F437563

General Info

Members Datasets Scaffolds Average Seq Length
411 186 822 153

Family's Representative Sequence

Representative Sequence 3300035115|Ga0373941_0040931|Ga0373941_0040931_404_949
Length 181
Sequence VTTRIARPSFKLQRQIEVSELERLWSPWRARYIASGVDAHKDGCVFCAIANDPEHDEENFVLHRAHHCFVVLNLYPYISGHLMIVPYLHTSEFDSTAKEITDEMMDQTKRAQRALREIYKPAGFNMGMNLGVAGGAGIADHLHIHLLPRWGGDTNFMTTVGETRVLPEDLPTTYAKLKPHF

Samples

Sample ID Description Type Environment
1 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
141 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
142 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
143 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
144 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
154 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
155 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
156 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
166 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
167 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
168 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
169 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
170 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
171 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
172 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
173 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
174 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
175 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
176 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
177 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
178 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
179 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
180 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
181 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
185 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
186 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.7
Rhizosphere 98.3
Stem 0
Stem Tuber 0
Unclassified 24.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373941_0040931 3300035115 Unclassified 1432
2 MBSR1b_contig_2105260 2162886012 Bacteria 1701
3 JGI24750J21931_1057874 3300002070 Unclassified 615
4 JGI24751J29686_10000124 3300002459 Bacteria 38798
5 JGI25406J46586_10003601 3300003203 Bacteria 7261
6 Ga0065712_10067792 3300005290 Bacteria 34297
7 Ga0065715_10047735 3300005293 Unclassified 923
8 Ga0065715_10090188 3300005293 Bacteria 7487
9 Ga0065715_10103260 3300005293 Bacteria 3046
10 Ga0065707_10343913 3300005295 Bacteria 919
11 Ga0070676_10976103 3300005328 Bacteria 635
12 Ga0070690_100001079 3300005330 Bacteria 13993
13 Ga0070670_100293788 3300005331 Unclassified 1420
14 Ga0068869_100047907 3300005334 Bacteria 3088
15 Ga0068869_100100294 3300005334 Unclassified 2189
16 Ga0068869_100254908 3300005334 Unclassified 1403
17 Ga0068869_100454727 3300005334 Bacteria 1062
18 Ga0068869_100769396 3300005334 Bacteria 826
19 Ga0068869_101075949 3300005334 Unclassified 703
20 Ga0070680_100040200 3300005336 Bacteria 3786
21 Ga0070680_100075339 3300005336 Bacteria 2778
22 Ga0070680_100279921 3300005336 Bacteria 1413
23 Ga0068868_100123914 3300005338 Bacteria 2109
24 Ga0068868_100377544 3300005338 Bacteria 1219
25 Ga0068868_100899820 3300005338 Unclassified 804
26 Ga0070689_100005159 3300005340 Bacteria 8888
27 Ga0070689_100730209 3300005340 Unclassified 867
28 Ga0070691_10699081 3300005341 Unclassified 608
29 Ga0070687_100000973 3300005343 Bacteria 9748
30 Ga0070687_100110374 3300005343 Bacteria 1555
31 Ga0070687_100155672 3300005343 Unclassified 1346
32 Ga0070687_101005222 3300005343 Unclassified 605
33 Ga0070692_10017835 3300005345 Bacteria 3402
34 Ga0070692_10025277 3300005345 Bacteria 2925
35 Ga0070692_10026801 3300005345 Bacteria 2852
36 Ga0070692_10177192 3300005345 Bacteria 1233
37 Ga0070692_10195683 3300005345 Bacteria 1181
38 Ga0070669_100014727 3300005353 Bacteria 5568
39 Ga0070669_100196561 3300005353 Bacteria 1585
40 Ga0070675_100017401 3300005354 Bacteria 5711
41 Ga0070671_100002297 3300005355 Bacteria 14761
42 Ga0070671_100042723 3300005355 Bacteria 3768
43 Ga0070674_100554126 3300005356 Bacteria 965
44 Ga0070673_100030252 3300005364 Bacteria 4048
45 Ga0070673_100109848 3300005364 Bacteria 2285
46 Ga0070673_100204340 3300005364 Bacteria 1702
47 Ga0070688_100012128 3300005365 Bacteria 4818
48 Ga0070667_100045787 3300005367 Bacteria 3679
49 Ga0070667_101239657 3300005367 Unclassified 698
50 Ga0070701_10047426 3300005438 Bacteria 2212
51 Ga0070701_10112606 3300005438 Bacteria 1523
