 762
288 Ga0495604_0022726 3300047317 Bacteria 5007
289 Ga0495604_0494707 3300047317 Unclassified 794
290 Ga0495604_0982507 3300047317 Bacteria 523
291 Ga0495674_0001250 3300047319 Bacteria 24674
292 Ga0495674_0072984 3300047319 Bacteria 2959
293 Ga0495674_0255810 3300047319 Bacteria 1440
294 Ga0495676_0035616 3300047321 Bacteria 4162
295 Ga0495680_0003325 3300047322 Bacteria 15912
296 Ga0495680_0008993 3300047322 Bacteria 9025
297 Ga0495680_0078241 3300047322 Bacteria 2503
298 Ga0495680_0154631 3300047322 Bacteria 1670
299 Ga0495675_0184012 3300047444 Unclassified 1278
300 Ga0495675_0369972 3300047444 Bacteria 840
301 Ga0495675_0483940 3300047444 Bacteria 712
302 Ga0495684_0016252 3300047471 Bacteria 5730
303 Ga0495684_0204274 3300047471 Unclassified 1455
304 Ga0495684_0390427 3300047471 Bacteria 980
305 Ga0495684_0508719 3300047471 Unclassified 827
306 Ga0495602_0059245 3300048088 Bacteria 3344
307 Ga0495602_0313568 3300048088 Bacteria 1144
308 Ga0495602_0416373 3300048088 Bacteria 955
309 Ga0496100_0022780 3300048903 Bacteria 3794
310 Ga0496100_0026915 3300048903 Bacteria 3531
311 Ga0496100_0223067 3300048903 Bacteria 1384
312 Ga0496100_0543904 3300048903 Bacteria 898
313 Ga0496101_0018499 3300048904 Bacteria 4739
314 Ga0496101_0030913 3300048904 Bacteria 3759
315 Ga0496101_0039506 3300048904 Bacteria 3357
316 Ga0496101_0106629 3300048904 Bacteria 2104
317 Ga0496101_0129605 3300048904 Bacteria 1914
318 Ga0496102_0012299 3300048905 Bacteria 7401
319 Ga0496102_0247162 3300048905 Unclassified 1682
320 Ga0496102_0799164 3300048905 Bacteria 866
321 Ga0496102_1128879 3300048905 Bacteria 703
322 Ga0496103_0026754 3300048906 Bacteria 3491
323 Ga0496103_0031794 3300048906 Bacteria 3219
324 Ga0496103_0043893 3300048906 Bacteria 2753
325 Ga0496104_0000329 3300048907 Bacteria 42355
326 Ga0496104_0004353 3300048907 Bacteria 12312
327 Ga0496104_0088785 3300048907 Bacteria 2953
328 Ga0496104_0227267 3300048907 Unclassified 1778
329 Ga0496105_0000128 3300048908 Bacteria 51033
330 Ga0496105_0004432 3300048908 Bacteria 10574
331 Ga0496106_0068083 3300048909 Bacteria 2715
332 Ga0496106_0127468 3300048909 Bacteria 1994
333 Ga0496106_0345341 3300048909 Bacteria 1195
334 Ga0496107_0090556 3300048910 Unclassified 2235
335 Ga0496107_0104459 3300048910 Bacteria 2079
336 Ga0496107_0131261 3300048910 Bacteria 1849
337 Ga0496107_0172526 3300048910 Bacteria 1605
338 Ga0496108_0005042 3300048911 Bacteria 10668
339 Ga0496108_0018733 3300048911 Bacteria 5674
340 Ga0496108_0181638 3300048911 Unclassified 1822
341 Ga0496108_0219141 3300048911 Bacteria 1653
342 Ga0496109_0000408 3300048912 Bacteria 38367
343 Ga0496109_0008215 3300048912 Bacteria 8857
344 Ga0496109_0241508 3300048912 Bacteria 1700
345 Ga0496109_0241766 3300048912 Bacteria 1699
346 Ga0496109_0356666 3300048912 Unclassified 1381
347 Ga0496109_0680736 3300048912 Bacteria 966
348 Ga0496110_0000289 3300048913 Bacteria 32969
349 Ga0496110_0011967 3300048913 Bacteria 7125
350 Ga0496110_0042156 3300048913 Bacteria 3983
351 Ga0496110_0267716 3300048913 Unclassified 1556
352 Ga0496111_0000145 3300048914 Bacteria 31804
353 Ga0496111_0001006 3300048914 Bacteria 15459
354 Ga0496111_0007092 3300048914 Bacteria 7323
355 Ga0496111_0065136 3300048914 Bacteria 2645
356 Ga0496111_0137955 3300048914 Unclassified 1807
357 Ga0496111_0263421 3300048914 Bacteria 1279
358 Ga0496112_0007445 3300048915 Bacteria 9716
359 Ga0496112_0008911 3300048915 Bacteria 9005
360 Ga0496112_0186228 3300048915 Bacteria 2039
361 Ga0496112_0259422 3300048915 Unclassified 1688
362 Ga0496113_0021049 3300048916 Bacteria 4596
363 Ga0496113_0138994 3300048916 Bacteria 1910
364 Ga0496113_0216089 3300048916 Unclassified 1527
365 Ga0496113_0224575 3300048916 Unclassified 1497
366 Ga0496114_0002645 3300048917 Bacteria 13671
367 Ga0496114_0005852 3300048917 Bacteria 9658
368 Ga0496114_0012282 3300048917 Bacteria 6852
369 Ga0496114_0015091 3300048917 Bacteria 6212
370 Ga0496114_0023286 3300048917 Bacteria 5053
371 Ga0496114_0192602 3300048917 Unclassified 1784
372 Ga0496114_0227435 3300048917 Unclassified 1638
373 Ga0496115_0331264 3300048918 Bacteria 1244
