F437527

General Info

Members Datasets Scaffolds Average Seq Length
411 219 822 100

Family's Representative Sequence

Representative Sequence 3300017792|Ga0163161_10003109|Ga0163161_100031094
Length 113
Sequence MIRYAHMMARKTSSFTQLVATFAALLAPAAAQAQAVVRDPAGSGPIVSALSWIQGTLLGNVATAVAVMAVAAVGFMMLTGRMNWRFGATVIVGCFVLFGAGAIVSGIQGAAVG

Samples

Sample ID Description Type Environment
1 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
139 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
140 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
141 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
142 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
143 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
146 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
147 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
148 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
149 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
150 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
151 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
152 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
153 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
154 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
155 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
156 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
157 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
158 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
159 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
160 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
161 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
162 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
163 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
164 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
165 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
166 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
181 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
182 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
183 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
185 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
186 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
187 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
188 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
189 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
190 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
191 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
192 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
193 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
194 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
195 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
196 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
197 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
198 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
199 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
200 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
201 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
204 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
205 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
206 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
207 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
208 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
209 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
210 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
211 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
212 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
213 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
214 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
215 2643221640 Caulobacter sp. Root342 Isolate Unclassified
216 2643221642 Caulobacter sp. Root343 Isolate Unclassified
217 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
218 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
219 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.81
Metatranscriptomes 0.49
Isolates 1.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.41
Nodule 0
Rhizoplane 7.54
Rhizosphere 85.89
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163161_10003109 3300017792 Bacteria 11706
2 JGI24740J21852_10167468 3300001979 Bacteria 545
3 JGI24739J22299_10025828 3300001989 Bacteria 2064
4 JGI24737J22298_10132706 3300001990 Bacteria 736
5 Ga0065707_10084425 3300005295 Bacteria 7214
6 Ga0070658_10000527 3300005327 Bacteria 33153
7 Ga0070658_10004471 3300005327 Bacteria 11386
8 Ga0070658_10170187 3300005327 Bacteria 1830
9 Ga0070658_11959602 3300005327 Bacteria 506
10 Ga0070690_100001298 3300005330 Bacteria 12986
11 Ga0070670_100102115 3300005331 Bacteria 2470
12 Ga0070670_100179352 3300005331 Bacteria 1839
13 Ga0070670_100472564 3300005331 Bacteria 1113
14 Ga0070677_10456473 3300005333 Bacteria 685
15 Ga0068869_100221876 3300005334 Bacteria 1499
16 Ga0068869_101458324 3300005334 Bacteria 607
17 Ga0070666_10008876 3300005335 Bacteria 6250
18 Ga0070666_10076417 3300005335 Bacteria 2284
19 Ga0070666_10780707 3300005335 Bacteria 703
20 Ga0068868_100021042 3300005338 Bacteria 4911
21 Ga0068868_100328970 3300005338 Bacteria 1304
22 Ga0068868_102437118 3300005338 Bacteria 500
23 Ga0070660_100002422 3300005339 Bacteria 12821
24 Ga0070660_100006995 3300005339 Bacteria 7831
25 Ga0070660_100007656 3300005339 Bacteria 7526
26 Ga0070660_100167038 3300005339 Bacteria 1776
27 Ga0070661_100019466 3300005344 Bacteria 4838
28 Ga0070668_100087794 3300005347 Bacteria 2447
29 Ga0070668_100498632 3300005347 Bacteria 1054
30 Ga0070668_101069754 3300005347 Bacteria 727
31 Ga0070669_100000157 3300005353 Bacteria 61394
32 Ga0070669_100196021 3300005353 Bacteria 1587
33 Ga0070669_100325089 3300005353 Bacteria 1243
34 Ga0070675_100188972 3300005354 Bacteria 1784
35 Ga0070675_100280169 3300005354 Bacteria 1465
36 Ga0070671_100000003 3300005355 Bacteria 270186
37 Ga0070671_100024825 3300005355 Bacteria 4911
38 Ga0070671_100553038 3300005355 Bacteria 992
39 Ga0070671_101423733 3300005355 Bacteria 612
40 Ga0070674_100008555 3300005356 Bacteria 6102
41 Ga0070673_100000518 3300005364 Bacteria 20675
42 Ga0070673_100012870 3300005364 Bacteria 5761
43 Ga0070673_100146167 3300005364 Bacteria 1998
44 Ga0070659_100008766 3300005366 Bacteria 7403
45 Ga0070659_100581534 3300005366 Bacteria 961
46 Ga0070659_101317784 3300005366 Bacteria 641
47 Ga0070667_100007167 3300005367 Bacteria 9264
48 Ga0070667_100167561 3300005367 Bacteria 1938
49 Ga0070708_100757286 3300005445 Bacteria 913
50 Ga0070663_100018632 3300005455 Bacteria 4556
51 Ga0070663_100030929 3300005455 Bacteria 3673
52 Ga0070663_100150124 3300005455 Bacteria 1786
53 Ga0070678_100006694 3300005456 Bacteria 6785
54 Ga0070678_100119013 3300005456 Bacteria 2080
55 Ga0070662_100003944 3300005457 Bacteria 9304
56 Ga0070662_100415008 3300005457 Bacteria 1113
57 Ga0068867_100003690 3300005459 Bacteria 10771
58 Ga0070685_11615228 3300005466 Bacteria 502
59 Ga0070679_100479804 3300005530 Bacteria 1187
60 Ga0068853_100061364 3300005539 Bacteria 3252
61 Ga0070672_100017688 3300005543 Bacteria 5136
62 Ga0070672_100194937 3300005543 Bacteria 1692
63 Ga0070686_100003020 3300005544 Bacteria 9226
64 Ga0070665_100011161 3300005548 Bacteria 9081
65 Ga0070665_100029391 3300005548 Bacteria 5531
66 Ga0070665_100036454 3300005548 Bacteria 4947
67 Ga0068855_100012685 3300005563 Bacteria 10169
68 Ga0068855_100514020 3300005563 Bacteria 1300
69 Ga0068855_101607469 3300005563 Bacteria 665
70 Ga0070664_100020553 3300005564 Bacteria 5436
71 Ga0070664_100430302 3300005564 Bacteria 1210
72 Ga0068857_100373643 3300005577 Bacteria 1323