52 Ga0070701_10169882 3300005438 Bacteria 1269
53 Ga0070701_10260200 3300005438 Bacteria 1051
54 Ga0070701_10684894 3300005438 Bacteria 688
55 Ga0070705_100001506 3300005440 Bacteria 12262
56 Ga0070705_100047379 3300005440 Bacteria 2484
57 Ga0070705_100166836 3300005440 Bacteria 1478
58 Ga0070700_100000173 3300005441 Bacteria 36530
59 Ga0070700_100090466 3300005441 Bacteria 1996
60 Ga0070700_100466019 3300005441 Bacteria 965
61 Ga0070694_100087439 3300005444 Bacteria 2180
62 Ga0070694_100110739 3300005444 Bacteria 1955
63 Ga0070694_100354514 3300005444 Unclassified 1137
64 Ga0070694_100458971 3300005444 Bacteria 1007
65 Ga0070694_100586162 3300005444 Unclassified 896
66 Ga0070708_100049018 3300005445 Unclassified 3736
67 Ga0070678_100091922 3300005456 Bacteria 2330
68 Ga0070662_101229577 3300005457 Unclassified 644
69 Ga0070681_10220028 3300005458 Bacteria 1814
70 Ga0068867_100686370 3300005459 Bacteria 902
71 Ga0070685_10035744 3300005466 Bacteria 2805
72 Ga0070685_10136551 3300005466 Bacteria 1539
73 Ga0070706_100000300 3300005467 Bacteria 60347
74 Ga0070706_100155855 3300005467 Bacteria 2132
75 Ga0070706_100362949 3300005467 Bacteria 1349
76 Ga0070707_100003608 3300005468 Bacteria 14599
77 Ga0070707_100113530 3300005468 Bacteria 2629
78 Ga0070698_100026306 3300005471 Bacteria 6057
79 Ga0070698_100029215 3300005471 Bacteria 5723
80 Ga0070699_100381477 3300005518 Bacteria 1273
81 Ga0070679_100702236 3300005530 Bacteria 954
82 Ga0070684_100115994 3300005535 Unclassified 2405
83 Ga0070697_100345340 3300005536 Bacteria 1285
84 Ga0070697_100511342 3300005536 Unclassified 1051
85 Ga0070697_101361880 3300005536 Unclassified 633
86 Ga0068853_100031864 3300005539 Bacteria 4462
87 Ga0068853_100344797 3300005539 Unclassified 1384
88 Ga0068853_101174053 3300005539 Unclassified 741
89 Ga0070672_100006583 3300005543 Bacteria 7818
90 Ga0070672_100217749 3300005543 Bacteria 1601
91 Ga0070672_100440547 3300005543 Unclassified 1121
92 Ga0070672_100463781 3300005543 Bacteria 1092
93 Ga0070686_100017735 3300005544 Bacteria 4166
94 Ga0070686_100042257 3300005544 Bacteria 2854
95 Ga0070686_100069209 3300005544 Bacteria 2304
96 Ga0070686_100413401 3300005544 Bacteria 1029
97 Ga0070686_100450194 3300005544 Unclassified 990
98 Ga0070695_100053365 3300005545 Bacteria 2599
99 Ga0070695_100076097 3300005545 Bacteria 2210
100 Ga0070695_100094842 3300005545 Bacteria 1999
101 Ga0070695_100453097 3300005545 Unclassified 983
102 Ga0070695_100706295 3300005545 Bacteria 801
103 Ga0070696_100070091 3300005546 Bacteria 2465
104 Ga0070696_100137185 3300005546 Bacteria 1784
105 Ga0070696_100479293 3300005546 Bacteria 986
106 Ga0070696_100852198 3300005546 Unclassified 753
107 Ga0070693_100001493 3300005547 Bacteria 10543
108 Ga0070665_101372111 3300005548 Bacteria 716
109 Ga0070704_100001705 3300005549 Bacteria 11972
110 Ga0070704_100033329 3300005549 Bacteria 3481
111 Ga0070704_100151491 3300005549 Bacteria 1824
112 Ga0070704_100292182 3300005549 Bacteria 1355
113 Ga0070704_100312336 3300005549 Unclassified 1314
114 Ga0070704_100395000 3300005549 Unclassified 1178
115 Ga0070704_100508321 3300005549 Unclassified 1047
116 Ga0070664_100243836 3300005564 Bacteria 1614
117 Ga0070664_101562965 3300005564 Unclassified 625
118 Ga0068857_100288840 3300005577 Bacteria 1510
119 Ga0068857_100869190 3300005577 Unclassified 863
120 Ga0068854_102025242 3300005578 Unclassified 531
121 Ga0068856_100010070 3300005614 Bacteria 9186
122 Ga0070702_100000327 3300005615 Bacteria 16557
123 Ga0070702_100582454 3300005615 Bacteria 836
124 Ga0070702_100621278 3300005615 Unclassified 813
125 Ga0068852_100273261 3300005616 Bacteria 1627
126 Ga0068859_100003869 3300005617 Bacteria 15295
127 Ga0068859_100012775 3300005617 Bacteria 8438
128 Ga0068859_100020802 3300005617 Bacteria 6586
129 Ga0068859_100129178 3300005617 Bacteria 2598
130 Ga0068859_100224325 3300005617 Bacteria 1967
131 Ga0068859_100409705 3300005617 Bacteria 1451
132 Ga0068859_100486455 3300005617 Unclassified 1329
133 Ga0068859_101532634 3300005617 Bacteria 736
134 Ga0068864_100004233 3300005618 Bacteria 11810
135 Ga0068864_100116563 3300005618 Bacteria 2383
136 Ga0068864_100272500 3300005618 Bacteria 1577
137 Ga0068864_100704711 3300005618 Bacteria 986
138 Ga0068864_101459479 3300005618 Bacteria 687
139 Ga0068861_100004957 3300005719 Bacteria 8966
140 Ga0068861_100025737 3300005719 Bacteria 4271
141 Ga0068861_100025845 3300005719 Bacteria 4263
142 Ga0068861_100208718 3300005719 Bacteria 1644
143 Ga0068861_100482757 3300005719 Bacteria 1117
144 Ga0068851_10005780 3300005834 Bacteria 5633