374 Ga0496115_0568487 3300048918 Bacteria 904
375 Ga0496115_0965160 3300048918 Unclassified 654
376 Ga0501040_0036414 3300049576 Bacteria 3340
377 Ga0501041_0371305 3300049577 Bacteria 905
378 Ga0501042_0347381 3300049578 Unclassified 1073
379 Ga0501046_0506195 3300049580 Unclassified 864
380 Ga0501048_0504729 3300049582 Unclassified 867
381 Ga0501069_0510897 3300049585 Bacteria 717
382 Ga0501076_0132093 3300049592 Unclassified 2025
383 Ga0501076_0395025 3300049592 Unclassified 1137
384 Ga0501079_0052229 3300049741 Bacteria 3155
385 Ga0501079_0120083 3300049741 Unclassified 2044
386 Ga0501081_0394075 3300049743 Bacteria 1025
387 Ga0501045_0033715 3300049824 Bacteria 3714
388 nmdc:mga0yw44_237343_c1 3300050492 Unclassified 1211
389 nmdc:mga05p37_1124_c1 3300050507 Bacteria 30734
390 nmdc:mga06r32_66642_c1 3300050510 Bacteria 3474
391 nmdc:mga08y16_94552_c1 3300050511 Bacteria 3113
392 nmdc:mga0n895_349236_c1 3300050512 Unclassified 1498
393 nmdc:mga0n895_9591_c1 3300050512 Bacteria 8480
394 nmdc:mga0rr50_1279_c1 3300050513 Bacteria 13709
395 nmdc:mga0a205_158675_c1 3300050515 Bacteria 2159
396 nmdc:mga0a205_2100_c2 3300050515 Bacteria 11080
397 nmdc:mga0a205_25976_c1 3300050515 Bacteria 5579
398 Ga0495601_0448039 3300053077 Bacteria 835
399 Ga0495601_0468018 3300053077 Bacteria 815
400 Ga0495612_0015125 3300053078 Bacteria 3094
401 Ga0495612_0270832 3300053078 Unclassified 758
402 Ga0495595_0033550 3300053084 Bacteria 2317
403 Ga0495595_0165255 3300053084 Unclassified 1094
404 Ga0495595_0304702 3300053084 Unclassified 801
405 Ga0495619_0030848 3300053085 Bacteria 3471
406 Ga0495619_0072030 3300053085 Bacteria 2313
407 Ga0495619_0072739 3300053085 Unclassified 2303
408 Ga0495619_0077820 3300053085 Bacteria 2229
409 Ga0495619_0113816 3300053085 Unclassified 1850
410 Ga0501084_0027381 3300054114 Bacteria 4763
411 Ga0501082_0032031 3300060353 Bacteria 4535

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037312 Ga0395899_0111259 Ga0395899_0111259_211_723 144
2 3300037418 Ga0395900_0120111 Ga0395900_0120111_1380_1892 144
3 3300037471 Ga0395905_0483475 Ga0395905_0483475_329_841 144
4 3300038443 Ga0395901_0033767 Ga0395901_0033767_1195_1707 144
5 3300037466 Ga0395898_0380562 Ga0395898_0380562_12_524 145
6 3300048915 Ga0496112_0007445 Ga0496112_0007445_5509_6021 146
7 3300037466 Ga0395898_0117431 Ga0395898_0117431_10_522 147
8 3300044901 Ga0466960_0012643 Ga0466960_0012643_266_778 147
9 3300047317 Ga0495604_0982507 Ga0495604_0982507_48_509 152
10 3300036401 Ga0373937_0573094 Ga0373937_0573094_454_975 154
11 3300044683 Ga0466965_0047065 Ga0466965_0047065_388_912 156
12 3300044693 Ga0466961_0018938 Ga0466961_0018938_1027_1551 156
13 3300044719 Ga0466971_0001907 Ga0466971_0001907_5281_5805 156
14 3300044735 Ga0466968_0018394 Ga0466968_0018394_1846_2370 156
15 3300044842 Ga0466957_0039236 Ga0466957_0039236_1210_1734 156
16 3300045049 Ga0466959_0027454 Ga0466959_0027454_433_957 156
17 3300045836 Ga0466958_0004948 Ga0466958_0004948_1123_1647 156
18 3300049592 Ga0501076_0132093 Ga0501076_0132093_167_637 156
19 3300049741 Ga0501079_0052229 Ga0501079_0052229_1886_2356 156
20 3300049824 Ga0501045_0033715 Ga0501045_0033715_3078_3548 156
21 3300054114 Ga0501084_0027381 Ga0501084_0027381_1241_1711 156
22 3300060353 Ga0501082_0032031 Ga0501082_0032031_2723_3193 156
23 3300046543 Ga0495645_0298740 Ga0495645_0298740_273_785 158
24 3300005434 Ga0070709_10137168 Ga0070709_101371681 159
25 3300009551 Ga0105238_11120260 Ga0105238_111202602 160
26 3300046543 Ga0495645_0035444 Ga0495645_0035444_1022_1543 163
27 3300046680 Ga0495646_0138414 Ga0495646_0138414_781_1302 163
28 3300048904 Ga0496101_0039506 Ga0496101_0039506_1868_2389 163
29 3300048907 Ga0496104_0004353 Ga0496104_0004353_3867_4388 163
30 3300048908 Ga0496105_0004432 Ga0496105_0004432_5255_5776 163
31 3300048912 Ga0496109_0241508 Ga0496109_0241508_444_965 163
32 3300013105 Ga0157369_10025501 Ga0157369_100255012 164
33 3300046459 Ga0495629_0116361 Ga0495629_0116361_515_1027 164
34 3300046462 Ga0495651_0007210 Ga0495651_0007210_7002_7514 164
35 3300046511 Ga0495608_0065917 Ga0495608_0065917_552_1064 164
36 3300046517 Ga0495630_0066198 Ga0495630_0066198_1266_1778 164