73 Ga0068854_100033510 3300005578 Bacteria 3582
74 Ga0068854_100172576 3300005578 Bacteria 1684
75 Ga0068856_100036298 3300005614 Bacteria 4832
76 Ga0068856_100198936 3300005614 Bacteria 2018
77 Ga0068852_100002608 3300005616 Bacteria 12454
78 Ga0068852_100044210 3300005616 Bacteria 3781
79 Ga0068852_100282394 3300005616 Bacteria 1601
80 Ga0068859_100014851 3300005617 Bacteria 7820
81 Ga0068859_100349193 3300005617 Bacteria 1574
82 Ga0068859_100982000 3300005617 Bacteria 927
83 Ga0068864_100014917 3300005618 Bacteria 6456
84 Ga0068864_101657002 3300005618 Bacteria 644
85 Ga0068866_10005853 3300005718 Bacteria 5105
86 Ga0068851_10002874 3300005834 Bacteria 7607
87 Ga0068851_10311507 3300005834 Bacteria 907
88 Ga0068863_100008141 3300005841 Bacteria 10235
89 Ga0068863_100533225 3300005841 Bacteria 1158
90 Ga0068863_101085069 3300005841 Bacteria 805
91 Ga0068858_100000610 3300005842 Bacteria 37368
92 Ga0068858_100031702 3300005842 Bacteria 4911
93 Ga0068860_100014581 3300005843 Bacteria 7690
94 Ga0068860_100024486 3300005843 Bacteria 5831
95 Ga0068860_100594819 3300005843 Bacteria 1111
96 Ga0075364_10009290 3300006051 Bacteria 5893
97 Ga0075432_10271630 3300006058 Bacteria 695
98 Ga0075362_10071721 3300006177 Bacteria 1583
99 Ga0097621_100009044 3300006237 Bacteria 7215
100 Ga0097621_102249044 3300006237 Bacteria 522
101 Ga0075370_10092810 3300006353 Bacteria 1742
102 Ga0068871_100023371 3300006358 Bacteria 4780
103 Ga0068865_100027615 3300006881 Bacteria 3750
104 Ga0068865_101932620 3300006881 Bacteria 535
105 Ga0097620_100014851 3300006931 Bacteria 7820
106 Ga0097620_100349227 3300006931 Bacteria 1574
107 Ga0097620_100982125 3300006931 Bacteria 927
108 Ga0105251_10175796 3300009011 Bacteria 964
109 Ga0105240_10226332 3300009093 Bacteria 2176
110 Ga0105240_10327878 3300009093 Bacteria 1743
111 Ga0105245_10003962 3300009098 Bacteria 13159
112 Ga0105245_10010776 3300009098 Bacteria 7956
113 Ga0105245_12031000 3300009098 Bacteria 628
114 Ga0105247_10397862 3300009101 Bacteria 981
115 Ga0105243_10013818 3300009148 Bacteria 6110
116 Ga0105241_10905232 3300009174 Bacteria 819
117 Ga0105242_10006531 3300009176 Bacteria 8977
118 Ga0105248_10007659 3300009177 Bacteria 11865
119 Ga0105248_10023201 3300009177 Bacteria 6890
120 Ga0105248_10143867 3300009177 Bacteria 2690
121 Ga0105248_10445927 3300009177 Bacteria 1458
122 Ga0105238_10002340 3300009551 Bacteria 19060
123 Ga0105239_10095637 3300010375 Bacteria 3281
124 Ga0105246_11520407 3300011119 Bacteria 629
125 Ga0157373_10011937 3300013100 Bacteria 6383
126 Ga0157371_10040387 3300013102 Bacteria 3332
127 Ga0157374_10012308 3300013296 Bacteria 7443
128 Ga0157374_10014204 3300013296 Bacteria 6962
129 Ga0157374_11752649 3300013296 Bacteria 646
130 Ga0157378_11834943 3300013297 Bacteria 655
131 Ga0163162_10057598 3300013306 Bacteria 3914
132 Ga0163162_10069791 3300013306 Bacteria 3566
133 Ga0163162_10250022 3300013306 Bacteria 1905
134 Ga0163162_10923902 3300013306 Bacteria 985
135 Ga0157372_10885936 3300013307 Bacteria 1036
136 Ga0157372_11774447 3300013307 Bacteria 710
137 Ga0157375_10011274 3300013308 Bacteria 7890
138 Ga0157380_12805830 3300014326 Bacteria 554
139 Ga0157377_10077101 3300014745 Bacteria 1940
140 Ga0157377_10425538 3300014745 Bacteria 910
141 Ga0157379_10008538 3300014968 Bacteria 8912
142 Ga0157379_10513439 3300014968 Bacteria 1112
143 Ga0157379_11402638 3300014968 Bacteria 677
144 Ga0157376_10012204 3300014969 Bacteria 6368
145 Ga0157376_10081403 3300014969 Bacteria 2780
146 Ga0163161_10211792 3300017792 Bacteria 1497
147 Ga0163161_10602643 3300017792 Bacteria 906
148 Ga0206354_10895363 3300020081 Bacteria 609
149 Ga0213876_10019936 3300021384 Bacteria 3542
150 Ga0207697_10024148 3300025315 Bacteria 2490
151 Ga0207697_10185275 3300025315 Bacteria 913
152 Ga0207656_10018940 3300025321 Bacteria 2717