145 Ga0068870_10229536 3300005840 Bacteria 1140
146 Ga0068870_10487028 3300005840 Unclassified 819
147 Ga0068863_100028818 3300005841 Bacteria 5302
148 Ga0068863_100089013 3300005841 Bacteria 2926
149 Ga0068863_100667315 3300005841 Bacteria 1032
150 Ga0068858_100049915 3300005842 Bacteria 3874
151 Ga0068858_100069506 3300005842 Bacteria 3264
152 Ga0068858_100147330 3300005842 Bacteria 2211
153 Ga0068858_100662506 3300005842 Bacteria 1014
154 Ga0068860_100154068 3300005843 Bacteria 2214
155 Ga0068860_100256301 3300005843 Bacteria 1704
156 Ga0068860_100355246 3300005843 Bacteria 1443
157 Ga0068860_100863431 3300005843 Unclassified 920
158 Ga0068860_101114228 3300005843 Unclassified 809
159 Ga0068860_101199220 3300005843 Bacteria 779
160 Ga0068862_100031256 3300005844 Bacteria 4492
161 Ga0068862_100510301 3300005844 Bacteria 1142
162 Ga0068862_100865007 3300005844 Bacteria 887
163 Ga0068862_101428361 3300005844 Unclassified 696
164 Ga0070716_100016133 3300006173 Bacteria 3851
165 Ga0068871_100003839 3300006358 Bacteria 10355
166 Ga0068871_100312171 3300006358 Bacteria 1382
167 Ga0075428_101325337 3300006844 Bacteria 757
168 Ga0075431_100469097 3300006847 Bacteria 1253
169 Ga0075431_100487588 3300006847 Bacteria 1225
170 Ga0075433_10004770 3300006852 Bacteria 10577
171 Ga0075433_10031289 3300006852 Bacteria 4548
172 Ga0075433_10437069 3300006852 Bacteria 1154
173 Ga0075433_10542336 3300006852 Bacteria 1023
174 Ga0075434_100183567 3300006871 Bacteria 2112
175 Ga0068865_100015094 3300006881 Bacteria 4921
176 Ga0068865_100693105 3300006881 Unclassified 870
177 Ga0068865_100868639 3300006881 Unclassified 782
178 Ga0068865_101082525 3300006881 Unclassified 705
179 Ga0097620_100003869 3300006931 Bacteria 15295
180 Ga0097620_100012775 3300006931 Bacteria 8438
181 Ga0097620_100020801 3300006931 Bacteria 6586
182 Ga0097620_100129170 3300006931 Bacteria 2598
183 Ga0097620_100224323 3300006931 Bacteria 1967
184 Ga0097620_100409706 3300006931 Bacteria 1451
185 Ga0097620_100486431 3300006931 Unclassified 1329
186 Ga0097620_100880859 3300006931 Unclassified 980
187 Ga0097620_101532184 3300006931 Bacteria 736
188 Ga0105251_10264205 3300009011 Bacteria 777
189 Ga0111539_10146536 3300009094 Bacteria 2764
190 Ga0111539_10199294 3300009094 Bacteria 2335
191 Ga0111539_10408841 3300009094 Bacteria 1581
192 Ga0111539_10438068 3300009094 Bacteria 1522
193 Ga0105245_10337533 3300009098 Bacteria 1489
194 Ga0105245_10594046 3300009098 Bacteria 1133
195 Ga0105245_11377400 3300009098 Unclassified 755
196 Ga0105247_10543685 3300009101 Bacteria 853
197 Ga0114129_10000991 3300009147 Bacteria 37136
198 Ga0114129_10033925 3300009147 Bacteria 7209
199 Ga0114129_11785144 3300009147 Unclassified 748
200 Ga0105243_10224046 3300009148 Bacteria 1664
201 Ga0105243_10273105 3300009148 Bacteria 1519
202 Ga0105243_10453877 3300009148 Unclassified 1203
203 Ga0105243_10566886 3300009148 Bacteria 1088
204 Ga0105243_11004551 3300009148 Bacteria 837
205 Ga0105243_11559201 3300009148 Unclassified 686
206 Ga0105241_10152238 3300009174 Unclassified 1893
207 Ga0105241_11175396 3300009174 Unclassified 726
208 Ga0105241_11365238 3300009174 Unclassified 677
209 Ga0105241_11821902 3300009174 Bacteria 594
210 Ga0105242_10107173 3300009176 Unclassified 2376
211 Ga0105242_10304777 3300009176 Bacteria 1455
212 Ga0105242_11040346 3300009176 Unclassified 829
213 Ga0105248_10005524 3300009177 Bacteria 13885
214 Ga0105248_10185682 3300009177 Unclassified 2343
215 Ga0105248_10257377 3300009177 Bacteria 1965
216 Ga0105248_10368050 3300009177 Bacteria 1618
217 Ga0105248_10406236 3300009177 Unclassified 1533
218 Ga0105248_10425362 3300009177 Unclassified 1496
219 Ga0105248_11599632 3300009177 Unclassified 738
220 Ga0105237_10001358 3300009545 Bacteria 32392
221 Ga0105237_10035758 3300009545 Bacteria 5025
222 Ga0105238_10015961 3300009551 Bacteria 7600
223 Ga0105238_10021887 3300009551 Bacteria 6513
224 Ga0105239_10314282 3300010375 Bacteria 1766
225 Ga0105239_10528710 3300010375 Bacteria 1342
226 Ga0105246_10449901 3300011119 Bacteria 1082
227 Ga0105246_10456109 3300011119 Bacteria 1075
228 Ga0157373_10004420 3300013100 Bacteria 10590
229 Ga0157371_10628792 3300013102 Unclassified 800
230 Ga0157378_10028938 3300013297 Bacteria 4891
231 Ga0157378_10101056 3300013297 Bacteria 2634
232 Ga0157378_10293840 3300013297 Bacteria 1570
233 Ga0157378_10591806 3300013297 Bacteria 1119
234 Ga0157378_11528663 3300013297 Unclassified 712
235 Ga0157372_10208005 3300013307 Bacteria 2267
236 Ga0157372_10773235 3300013307 Unclassified 1116