37 3300046526 Ga0495666_0203309 Ga0495666_0203309_299_811 164
38 3300046529 Ga0495652_0187954 Ga0495652_0187954_759_1271 164
39 3300046531 Ga0495665_0327227 Ga0495665_0327227_111_623 164
40 3300046533 Ga0495640_0002277 Ga0495640_0002277_13326_13838 164
41 3300046559 Ga0495667_0003124 Ga0495667_0003124_4714_5226 164
42 3300046663 Ga0495635_0063925 Ga0495635_0063925_993_1505 164
43 3300046675 Ga0495657_0021789 Ga0495657_0021789_2950_3462 164
44 3300046678 Ga0495599_0648459 Ga0495599_0648459_42_554 164
45 3300046809 Ga0495600_0483765 Ga0495600_0483765_189_701 164
46 3300047317 Ga0495604_0022726 Ga0495604_0022726_2514_3026 164
47 3300047319 Ga0495674_0001250 Ga0495674_0001250_989_1501 164
48 3300047322 Ga0495680_0003325 Ga0495680_0003325_12182_12694 164
49 3300047444 Ga0495675_0483940 Ga0495675_0483940_38_550 164
50 3300047471 Ga0495684_0016252 Ga0495684_0016252_918_1430 164
51 3300048088 Ga0495602_0416373 Ga0495602_0416373_39_551 164
52 3300048918 Ga0496115_0568487 Ga0496115_0568487_330_842 164
53 3300053077 Ga0495601_0448039 Ga0495601_0448039_266_778 164
54 3300053085 Ga0495619_0077820 Ga0495619_0077820_1014_1526 164
55 3300006881 Ga0068865_101666254 Ga0068865_1016662541 168
56 3300046511 Ga0495608_0525640 Ga0495608_0525640_30_536 168
57 3300046516 Ga0495628_0230879 Ga0495628_0230879_256_762 168
58 3300047322 Ga0495680_0154631 Ga0495680_0154631_1005_1511 168
59 3300047444 Ga0495675_0369972 Ga0495675_0369972_317_823 168
60 3300053078 Ga0495612_0270832 Ga0495612_0270832_144_650 168
61 3300045049 Ga0466959_0074845 Ga0466959_0074845_1056_1580 169
62 3300005329 Ga0070683_100016747 Ga0070683_1000167473 170
63 3300005337 Ga0070682_100013407 Ga0070682_1000134073 170
64 3300005337 Ga0070682_100080655 Ga0070682_1000806552 170
65 3300005339 Ga0070660_100156574 Ga0070660_1001565742 170
66 3300005356 Ga0070674_101051900 Ga0070674_1010519002 170
67 3300005366 Ga0070659_100593493 Ga0070659_1005934932 170
68 3300005367 Ga0070667_100119877 Ga0070667_1001198772 170
69 3300005456 Ga0070678_100032480 Ga0070678_1000324802 170
70 3300005456 Ga0070678_100060278 Ga0070678_1000602783 170
71 3300005458 Ga0070681_10008931 Ga0070681_100089316 170
72 3300005459 Ga0068867_100939874 Ga0068867_1009398741 170
73 3300005468 Ga0070707_100294062 Ga0070707_1002940622 170
74 3300005530 Ga0070679_100054246 Ga0070679_1000542462 170
75 3300005535 Ga0070684_100001346 Ga0070684_1000013466 170
76 3300005535 Ga0070684_100926123 Ga0070684_1009261232 170
77 3300005544 Ga0070686_100198636 Ga0070686_1001986362 170
78 3300005544 Ga0070686_100305904 Ga0070686_1003059042 170
79 3300005547 Ga0070693_100004489 Ga0070693_1000044896 170
80 3300005547 Ga0070693_100419086 Ga0070693_1004190862 170
81 3300005563 Ga0068855_100065446 Ga0068855_1000654464 170
82 3300005614 Ga0068856_100104415 Ga0068856_1001044152 170
83 3300005614 Ga0068856_100301670 Ga0068856_1003016702 170
84 3300005614 Ga0068856_102033324 Ga0068856_1020333241 170
85 3300005615 Ga0070702_100216811 Ga0070702_1002168111 170
86 3300005616 Ga0068852_100295618 Ga0068852_1002956182 170
87 3300005718 Ga0068866_10831694 Ga0068866_108316942 170
88 3300005719 Ga0068861_100708262 Ga0068861_1007082621 170
89 3300006358 Ga0068871_100468449 Ga0068871_1004684492 170
90 3300006871 Ga0075434_100032367 Ga0075434_1000323672 170
91 3300006871 Ga0075434_100149624 Ga0075434_1001496241 170
92 3300006914 Ga0075436_100375791 Ga0075436_1003757912 170
93 3300007076 Ga0075435_100006823 Ga0075435_1000068236 170
94 3300009098 Ga0105245_10022175 Ga0105245_100221752 170
95 3300009098 Ga0105245_10128896 Ga0105245_101288961 170
96 3300009148 Ga0105243_10058844 Ga0105243_100588442 170
97 3300009148 Ga0105243_10787707 Ga0105243_107877072 170
98 3300009174 Ga0105241_10804498 Ga0105241_108044982 170
99 3300009176 Ga0105242_10122133 Ga0105242_101221333 170
100 3300009553 Ga0105249_10241591 Ga0105249_102415913 170
101 3300010375 Ga0105239_10071854 Ga0105239_100718543 170
102 3300010375 Ga0105239_10111640 Ga0105239_101116403 170
103 3300013102 Ga0157371_10358692 Ga0157371_103586921 170
104 3300013105 Ga0157369_10894631 Ga0157369_108946312 170