153 Ga0207682_10341599 3300025893 Bacteria 705
154 Ga0207642_10045749 3300025899 Bacteria 1945
155 Ga0207680_10002414 3300025903 Bacteria 8715
156 Ga0207680_10223362 3300025903 Bacteria 1292
157 Ga0207680_10476361 3300025903 Bacteria 888
158 Ga0207705_10000071 3300025909 Bacteria 128862
159 Ga0207705_10005684 3300025909 Bacteria 9313
160 Ga0207705_10021254 3300025909 Bacteria 4629
161 Ga0207705_10100782 3300025909 Bacteria 2124
162 Ga0207695_10688251 3300025913 Bacteria 903
163 Ga0207657_10000673 3300025919 Bacteria 36391
164 Ga0207657_10001759 3300025919 Bacteria 23391
165 Ga0207657_10036970 3300025919 Bacteria 4366
166 Ga0207657_10113305 3300025919 Bacteria 2237
167 Ga0207649_10029091 3300025920 Bacteria 3260
168 Ga0207649_10033131 3300025920 Bacteria 3085
169 Ga0207649_10254521 3300025920 Bacteria 1266
170 Ga0207652_10368365 3300025921 Bacteria 1297
171 Ga0207681_10000200 3300025923 Bacteria 47761
172 Ga0207681_10046413 3300025923 Bacteria 2922
173 Ga0207681_10555280 3300025923 Bacteria 945
174 Ga0207694_10017819 3300025924 Bacteria 5367
175 Ga0207650_10118225 3300025925 Bacteria 2060
176 Ga0207650_10521471 3300025925 Bacteria 994
177 Ga0207659_10172935 3300025926 Bacteria 1705
178 Ga0207659_10268527 3300025926 Bacteria 1391
179 Ga0207687_10010086 3300025927 Bacteria 6178
180 Ga0207687_10137283 3300025927 Bacteria 1851
181 Ga0207664_10685886 3300025929 Bacteria 921
182 Ga0207644_10000004 3300025931 Bacteria 566613
183 Ga0207644_10000784 3300025931 Bacteria 20158
184 Ga0207644_10380857 3300025931 Bacteria 1150
185 Ga0207644_10520672 3300025931 Bacteria 982
186 Ga0207644_10842473 3300025931 Bacteria 768
187 Ga0207690_10077469 3300025932 Bacteria 2311
188 Ga0207690_10357790 3300025932 Bacteria 1156
189 Ga0207706_10002224 3300025933 Bacteria 18936
190 Ga0207706_10061296 3300025933 Bacteria 3312
191 Ga0207706_10196365 3300025933 Bacteria 1770
192 Ga0207706_10301102 3300025933 Bacteria 1397
193 Ga0207706_10368353 3300025933 Bacteria 1248
194 Ga0207686_10125975 3300025934 Bacteria 1750
195 Ga0207709_10007972 3300025935 Bacteria 5867
196 Ga0207669_10175984 3300025937 Bacteria 1528
197 Ga0207669_10249091 3300025937 Bacteria 1322
198 Ga0207704_10002737 3300025938 Bacteria 7951
199 Ga0207704_11243301 3300025938 Bacteria 636
200 Ga0207691_10061191 3300025940 Bacteria 3420
201 Ga0207691_10685770 3300025940 Bacteria 864
202 Ga0207711_10014405 3300025941 Bacteria 6566
203 Ga0207711_10037616 3300025941 Bacteria 4112
204 Ga0207711_10468323 3300025941 Bacteria 1173
205 Ga0207679_10007147 3300025945 Bacteria 7070
206 Ga0207679_10398007 3300025945 Bacteria 1211
207 Ga0207667_10043709 3300025949 Bacteria 4753
208 Ga0207667_10703461 3300025949 Bacteria 1013
209 Ga0207651_10001331 3300025960 Bacteria 11157
210 Ga0207651_10007394 3300025960 Bacteria 5850
211 Ga0207651_10443893 3300025960 Bacteria 1112
212 Ga0207668_10432740 3300025972 Bacteria 1119
213 Ga0207668_10516592 3300025972 Bacteria 1030
214 Ga0207668_10590639 3300025972 Bacteria 966
215 Ga0207668_10806196 3300025972 Bacteria 831
216 Ga0207640_10052215 3300025981 Bacteria 2662
217 Ga0207640_10152577 3300025981 Bacteria 1699
218 Ga0207658_10447325 3300025986 Bacteria 1143
219 Ga0207677_10002251 3300026023 Bacteria 10126
220 Ga0207677_10103799 3300026023 Bacteria 2099
221 Ga0207677_10356849 3300026023 Bacteria 1227
222 Ga0207677_10610848 3300026023 Bacteria 958
223 Ga0207677_12087047 3300026023 Bacteria 527
224 Ga0207703_10001161 3300026035 Bacteria 24840
225 Ga0207703_10002360 3300026035 Bacteria 16431
226 Ga0207639_10298276 3300026041 Bacteria 1424
227 Ga0207639_10429814 3300026041 Bacteria 1195
228 Ga0207678_10031849 3300026067 Bacteria 4598
229 Ga0207678_10049006 3300026067 Bacteria 3650
230 Ga0207678_10064927 3300026067 Bacteria 3136
231 Ga0207678_10941977 3300026067 Bacteria 764
232 Ga0207702_10097515 3300026078 Bacteria 2587