237 Ga0157372_11996283 3300013307 Bacteria 667
238 Ga0157375_10042530 3300013308 Bacteria 4398
239 Ga0157375_10593767 3300013308 Bacteria 1267
240 Ga0157375_10703505 3300013308 Bacteria 1164
241 Ga0163163_10862055 3300014325 Bacteria 969
242 Ga0163163_11910609 3300014325 Unclassified 654
243 Ga0157380_10029571 3300014326 Bacteria 4188
244 Ga0157380_10093564 3300014326 Bacteria 2485
245 Ga0157380_10213979 3300014326 Bacteria 1720
246 Ga0157380_10464031 3300014326 Unclassified 1220
247 Ga0157379_10755994 3300014968 Bacteria 915
248 Ga0163161_10039480 3300017792 Bacteria 3389
249 Ga0163161_10221444 3300017792 Bacteria 1465
250 Ga0207656_10002954 3300025321 Bacteria 5802
251 Ga0207653_10053089 3300025885 Bacteria 1353
252 Ga0207653_10284638 3300025885 Bacteria 639
253 Ga0207642_10664472 3300025899 Unclassified 654
254 Ga0207647_10034607 3300025904 Bacteria 3223
255 Ga0207645_10024795 3300025907 Bacteria 3885
256 Ga0207645_10037839 3300025907 Bacteria 3096
257 Ga0207645_10295337 3300025907 Bacteria 1078
258 Ga0207643_10006382 3300025908 Bacteria 6313
259 Ga0207643_10113006 3300025908 Bacteria 1602
260 Ga0207643_10381723 3300025908 Bacteria 888
261 Ga0207684_10082992 3300025910 Bacteria 2729
262 Ga0207684_10422655 3300025910 Unclassified 1145
263 Ga0207654_10032359 3300025911 Bacteria 2889
264 Ga0207654_10646758 3300025911 Unclassified 757
265 Ga0207707_10444675 3300025912 Bacteria 1109
266 Ga0207671_10002677 3300025914 Bacteria 18681
267 Ga0207671_11091189 3300025914 Bacteria 627
268 Ga0207660_10236474 3300025917 Bacteria 1438
269 Ga0207660_10348179 3300025917 Bacteria 1187
270 Ga0207660_10871340 3300025917 Bacteria 735
271 Ga0207662_10001249 3300025918 Bacteria 12225
272 Ga0207662_10003010 3300025918 Bacteria 8585
273 Ga0207662_10115439 3300025918 Bacteria 1678
274 Ga0207662_10196855 3300025918 Bacteria 1303
275 Ga0207662_10256433 3300025918 Bacteria 1150
276 Ga0207652_11251092 3300025921 Unclassified 644
277 Ga0207646_10076462 3300025922 Bacteria 2992
278 Ga0207646_10621692 3300025922 Bacteria 969
279 Ga0207681_10043396 3300025923 Bacteria 3009
280 Ga0207681_10086893 3300025923 Bacteria 2223
281 Ga0207681_10474408 3300025923 Bacteria 1021
282 Ga0207694_10343760 3300025924 Bacteria 1234
283 Ga0207650_10000022 3300025925 Bacteria 318878
284 Ga0207650_10073190 3300025925 Bacteria 2580
285 Ga0207650_11071817 3300025925 Unclassified 686
286 Ga0207644_10006155 3300025931 Bacteria 7823
287 Ga0207706_10993446 3300025933 Unclassified 705
288 Ga0207686_10696764 3300025934 Unclassified 807
289 Ga0207709_10337959 3300025935 Unclassified 1132
290 Ga0207709_10607362 3300025935 Unclassified 867
291 Ga0207709_10695227 3300025935 Bacteria 813
292 Ga0207709_11524113 3300025935 Unclassified 555
293 Ga0207670_10001276 3300025936 Bacteria 13298
294 Ga0207670_10849337 3300025936 Bacteria 763
295 Ga0207669_10328738 3300025937 Bacteria 1173
296 Ga0207704_10007143 3300025938 Bacteria 5256
297 Ga0207704_10740382 3300025938 Unclassified 817
298 Ga0207665_10046095 3300025939 Bacteria 2921
299 Ga0207691_10004188 3300025940 Bacteria 14005
300 Ga0207691_10132447 3300025940 Bacteria 2201
301 Ga0207711_10002754 3300025941 Bacteria 15490
302 Ga0207711_10166099 3300025941 Bacteria 2000
303 Ga0207711_10176924 3300025941 Unclassified 1939
304 Ga0207689_10063414 3300025942 Bacteria 3040
305 Ga0207689_10078793 3300025942 Bacteria 2708
306 Ga0207689_10423030 3300025942 Bacteria 1112
307 Ga0207689_10446520 3300025942 Bacteria 1081
308 Ga0207689_10595979 3300025942 Unclassified 929
309 Ga0207679_10241345 3300025945 Bacteria 1531
310 Ga0207712_10027637 3300025961 Bacteria 3789
311 Ga0207712_10028514 3300025961 Bacteria 3735
312 Ga0207712_10433263 3300025961 Bacteria 1112
313 Ga0207677_10111536 3300026023 Bacteria 2038
314 Ga0207677_10288729 3300026023 Unclassified 1350
315 Ga0207677_10356044 3300026023 Bacteria 1228
316 Ga0207703_10072031 3300026035 Bacteria 2856
317 Ga0207703_10133013 3300026035 Bacteria 2150
318 Ga0207703_10215900 3300026035 Unclassified 1713
319 Ga0207639_10102693 3300026041 Bacteria 2315
320 Ga0207708_10000475 3300026075 Bacteria 31007
321 Ga0207708_10030939 3300026075 Bacteria 4062
322 Ga0207708_10306370 3300026075 Bacteria 1293
323 Ga0207708_10417451 3300026075 Bacteria 1112
324 Ga0207641_10280705 3300026088 Bacteria 1566
325 Ga0207641_10715440 3300026088 Bacteria 987
326 Ga0207641_10735051 3300026088 Bacteria 973
327 Ga0207641_11218276 3300026088 Unclassified 752
328 Ga0207648_10041795 3300026089 Unclassified 4026
329 Ga0207648_10082598 3300026089 Bacteria 2802
330 Ga0207648_10119664 3300026089 Bacteria 2315