105 3300013308 Ga0157375_10126959 Ga0157375_101269592 170
106 3300014325 Ga0163163_10211571 Ga0163163_102115712 170
107 3300014745 Ga0157377_10201549 Ga0157377_102015491 170
108 3300014745 Ga0157377_10224130 Ga0157377_102241302 170
109 3300025899 Ga0207642_10534937 Ga0207642_105349372 170
110 3300025911 Ga0207654_10222274 Ga0207654_102222742 170
111 3300025919 Ga0207657_10140380 Ga0207657_101403802 170
112 3300025921 Ga0207652_10078087 Ga0207652_100780873 170
113 3300025922 Ga0207646_10467252 Ga0207646_104672522 170
114 3300025927 Ga0207687_10016152 Ga0207687_100161522 170
115 3300025927 Ga0207687_10123292 Ga0207687_101232922 170
116 3300025931 Ga0207644_10107251 Ga0207644_101072512 170
117 3300025933 Ga0207706_10167593 Ga0207706_101675932 170
118 3300025934 Ga0207686_10037393 Ga0207686_100373932 170
119 3300025935 Ga0207709_10108935 Ga0207709_101089353 170
120 3300025935 Ga0207709_10381087 Ga0207709_103810871 170
121 3300025937 Ga0207669_11019661 Ga0207669_110196611 170
122 3300025938 Ga0207704_10459450 Ga0207704_104594502 170
123 3300025942 Ga0207689_10118208 Ga0207689_101182082 170
124 3300025944 Ga0207661_10001315 Ga0207661_100013154 170
125 3300025949 Ga0207667_10117660 Ga0207667_101176602 170
126 3300025986 Ga0207658_10096350 Ga0207658_100963502 170
127 3300026023 Ga0207677_10036658 Ga0207677_100366583 170
128 3300026078 Ga0207702_10018431 Ga0207702_100184313 170
129 3300026078 Ga0207702_10069863 Ga0207702_100698632 170
130 3300026078 Ga0207702_11122094 Ga0207702_111220942 170
131 3300026121 Ga0207683_10055613 Ga0207683_100556132 170
132 3300026121 Ga0207683_10079570 Ga0207683_100795703 170
133 3300028573 Ga0265334_10156365 Ga0265334_101563651 170
134 3300035090 Ga0373949_0114520 Ga0373949_0114520_27_542 170
135 3300037466 Ga0395898_0939985 Ga0395898_0939985_189_701 170
136 3300037466 Ga0395898_1761037 Ga0395898_1761037_18_530 170
137 3300044735 Ga0466968_0043357 Ga0466968_0043357_557_1069 170
138 3300046615 Ga0495656_0223051 Ga0495656_0223051_39_554 170
139 3300048903 Ga0496100_0022780 Ga0496100_0022780_376_891 170
140 3300048903 Ga0496100_0026915 Ga0496100_0026915_2555_3070 170
141 3300048904 Ga0496101_0018499 Ga0496101_0018499_3274_3789 170
142 3300048904 Ga0496101_0030913 Ga0496101_0030913_24_536 170
143 3300048904 Ga0496101_0129605 Ga0496101_0129605_1035_1550 170
144 3300048905 Ga0496102_0012299 Ga0496102_0012299_3974_4489 170
145 3300048905 Ga0496102_0247162 Ga0496102_0247162_69_584 170
146 3300048905 Ga0496102_1128879 Ga0496102_1128879_180_692 170
147 3300048906 Ga0496103_0026754 Ga0496103_0026754_1548_2063 170
148 3300048906 Ga0496103_0031794 Ga0496103_0031794_1444_1956 170
149 3300048906 Ga0496103_0043893 Ga0496103_0043893_1680_2195 170
150 3300048907 Ga0496104_0000329 Ga0496104_0000329_2887_3402 170
151 3300048907 Ga0496104_0227267 Ga0496104_0227267_221_736 170
152 3300048908 Ga0496105_0000128 Ga0496105_0000128_11364_11879 170
153 3300048909 Ga0496106_0068083 Ga0496106_0068083_1189_1704 170
154 3300048910 Ga0496107_0090556 Ga0496107_0090556_750_1265 170
155 3300048910 Ga0496107_0131261 Ga0496107_0131261_194_706 170
156 3300048911 Ga0496108_0018733 Ga0496108_0018733_1066_1581 170
157 3300048911 Ga0496108_0181638 Ga0496108_0181638_788_1303 170
158 3300048912 Ga0496109_0000408 Ga0496109_0000408_31762_32277 170
159 3300048913 Ga0496110_0011967 Ga0496110_0011967_2425_2940 170
160 3300048913 Ga0496110_0042156 Ga0496110_0042156_1529_2044 170
161 3300048914 Ga0496111_0001006 Ga0496111_0001006_9732_10247 170
162 3300048914 Ga0496111_0007092 Ga0496111_0007092_6017_6532 170
163 3300048916 Ga0496113_0138994 Ga0496113_0138994_1197_1712 170
164 3300048916 Ga0496113_0216089 Ga0496113_0216089_313_828 170
165 3300048917 Ga0496114_0002645 Ga0496114_0002645_1738_2253 170
166 3300048917 Ga0496114_0005852 Ga0496114_0005852_2713_3225 170
167 3300048917 Ga0496114_0012282 Ga0496114_0012282_5264_5779 170
168 3300048917 Ga0496114_0227435 Ga0496114_0227435_10_525 170
169 3300048918 Ga0496115_0331264 Ga0496115_0331264_145_657 170
170 3300048918 Ga0496115_0965160 Ga0496115_0965160_73_588 170
171 3300049576 Ga0501040_0036414 Ga0501040_0036414_2326_2841 170
172 3300049577 Ga0501041_0371305 Ga0501041_0371305_298_813 170