331 Ga0207676_10008123 3300026095 Bacteria 7459
332 Ga0207676_10011003 3300026095 Bacteria 6459
333 Ga0207676_10469351 3300026095 Unclassified 1190
334 Ga0207674_10157625 3300026116 Unclassified 2225
335 Ga0207674_10248271 3300026116 Bacteria 1726
336 Ga0207674_10451449 3300026116 Bacteria 1242
337 Ga0207674_10466900 3300026116 Bacteria 1220
338 Ga0207675_100006942 3300026118 Bacteria 10711
339 Ga0207675_100084156 3300026118 Bacteria 2985
340 Ga0207675_100087638 3300026118 Bacteria 2924
341 Ga0207675_100288957 3300026118 Bacteria 1595
342 Ga0207675_100293051 3300026118 Bacteria 1583
343 Ga0207698_10054989 3300026142 Bacteria 3065
344 Ga0268265_10259700 3300028380 Bacteria 1543
345 Ga0268265_10351774 3300028380 Bacteria 1346
346 Ga0268265_10460837 3300028380 Bacteria 1189
347 Ga0268264_10179387 3300028381 Bacteria 1922
348 Ga0268264_10271266 3300028381 Bacteria 1585
349 Ga0268264_10275358 3300028381 Unclassified 1574
350 Ga0268264_11033881 3300028381 Bacteria 829
351 Ga0268264_11332554 3300028381 Unclassified 728
352 Ga0265316_10159873 3300031344 Bacteria 1685
353 Ga0307408_100065079 3300031548 Unclassified 2673
354 Ga0307408_100072696 3300031548 Bacteria 2547
355 Ga0307408_100159617 3300031548 Bacteria 1789
356 Ga0265342_10060528 3300031712 Unclassified 2233
357 Ga0307405_10017732 3300031731 Bacteria 3914
358 Ga0307410_10366166 3300031852 Bacteria 1156
359 Ga0307406_10006255 3300031901 Bacteria 6559
360 Ga0307407_10204655 3300031903 Unclassified 1325
361 Ga0307412_10003227 3300031911 Bacteria 9071
362 Ga0307416_100004248 3300032002 Bacteria 8602
363 Ga0307416_100105066 3300032002 Unclassified 2471
364 Ga0307414_10004113 3300032004 Bacteria 7858
365 Ga0307411_10020301 3300032005 Bacteria 3860
366 Ga0307411_10215094 3300032005 Bacteria 1487
367 Ga0307415_100006333 3300032126 Bacteria 6371
368 Ga0307415_101559321 3300032126 Bacteria 633
369 Ga0373941_0141560 3300035115 Bacteria 875
370 Ga0373961_0239083 3300035241 Bacteria 653
371 Ga0373931_0036608 3300035691 Bacteria 2559
372 Ga0395905_0196154 3300037471 Bacteria 1893
373 Ga0439448_0023279 3300042005 Unclassified 1931
374 Ga0439455_0006309 3300042012 Unclassified 2456
375 Ga0450889_040123 3300042144 Unclassified 563
376 Ga0439458_0000766 3300042157 Bacteria 8238
377 Ga0451576_0372330 3300045051 Bacteria 1497
378 Ga0451576_0824825 3300045051 Bacteria 974
379 Ga0495598_0045919 3300046537 Bacteria 1296
380 Ga0496102_0053630 3300048905 Bacteria 3675
381 Ga0496103_0023046 3300048906 Unclassified 3753
382 Ga0496104_0040222 3300048907 Bacteria 4382
383 Ga0496108_0840234 3300048911 Bacteria 791
384 Ga0496110_0732950 3300048913 Bacteria 891
385 Ga0496112_0306934 3300048915 Unclassified 1532
386 Ga0496112_0823761 3300048915 Bacteria 852
387 Ga0501202_002560 3300049652 Bacteria 3063
388 Ga0501208_018252 3300049655 Unclassified 1115
389 Ga0501209_013252 3300049656 Unclassified 1780
390 Ga0501216_009044 3300049660 Bacteria 1582
391 Ga0501217_003672 3300049661 Unclassified 3114
392 Ga0501223_001550 3300049663 Bacteria 5300
393 Ga0501227_006913 3300049665 Bacteria 2433
394 Ga0501230_015713 3300049667 Unclassified 1261
395 Ga0501236_014795 3300049670 Unclassified 1085
396 Ga0501240_020438 3300049673 Unclassified 991
397 Ga0501257_054437 3300049686 Unclassified 1002
398 Ga0501221_005556 3300049704 Bacteria 2111
399 Ga0501225_0003305 3300049705 Bacteria 4916
400 Ga0501225_0021391 3300049705 Bacteria 1786
401 Ga0501234_016001 3300049707 Bacteria 1182
402 Ga0501273_001495 3300049770 Bacteria 2241
403 Ga0501273_003663 3300049770 Unclassified 1646
404 Ga0501204_007904 3300049850 Unclassified 1203
405 Ga0501212_003611 3300049851 Bacteria 1953
406 nmdc:mga05p37_74537_c1 3300050507 Unclassified 4177
407 nmdc:mga08y16_1702580_c1 3300050511 Unclassified 586
408 nmdc:mga0n895_545350_c1 3300050512 Bacteria 1166
409 nmdc:mga0rr50_53457_c1 3300050513 Bacteria 3005
410 nmdc:mga0a205_489882_c1 3300050515 Bacteria 1087
411 nmdc:mga0a205_535107_c1 3300050515 Bacteria 1027
412 Ga0373941_0040931
413 MBSR1b_contig_2105260
414 JGI24750J21931_1057874
415 JGI24751J29686_10000124
416 JGI25406J46586_10003601
417 Ga0065712_10067792
418 Ga0065715_10047735
419 Ga0065715_10090188
420 Ga0065715_10103260
421 Ga0065707_10343913
422 Ga0070676_10976103
423 Ga0070690_100001079
424 Ga0070670_100293788
425 Ga0068869_100047907
426 Ga0068869_100100294
427 Ga0068869_100254908
428 Ga0068869_100454727
429 Ga0068869_100769396
430 Ga0068869_101075949
431 Ga0070680_100040200
432 Ga0070680_100075339
433 Ga0070680_100279921
434 Ga0068868_100123914