173 3300049578 Ga0501042_0347381 Ga0501042_0347381_345_860 170
174 3300049580 Ga0501046_0506195 Ga0501046_0506195_182_697 170
175 3300049582 Ga0501048_0504729 Ga0501048_0504729_263_778 170
176 3300049592 Ga0501076_0395025 Ga0501076_0395025_221_736 170
177 3300049741 Ga0501079_0120083 Ga0501079_0120083_1183_1698 170
178 3300049743 Ga0501081_0394075 Ga0501081_0394075_419_934 170
179 3300050512 nmdc:mga0n895_9591_c1 nmdc:mga0n895_9591_c1_7018_7530 170
180 3300050513 nmdc:mga0rr50_1279_c1 nmdc:mga0rr50_1279_c1_6669_7181 170
181 3300050515 nmdc:mga0a205_2100_c2 nmdc:mga0a205_2100_c2_2517_3029 170
182 3300005345 Ga0070692_10832261 Ga0070692_108322611 171
183 3300005535 Ga0070684_100921553 Ga0070684_1009215532 171
184 3300005435 Ga0070714_100270879 Ga0070714_1002708792 172
185 3300005435 Ga0070714_100673434 Ga0070714_1006734341 172
186 3300005436 Ga0070713_100022491 Ga0070713_1000224914 172
187 3300005439 Ga0070711_100420541 Ga0070711_1004205412 172
188 3300006028 Ga0070717_10010285 Ga0070717_100102854 172
189 3300009553 Ga0105249_10509422 Ga0105249_105094222 172
190 3300025898 Ga0207692_10518348 Ga0207692_105183482 172
191 3300025898 Ga0207692_10616078 Ga0207692_106160781 172
192 3300025910 Ga0207684_10494963 Ga0207684_104949632 172
193 3300025916 Ga0207663_10211588 Ga0207663_102115882 172
194 3300025928 Ga0207700_10188140 Ga0207700_101881402 172
195 3300025929 Ga0207664_10076733 Ga0207664_100767333 172
196 3300025929 Ga0207664_10256874 Ga0207664_102568742 172
197 3300025929 Ga0207664_11469273 Ga0207664_114692731 172
198 3300025961 Ga0207712_10197908 Ga0207712_101979082 172
199 3300036401 Ga0373937_0170335 Ga0373937_0170335_935_1456 172
200 3300046454 Ga0495592_0038146 Ga0495592_0038146_854_1375 172
201 3300046462 Ga0495651_0238220 Ga0495651_0238220_520_1041 172
202 3300046463 Ga0495653_0111378 Ga0495653_0111378_1022_1543 172
203 3300046476 Ga0495662_0188981 Ga0495662_0188981_370_891 172
204 3300046511 Ga0495608_0196280 Ga0495608_0196280_693_1214 172
205 3300046514 Ga0495618_0113304 Ga0495618_0113304_547_1068 172
206 3300046516 Ga0495628_0016137 Ga0495628_0016137_1096_1617 172
207 3300046529 Ga0495652_0174091 Ga0495652_0174091_724_1245 172
208 3300046533 Ga0495640_0169303 Ga0495640_0169303_182_703 172
209 3300046536 Ga0495587_0093572 Ga0495587_0093572_209_730 172
210 3300046642 Ga0495634_0070291 Ga0495634_0070291_1601_2122 172
211 3300046663 Ga0495635_0089217 Ga0495635_0089217_957_1478 172
212 3300046675 Ga0495657_0139348 Ga0495657_0139348_541_1062 172
213 3300046678 Ga0495599_0032685 Ga0495599_0032685_392_913 172
214 3300046689 Ga0495613_0331484 Ga0495613_0331484_173_691 172
215 3300046809 Ga0495600_0252444 Ga0495600_0252444_216_737 172
216 3300047319 Ga0495674_0072984 Ga0495674_0072984_926_1447 172
217 3300047322 Ga0495680_0078241 Ga0495680_0078241_1448_1969 172
218 3300047471 Ga0495684_0204274 Ga0495684_0204274_734_1255 172
219 3300047471 Ga0495684_0508719 Ga0495684_0508719_130_651 172
220 3300048088 Ga0495602_0059245 Ga0495602_0059245_2033_2554 172
221 3300048907 Ga0496104_0088785 Ga0496104_0088785_1143_1664 172
222 3300048912 Ga0496109_0241766 Ga0496109_0241766_647_1168 172
223 3300048914 Ga0496111_0263421 Ga0496111_0263421_216_737 172
224 3300053078 Ga0495612_0015125 Ga0495612_0015125_1489_2010 172
225 3300053084 Ga0495595_0165255 Ga0495595_0165255_458_979 172
226 3300053084 Ga0495595_0304702 Ga0495595_0304702_264_785 172
227 3300053085 Ga0495619_0030848 Ga0495619_0030848_1647_2168 172
228 3300053085 Ga0495619_0113816 Ga0495619_0113816_355_876 172
229 3300005355 Ga0070671_100116372 Ga0070671_1001163722 173
230 3300005364 Ga0070673_101041420 Ga0070673_1010414202 173
231 3300005439 Ga0070711_100290814 Ga0070711_1002908142 173
232 3300005456 Ga0070678_100517417 Ga0070678_1005174171 173
233 3300005471 Ga0070698_100885960 Ga0070698_1008859602 173
234 3300005536 Ga0070697_100092822 Ga0070697_1000928223 173
235 3300006038 Ga0075365_10280466 Ga0075365_102804662 173
236 3300006175 Ga0070712_100329300 Ga0070712_1003293002 173
237 3300006358 Ga0068871_101283773 Ga0068871_1012837732 173
238 3300006844 Ga0075428_100002807 Ga0075428_1000028074 173