435 Ga0068868_100377544
436 Ga0068868_100899820
437 Ga0070689_100005159
438 Ga0070689_100730209
439 Ga0070691_10699081
440 Ga0070687_100000973
441 Ga0070687_100110374
442 Ga0070687_100155672
443 Ga0070687_101005222
444 Ga0070692_10017835
445 Ga0070692_10025277
446 Ga0070692_10026801
447 Ga0070692_10177192
448 Ga0070692_10195683
449 Ga0070669_100014727
450 Ga0070669_100196561
451 Ga0070675_100017401
452 Ga0070671_100002297
453 Ga0070671_100042723
454 Ga0070674_100554126
455 Ga0070673_100030252
456 Ga0070673_100109848
457 Ga0070673_100204340
458 Ga0070688_100012128
459 Ga0070667_100045787
460 Ga0070667_101239657
461 Ga0070701_10047426
462 Ga0070701_10112606
463 Ga0070701_10169882
464 Ga0070701_10260200
465 Ga0070701_10684894
466 Ga0070705_100001506
467 Ga0070705_100047379
468 Ga0070705_100166836
469 Ga0070700_100000173
470 Ga0070700_100090466
471 Ga0070700_100466019
472 Ga0070694_100087439
473 Ga0070694_100110739
474 Ga0070694_100354514
475 Ga0070694_100458971
476 Ga0070694_100586162
477 Ga0070708_100049018
478 Ga0070678_100091922
479 Ga0070662_101229577
480 Ga0070681_10220028
481 Ga0068867_100686370
482 Ga0070685_10035744
483 Ga0070685_10136551
484 Ga0070706_100000300
485 Ga0070706_100155855
486 Ga0070706_100362949
487 Ga0070707_100003608
488 Ga0070707_100113530
489 Ga0070698_100026306
490 Ga0070698_100029215
491 Ga0070699_100381477
492 Ga0070679_100702236
493 Ga0070684_100115994
494 Ga0070697_100345340
495 Ga0070697_100511342
496 Ga0070697_101361880
497 Ga0068853_100031864
498 Ga0068853_100344797
499 Ga0068853_101174053
500 Ga0070672_100006583
501 Ga0070672_100217749
502 Ga0070672_100440547
503 Ga0070672_100463781
504 Ga0070686_100017735
505 Ga0070686_100042257
506 Ga0070686_100069209
507 Ga0070686_100413401
508 Ga0070686_100450194
509 Ga0070695_100053365
510 Ga0070695_100076097
511 Ga0070695_100094842
512 Ga0070695_100453097
513 Ga0070695_100706295
514 Ga0070696_100070091
515 Ga0070696_100137185
516 Ga0070696_100479293
517 Ga0070696_100852198
518 Ga0070693_100001493
519 Ga0070665_101372111
520 Ga0070704_100001705
521 Ga0070704_100033329
522 Ga0070704_100151491
523 Ga0070704_100292182
524 Ga0070704_100312336
525 Ga0070704_100395000
526 Ga0070704_100508321
527 Ga0070664_100243836
528 Ga0070664_101562965
529 Ga0068857_100288840
530 Ga0068857_100869190
531 Ga0068854_102025242
532 Ga0068856_100010070
533 Ga0070702_100000327
534 Ga0070702_100582454
535 Ga0070702_100621278
536 Ga0068852_100273261
537 Ga0068859_100003869
538 Ga0068859_100012775
539 Ga0068859_100020802
540 Ga0068859_100129178
541 Ga0068859_100224325
542 Ga0068859_100409705
543 Ga0068859_100486455
544 Ga0068859_101532634
545 Ga0068864_100004233
546 Ga0068864_100116563
547 Ga0068864_100272500
548 Ga0068864_100704711
549 Ga0068864_101459479
550 Ga0068861_100004957
551 Ga0068861_100025737
552 Ga0068861_100025845
553 Ga0068861_100208718
554 Ga0068861_100482757
555 Ga0068851_10005780
556 Ga0068870_10229536
557 Ga0068870_10487028
558 Ga0068863_100028818
559 Ga0068863_100089013
560 Ga0068863_100667315
561 Ga0068858_100049915
562 Ga0068858_100069506
563 Ga0068858_100147330
564 Ga0068858_100662506
565 Ga0068860_100154068
566 Ga0068860_100256301
567 Ga0068860_100355246
568 Ga0068860_100863431
569 Ga0068860_101114228
570 Ga0068860_101199220
571 Ga0068862_100031256
572 Ga0068862_100510301
573 Ga0068862_100865007
574 Ga0068862_101428361
575 Ga0070716_100016133
576 Ga0068871_100003839
577 Ga0068871_100312171
578 Ga0075428_101325337
579 Ga0075431_100469097
580 Ga0075431_100487588
581 Ga0075433_10004770
582 Ga0075433_10031289
583 Ga0075433_10437069
584 Ga0075433_10542336
585 Ga0075434_100183567
586 Ga0068865_100015094
587 Ga0068865_100693105
588 Ga0068865_100868639
589 Ga0068865_101082525
590 Ga0097620_100003869
591 Ga0097620_100012775
592 Ga0097620_100020801
593 Ga0097620_100129170
594 Ga0097620_100224323
595 Ga0097620_100409706
596 Ga0097620_100486431
597 Ga0097620_100880859
598 Ga0097620_101532184
599 Ga0105251_10264205
600 Ga0111539_10146536
601 Ga0111539_10199294
602 Ga0111539_10408841
603 Ga0111539_10438068
604 Ga0105245_10337533
605 Ga0105245_10594046
606 Ga0105245_11377400
607 Ga0105247_10543685
608 Ga0114129_10000991
609 Ga0114129_10033925
610 Ga0114129_11785144
611 Ga0105243_10224046
612 Ga0105243_10273105
613 Ga0105243_10453877
614 Ga0105243_10566886
615 Ga0105243_11004551
616 Ga0105243_11559201
617 Ga0105241_10152238
618 Ga0105241_11175396
619 Ga0105241_11365238
620 Ga0105241_11821902
621 Ga0105242_10107173
622 Ga0105242_10304777
623 Ga0105242_11040346
624 Ga0105248_10005524
625 Ga0105248_10185682
626 Ga0105248_10257377
627 Ga0105248_10368050
628 Ga0105248_10406236
629 Ga0105248_10425362
630 Ga0105248_11599632
631 Ga0105237_10001358
632 Ga0105237_10035758
633 Ga0105238_10015961
634 Ga0105238_10021887
635 Ga0105239_10314282
636 Ga0105239_10528710
637 Ga0105246_10449901
638 Ga0105246_10456109
639 Ga0157373_10004420
640 Ga0157371_10628792
641 Ga0157378_10028938
642 Ga0157378_10101056
643 Ga0157378_10293840
644 Ga0157378_10591806
645 Ga0157378_11528663
646 Ga0157372_10208005
647 Ga0157372_10773235
648 Ga0157372_11996283
649 Ga0157375_10042530
650 Ga0157375_10593767
651 Ga0157375_10703505
652 Ga0163163_10862055
653 Ga0163163_11910609
654 Ga0157380_10029571
655 Ga0157380_10093564
656 Ga0157380_10213979
657 Ga0157380_10464031
658 Ga0157379_10755994
659 Ga0163161_10039480
660 Ga0163161_10221444
661 Ga0207656_10002954
662 Ga0207653_10053089
663 Ga0207653_10284638
664 Ga0207642_10664472
665 Ga0207647_10034607
666 Ga0207645_10024795
667 Ga0207645_10037839
668 Ga0207645_10295337
669 Ga0207643_10006382
670 Ga0207643_10113006
671 Ga0207643_10381723
672 Ga0207684_10082992
673 Ga0207684_10422655
674 Ga0207654_10032359
675 Ga0207654_10646758
676 Ga0207707_10444675
677 Ga0207671_10002677
678 Ga0207671_11091189
679 Ga0207660_10236474
680 Ga0207660_10348179
681 Ga0207660_10871340
682 Ga0207662_10001249
683 Ga0207662_10003010
684 Ga0207662_10115439
685 Ga0207662_10196855
686 Ga0207662_10256433
687 Ga0207652_11251092
688 Ga0207646_10076462
689 Ga0207646_10621692
690 Ga0207681_10043396
691 Ga0207681_10086893
692 Ga0207681_10474408
693 Ga0207694_10343760
694 Ga0207650_10000022
695 Ga0207650_10073190
696 Ga0207650_11071817
697 Ga0207644_10006155
698 Ga0207706_10993446
699 Ga0207686_10696764
700 Ga0207709_10337959
701 Ga0207709_10607362
702 Ga0207709_10695227
703 Ga0207709_11524113
704 Ga0207670_10001276
705 Ga0207670_10849337
706 Ga0207669_10328738
707 Ga0207704_10007143
708 Ga0207704_10740382
709 Ga0207665_10046095
710 Ga0207691_10004188
711 Ga0207691_10132447
712 Ga0207711_10002754
713 Ga0207711_10166099
714 Ga0207711_10176924
715 Ga0207689_10063414
716 Ga0207689_10078793
717 Ga0207689_10423030
718 Ga0207689_10446520
719 Ga0207689_10595979
720 Ga0207679_10241345
721 Ga0207712_10027637
722 Ga0207712_10028514
723 Ga0207712_10433263
724 Ga0207677_10111536
725 Ga0207677_10288729
726 Ga0207677_10356044
727 Ga0207703_10072031
728 Ga0207703_10133013
729 Ga0207703_10215900
730 Ga0207639_10102693
731 Ga0207708_10000475
732 Ga0207708_10030939
733 Ga0207708_10306370
734 Ga0207708_10417451
735 Ga0207641_10280705
736 Ga0207641_10715440
737 Ga0207641_10735051
738 Ga0207641_11218276
739 Ga0207648_10041795
740 Ga0207648_10082598
741 Ga0207648_10119664
742 Ga0207676_10008123
743 Ga0207676_10011003
744 Ga0207676_10469351
745 Ga0207674_10157625
746 Ga0207674_10248271
747 Ga0207674_10451449
748 Ga0207674_10466900
749 Ga0207675_100006942
750 Ga0207675_100084156
751 Ga0207675_100087638
752 Ga0207675_100288957
753 Ga0207675_100293051
754 Ga0207698_10054989
755 Ga0268265_10259700
756 Ga0268265_10351774
757 Ga0268265_10460837
758 Ga0268264_10179387
759 Ga0268264_10271266
760 Ga0268264_10275358
761 Ga0268264_11033881
762 Ga0268264_11332554
763 Ga0265316_10159873
764 Ga0307408_100065079
765 Ga0307408_100072696
766 Ga0307408_100159617
767 Ga0265342_10060528
768 Ga0307405_10017732
769 Ga0307410_10366166
770 Ga0307406_10006255
771 Ga0307407_10204655
772 Ga0307412_10003227
773 Ga0307416_100004248
774 Ga0307416_100105066
775 Ga0307414_10004113
776 Ga0307411_10020301
777 Ga0307411_10215094
778 Ga0307415_100006333
779 Ga0307415_101559321
780 Ga0373941_0141560
781 Ga0373961_0239083
782 Ga0373931_0036608
783 Ga0395905_0196154
784 Ga0439448_0023279
785 Ga0439455_0006309
786 Ga0450889_040123
787 Ga0439458_0000766
788 Ga0451576_0372330
789 Ga0451576_0824825
790 Ga0495598_0045919
791 Ga0496102_0053630
792 Ga0496103_0023046
793 Ga0496104_0040222
794 Ga0496108_0840234
795 Ga0496110_0732950
796 Ga0496112_0306934
797 Ga0496112_0823761
798 Ga0501202_002560
799 Ga0501208_018252
800 Ga0501209_013252
801 Ga0501216_009044
802 Ga0501217_003672
803 Ga0501223_001550
804 Ga0501227_006913
805 Ga0501230_015713
806 Ga0501236_014795
807 Ga0501240_020438
808 Ga0501257_054437
809 Ga0501221_005556
810 Ga0501225_0003305
811 Ga0501225_0021391
812 Ga0501234_016001
813 Ga0501273_001495
814 Ga0501273_003663
815 Ga0501204_007904
816 Ga0501212_003611
817 nmdc:mga05p37_74537_c1
818 nmdc:mga08y16_1702580_c1
819 nmdc:mga0n895_545350_c1
820 nmdc:mga0rr50_53457_c1
821 nmdc:mga0a205_489882_c1
822 nmdc:mga0a205_535107_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01230