239 3300006847 Ga0075431_100102152 Ga0075431_1001021523 173
240 3300006852 Ga0075433_10037554 Ga0075433_100375546 173
241 3300006852 Ga0075433_10413488 Ga0075433_104134882 173
242 3300006871 Ga0075434_100351204 Ga0075434_1003512042 173
243 3300007076 Ga0075435_100456836 Ga0075435_1004568362 173
244 3300009094 Ga0111539_10084350 Ga0111539_100843503 173
245 3300009098 Ga0105245_10175164 Ga0105245_101751642 173
246 3300009147 Ga0114129_10009882 Ga0114129_1000988213 173
247 3300009147 Ga0114129_10025500 Ga0114129_100255007 173
248 3300009148 Ga0105243_10410746 Ga0105243_104107462 173
249 3300009174 Ga0105241_10242989 Ga0105241_102429892 173
250 3300009176 Ga0105242_10191952 Ga0105242_101919522 173
251 3300011119 Ga0105246_10056427 Ga0105246_100564272 173
252 3300013308 Ga0157375_10088826 Ga0157375_100888263 173
253 3300014968 Ga0157379_10340255 Ga0157379_103402552 173
254 3300017792 Ga0163161_11165907 Ga0163161_111659072 173
255 3300025918 Ga0207662_10307893 Ga0207662_103078932 173
256 3300025927 Ga0207687_10063116 Ga0207687_100631162 173
257 3300025931 Ga0207644_10175372 Ga0207644_101753722 173
258 3300025937 Ga0207669_10071005 Ga0207669_100710052 173
259 3300025938 Ga0207704_10438650 Ga0207704_104386501 173
260 3300028577 Ga0265318_10130273 Ga0265318_101302732 173
261 3300028800 Ga0265338_10004996 Ga0265338_1000499615 173
262 3300031251 Ga0265327_10025127 Ga0265327_100251273 173
263 3300031712 Ga0265342_10356196 Ga0265342_103561962 173
264 3300032002 Ga0307416_100664523 Ga0307416_1006645232 173
265 3300035117 Ga0373953_0060922 Ga0373953_0060922_905_1426 173
266 3300035119 Ga0373956_0115549 Ga0373956_0115549_216_737 173
267 3300035410 Ga0373924_0028783 Ga0373924_0028783_542_1063 173
268 3300035725 Ga0373947_0101315 Ga0373947_0101315_1136_1663 173
269 3300037418 Ga0395900_0321665 Ga0395900_0321665_153_680 173
270 3300037418 Ga0395900_0669901 Ga0395900_0669901_304_828 173
271 3300037466 Ga0395898_0092574 Ga0395898_0092574_1678_2205 173
272 3300037471 Ga0395905_0289387 Ga0395905_0289387_848_1375 173
273 3300038443 Ga0395901_0459002 Ga0395901_0459002_225_749 173
274 3300038443 Ga0395901_1055034 Ga0395901_1055034_192_719 173
275 3300041512 Ga0451853_3997314 Ga0451853_3997314_142_669 173
276 3300042142 Ga0450905_012254 Ga0450905_012254_532_1056 173
277 3300046455 Ga0495603_0026598 Ga0495603_0026598_398_925 173
278 3300046459 Ga0495629_0022107 Ga0495629_0022107_3838_4365 173
279 3300046462 Ga0495651_0426863 Ga0495651_0426863_94_615 173
280 3300046463 Ga0495653_0034233 Ga0495653_0034233_1906_2427 173
281 3300046511 Ga0495608_0064540 Ga0495608_0064540_1857_2378 173
282 3300046514 Ga0495618_0376417 Ga0495618_0376417_47_568 173
283 3300046516 Ga0495628_0096106 Ga0495628_0096106_1281_1802 173
284 3300046535 Ga0495586_0058532 Ga0495586_0058532_862_1389 173
285 3300046642 Ga0495634_0018361 Ga0495634_0018361_28_555 173
286 3300046642 Ga0495634_0070495 Ga0495634_0070495_1169_1690 173
287 3300046642 Ga0495634_0091415 Ga0495634_0091415_1013_1537 173
288 3300046663 Ga0495635_0079964 Ga0495635_0079964_1093_1614 173
289 3300046675 Ga0495657_0266410 Ga0495657_0266410_444_965 173
290 3300046679 Ga0495623_0066018 Ga0495623_0066018_992_1513 173
291 3300046683 Ga0495658_0481784 Ga0495658_0481784_151_675 173
292 3300046689 Ga0495613_0067107 Ga0495613_0067107_1226_1753 173
293 3300046689 Ga0495613_0068716 Ga0495613_0068716_89_610 173
294 3300046809 Ga0495600_0151548 Ga0495600_0151548_935_1456 173
295 3300047319 Ga0495674_0255810 Ga0495674_0255810_823_1347 173
296 3300047321 Ga0495676_0035616 Ga0495676_0035616_1183_1710 173
297 3300047322 Ga0495680_0008993 Ga0495680_0008993_6876_7397 173
298 3300047444 Ga0495675_0184012 Ga0495675_0184012_288_809 173
299 3300048088 Ga0495602_0313568 Ga0495602_0313568_217_738 173
300 3300048903 Ga0496100_0223067 Ga0496100_0223067_719_1246 173
301 3300048903 Ga0496100_0543904 Ga0496100_0543904_53_580 173
302 3300048904 Ga0496101_0106629 Ga0496101_0106629_784_1311 173
303 3300048905 Ga0496102_0799164 Ga0496102_0799164_135_662 173
304 3300048909 Ga0496106_0345341 Ga0496106_0345341_184_711 173
305 3300048910 Ga0496107_0104459 Ga0496107_0104459_157_684 173