HIT

HIT domain

54

152

0.94

PF11969

DcpS_C

Scavenger mRNA decapping enzyme C-term binding

43

153

0.87

PF04677

CwfJ_C_1

Protein similar to CwfJ C-terminus 1

35

148

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6af2-assembly1.cif.gz_C crystal structure of n-terminus deletion mutant of mycobacterium avium diadenosine 5',5'''-p1,p4-tetraphosphate phosphorylase 0.8917 26 160
6af2-assembly1.cif.gz_B-2 crystal structure of n-terminus deletion mutant of mycobacterium avium diadenosine 5',5'''-p1,p4-tetraphosphate phosphorylase 0.8771 26 160
6af2-assembly1.cif.gz_A crystal structure of n-terminus deletion mutant of mycobacterium avium diadenosine 5',5'''-p1,p4-tetraphosphate phosphorylase 0.8637 36 160
3ano-assembly1.cif.gz_B-2 crystal structure of a novel diadenosine 5',5'''-p1,p4-tetraphosphate phosphorylase from mycobacterium tuberculosis h37rv 0.8517 20 160
3wo5-assembly1.cif.gz_B-2 crystal structure of s147q of rv2613c from mycobacterium tuberculosis 0.8512 20 160
ID Description Score Start End Superfamily
af_A0A140LH01_2_105_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9048 40 129 3.30.428.10
af_A0A1D8PKG2_1_175_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8779 40 133 3.30.428.10
1y23D01 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.874 23 132 3.30.428.10
af_P49775_3_108_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.871 40 133 3.30.428.10
3lb5A00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8349 41 161 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A0C1ZME6-F1-model_v4 HIT family hydrolase 0.9054 40 135 GO:0003677
GO:0005524
GO:0016887
AF-A0A537A0R5-F1-model_v4 HIT family protein 0.905 40 134 GO:0003824
AF-A0A150QN91-F1-model_v4 HIT domain-containing protein 0.9011 40 135 GO:0003824
AF-A0A2V7HZY6-F1-model_v4 HIT family protein 0.901 24 136 GO:0003824
AF-B8D1Y7-F1-model_v4 Histidine triad (HIT) protein 0.8988 23 135 GO:0003824

Map