306 3300048911 Ga0496108_0005042 Ga0496108_0005042_1002_1529 173
307 3300048911 Ga0496108_0219141 Ga0496108_0219141_172_699 173
308 3300048912 Ga0496109_0008215 Ga0496109_0008215_3705_4232 173
309 3300048912 Ga0496109_0680736 Ga0496109_0680736_154_681 173
310 3300048913 Ga0496110_0000289 Ga0496110_0000289_12788_13315 173
311 3300048914 Ga0496111_0000145 Ga0496111_0000145_16855_17382 173
312 3300048914 Ga0496111_0137955 Ga0496111_0137955_787_1314 173
313 3300048915 Ga0496112_0186228 Ga0496112_0186228_391_918 173
314 3300048915 Ga0496112_0259422 Ga0496112_0259422_201_728 173
315 3300048916 Ga0496113_0021049 Ga0496113_0021049_3452_3979 173
316 3300048917 Ga0496114_0015091 Ga0496114_0015091_3039_3566 173
317 3300048917 Ga0496114_0023286 Ga0496114_0023286_668_1195 173
318 3300048917 Ga0496114_0192602 Ga0496114_0192602_94_621 173
319 3300049585 Ga0501069_0510897 Ga0501069_0510897_145_672 173
320 3300050492 nmdc:mga0yw44_237343_c1 nmdc:mga0yw44_237343_c1_249_773 173
321 3300050507 nmdc:mga05p37_1124_c1 nmdc:mga05p37_1124_c1_27565_28089 173
322 3300050510 nmdc:mga06r32_66642_c1 nmdc:mga06r32_66642_c1_1601_2125 173
323 3300050511 nmdc:mga08y16_94552_c1 nmdc:mga08y16_94552_c1_1810_2337 173
324 3300050512 nmdc:mga0n895_349236_c1 nmdc:mga0n895_349236_c1_815_1339 173
325 3300050515 nmdc:mga0a205_158675_c1 nmdc:mga0a205_158675_c1_363_887 173
326 3300050515 nmdc:mga0a205_25976_c1 nmdc:mga0a205_25976_c1_3238_3765 173
327 3300053084 Ga0495595_0033550 Ga0495595_0033550_786_1307 173
328 3300053085 Ga0495619_0072030 Ga0495619_0072030_519_1040 173
329 3300005327 Ga0070658_10248898 Ga0070658_102488982 174
330 3300005329 Ga0070683_100022133 Ga0070683_1000221332 174
331 3300005337 Ga0070682_100071937 Ga0070682_1000719372 174
332 3300005338 Ga0068868_100346272 Ga0068868_1003462722 174
333 3300005339 Ga0070660_100178208 Ga0070660_1001782082 174
334 3300005341 Ga0070691_10087927 Ga0070691_100879271 174
335 3300005355 Ga0070671_100086494 Ga0070671_1000864945 174
336 3300005435 Ga0070714_100006822 Ga0070714_1000068225 174
337 3300005436 Ga0070713_100011668 Ga0070713_1000116683 174
338 3300005458 Ga0070681_10069297 Ga0070681_100692972 174
339 3300005535 Ga0070684_100155056 Ga0070684_1001550563 174
340 3300005563 Ga0068855_100282506 Ga0068855_1002825062 174
341 3300005614 Ga0068856_100143236 Ga0068856_1001432362 174
342 3300005618 Ga0068864_101297547 Ga0068864_1012975471 174
343 3300005985 Ga0081539_10019905 Ga0081539_100199053 174
344 3300006028 Ga0070717_10026062 Ga0070717_100260623 174
345 3300009093 Ga0105240_10321942 Ga0105240_103219422 174
346 3300009098 Ga0105245_10564188 Ga0105245_105641882 174
347 3300009177 Ga0105248_10026601 Ga0105248_100266012 174
348 3300020070 Ga0206356_10531113 Ga0206356_105311132 174
349 3300022467 Ga0224712_10026332 Ga0224712_100263322 174
350 3300025914 Ga0207671_10569202 Ga0207671_105692022 174
351 3300025917 Ga0207660_10364673 Ga0207660_103646732 174
352 3300025919 Ga0207657_10005839 Ga0207657_100058393 174
353 3300025929 Ga0207664_10120551 Ga0207664_101205512 174
354 3300025931 Ga0207644_10602363 Ga0207644_106023631 174
355 3300025932 Ga0207690_10132927 Ga0207690_101329272 174
356 3300025944 Ga0207661_10242666 Ga0207661_102426663 174
357 3300025949 Ga0207667_10358013 Ga0207667_103580132 174
358 3300026078 Ga0207702_10150244 Ga0207702_101502442 174
359 3300028556 Ga0265337_1104977 Ga0265337_11049772 174
360 3300028558 Ga0265326_10012715 Ga0265326_100127152 174
361 3300028563 Ga0265319_1003634 Ga0265319_10036342 174
362 3300028573 Ga0265334_10002143 Ga0265334_100021436 174
363 3300028573 Ga0265334_10006821 Ga0265334_100068213 174
364 3300028577 Ga0265318_10000445 Ga0265318_1000044510 174
365 3300028653 Ga0265323_10010132 Ga0265323_100101322 174
366 3300028654 Ga0265322_10007423 Ga0265322_100074232 174
367 3300028666 Ga0265336_10036878 Ga0265336_100368782 174
368 3300028800 Ga0265338_10006808 Ga0265338_100068089 174
369 3300028800 Ga0265338_10010234 Ga0265338_100102342 174
370 3300028800 Ga0265338_10040072 Ga0265338_100400722 174
371 3300029957 Ga0265324_10009896 Ga0265324_100098962 174
372 3300029957 Ga0265324_10019389 Ga0265324_100193892 174
373 3300029957 Ga0265324_10122480 Ga0265324_101224802 174
374 3300031235 Ga0265330_10000419 Ga0265330_100004196 174
375 3300031238 Ga0265332_10015821 Ga0265332_100158214 174
376 3300031239 Ga0265328_10003874 Ga0265328_100038743 174
377 3300031240 Ga0265320_10025473 Ga0265320_100254732 174
378 3300031241 Ga0265325_10001635 Ga0265325_100016356 174
379 3300031242 Ga0265329_10056394 Ga0265329_100563942 174
380 3300031247 Ga0265340_10011366 Ga0265340_100113662 174
381 3300031249 Ga0265339_10004228 Ga0265339_100042285 174
382 3300031250 Ga0265331_10002612 Ga0265331_100026128 174
383 3300031251 Ga0265327_10018151 Ga0265327_100181512 174
384 3300031251 Ga0265327_10076720 Ga0265327_100767202 174
385 3300031344 Ga0265316_10003234 Ga0265316_1000323410 174
386 3300031595 Ga0265313_10029210 Ga0265313_100292102 174
387 3300035692 Ga0373935_0084584 Ga0373935_0084584_123_653 174
388 3300035692 Ga0373935_0121284 Ga0373935_0121284_439_963 174
389 3300037471 Ga0395905_0403506 Ga0395905_0403506_11_544 174
390 3300038443 Ga0395901_1085417 Ga0395901_1085417_47_580 174
391 3300044694 Ga0466963_0005588 Ga0466963_0005588_882_1406 174
392 3300044694 Ga0466963_0010464 Ga0466963_0010464_4414_4938 174
393 3300044694 Ga0466963_0041187 Ga0466963_0041187_778_1302 174
394 3300044694 Ga0466963_0218941 Ga0466963_0218941_782_1306 174
395 3300044706 Ga0466964_0192416 Ga0466964_0192416_211_735 174
396 3300044735 Ga0466968_0025536 Ga0466968_0025536_1238_1762 174
397 3300046463 Ga0495653_0273015 Ga0495653_0273015_300_824 174
398 3300046514 Ga0495618_0052309 Ga0495618_0052309_1963_2493 174
399 3300046516 Ga0495628_0461125 Ga0495628_0461125_75_605 174
400 3300046642 Ga0495634_0069436 Ga0495634_0069436_256_786 174
401 3300047317 Ga0495604_0494707 Ga0495604_0494707_245_769 174
402 3300047471 Ga0495684_0390427 Ga0495684_0390427_381_905 174
403 3300048909 Ga0496106_0127468 Ga0496106_0127468_1417_1941 174
404 3300048910 Ga0496107_0172526 Ga0496107_0172526_494_1018 174
405 3300048912 Ga0496109_0356666 Ga0496109_0356666_768_1292 174
406 3300048913 Ga0496110_0267716 Ga0496110_0267716_748_1272 174
407 3300048914 Ga0496111_0065136 Ga0496111_0065136_551_1075 174
408 3300048915 Ga0496112_0008911 Ga0496112_0008911_116_646 174
409 3300048916 Ga0496113_0224575 Ga0496113_0224575_760_1284 174
410 3300053077 Ga0495601_0468018 Ga0495601_0468018_176_700 174
411 3300053085 Ga0495619_0072739 Ga0495619_0072739_283_807 174

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04093

MreD

rod shape-determining protein MreD

9

164

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4tkr-assembly1.cif.gz_A native-sad phasing for thit from listeria monocytogenes serovar. 0.7143 3 158
4tkr-assembly1.cif.gz_A native-sad phasing for thit from listeria monocytogenes serovar. 0.6496 3 158
4hzu-assembly1.cif.gz_S structure of a bacterial energy-coupling factor transporter 0.6214 1 159
4huq-assembly1.cif.gz_S crystal structure of a transporter 0.5982 2 170
4hzu-assembly1.cif.gz_S structure of a bacterial energy-coupling factor transporter 0.598 1 159
ID Description Score Start End Superfamily
af_P0ABH4_4_155_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7993 2 156 1.10.1760.20
af_P0ABH4_4_155_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.781 2 156 1.10.1760.20
af_Q2FXS7_1_165_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7573 3 161 1.10.1760.20
af_Q2FXS7_1_165_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7294 3 161 1.10.1760.20
4tkrA00 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7143 3 158 1.10.1760.20
ID Description Score Start End GO Terms
AF-A0A538HL52-F1-model_v4 Rod shape-determining protein MreD 0.9791 2 132 GO:0005886
GO:0008360
AF-A0A538HL52-F1-model_v4 Rod shape-determining protein MreD 0.9576 2 132 GO:0005886
GO:0008360
AF-A0A7V9M8J1-F1-model_v4 Rod shape-determining protein MreD 0.9454 2 164 GO:0005886
GO:0008360
AF-A0A7X8FPP4-F1-model_v4 Rod shape-determining protein MreD 0.936 7 159 GO:0005886
GO:0008360
AF-A0A538J9I5-F1-model_v4 Rod shape-determining protein MreD 0.9346 3 174 GO:0005886
GO:0008360

Feature Viewer

pLDDT pTM Quality
88.24 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map