233 Ga0207702_11010543 3300026078 Bacteria 825
234 Ga0207702_11575001 3300026078 Bacteria 650
235 Ga0207641_10025107 3300026088 Bacteria 4912
236 Ga0207641_10617689 3300026088 Bacteria 1062
237 Ga0207641_10806412 3300026088 Bacteria 929
238 Ga0207648_10005776 3300026089 Bacteria 12393
239 Ga0207648_10056531 3300026089 Bacteria 3424
240 Ga0207676_10053812 3300026095 Bacteria 3151
241 Ga0207674_10336473 3300026116 Bacteria 1459
242 Ga0207675_100564928 3300026118 Bacteria 1138
243 Ga0207675_101631564 3300026118 Bacteria 665
244 Ga0207683_10003798 3300026121 Bacteria 13082
245 Ga0207683_10055737 3300026121 Bacteria 3467
246 Ga0207698_10000948 3300026142 Bacteria 16856
247 Ga0207698_10057634 3300026142 Bacteria 3007
248 Ga0207698_10158712 3300026142 Bacteria 1975
249 Ga0207428_10042305 3300027907 Bacteria 3684
250 Ga0268266_10088238 3300028379 Bacteria 2714
251 Ga0268266_10089665 3300028379 Bacteria 2693
252 Ga0268266_10125831 3300028379 Bacteria 2287
253 Ga0268265_10430323 3300028380 Bacteria 1228
254 Ga0268264_10001689 3300028381 Bacteria 20358
255 Ga0307408_100039054 3300031548 Bacteria 3352
256 Ga0307408_100149639 3300031548 Bacteria 1841
257 Ga0307408_100655137 3300031548 Bacteria 939
258 Ga0307405_10040261 3300031731 Bacteria 2829
259 Ga0307405_10110375 3300031731 Bacteria 1862
260 Ga0307405_10117162 3300031731 Bacteria 1815
261 Ga0307413_10035066 3300031824 Bacteria 2874
262 Ga0307413_10045254 3300031824 Bacteria 2607
263 Ga0307413_10076063 3300031824 Bacteria 2133
264 Ga0307413_10563488 3300031824 Bacteria 926
265 Ga0307410_10018713 3300031852 Bacteria 4191
266 Ga0307410_10036452 3300031852 Bacteria 3202
267 Ga0307410_10038846 3300031852 Bacteria 3121
268 Ga0307406_10010796 3300031901 Bacteria 5160
269 Ga0307406_10526889 3300031901 Bacteria 962
270 Ga0307407_10017409 3300031903 Bacteria 3605
271 Ga0307407_10069663 3300031903 Bacteria 2088
272 Ga0307407_10201956 3300031903 Bacteria 1333
273 Ga0307407_10769469 3300031903 Bacteria 730
274 Ga0307412_10105087 3300031911 Bacteria 2005
275 Ga0307412_10192764 3300031911 Bacteria 1542
276 Ga0307412_10199741 3300031911 Bacteria 1517
277 Ga0307412_11523163 3300031911 Bacteria 608
278 Ga0307412_12020755 3300031911 Bacteria 534
279 Ga0307412_12195438 3300031911 Bacteria 514
280 Ga0307409_100203175 3300031995 Bacteria 1774
281 Ga0307409_100406721 3300031995 Bacteria 1302
282 Ga0307409_100925669 3300031995 Bacteria 886
283 Ga0307409_101079981 3300031995 Bacteria 823
284 Ga0307409_101165836 3300031995 Bacteria 793
285 Ga0307416_100021223 3300032002 Bacteria 4657
286 Ga0307416_100149298 3300032002 Bacteria 2140
287 Ga0307416_101135271 3300032002 Bacteria 886
288 Ga0307416_102950427 3300032002 Bacteria 569
289 Ga0307414_10021764 3300032004 Bacteria 4032
290 Ga0307414_10183240 3300032004 Bacteria 1686
291 Ga0307414_10219623 3300032004 Bacteria 1559
292 Ga0307414_10420493 3300032004 Bacteria 1165
293 Ga0307414_10524125 3300032004 Bacteria 1052
294 Ga0307414_10561032 3300032004 Bacteria 1019
295 Ga0307414_10685521 3300032004 Bacteria 926
296 Ga0307414_10704186 3300032004 Bacteria 914
297 Ga0307414_11384528 3300032004 Bacteria 653
298 Ga0307411_10029277 3300032005 Bacteria 3360
299 Ga0307411_10092376 3300032005 Bacteria 2116
300 Ga0307411_10094669 3300032005 Bacteria 2094
301 Ga0307411_10132123 3300032005 Bacteria 1826
302 Ga0307415_100001996 3300032126 Bacteria 10039
303 Ga0307415_100016457 3300032126 Bacteria 4410
304 Ga0307415_100101968 3300032126 Bacteria 2107
305 Ga0307415_100604364 3300032126 Bacteria 976
306 Ga0307415_100737842 3300032126 Bacteria 893
307 Ga0307415_100917696 3300032126 Bacteria 808
308 Ga0316583_10290252 3300032133 Bacteria 566
309 Ga0373936_0023753 3300035113 Bacteria 2391
310 Ga0373960_0016347 3300035121 Bacteria 1907
311 Ga0373942_0014679 3300035207 Bacteria 1900
312 Ga0373961_0356268 3300035241 Bacteria 553
313 Ga0373931_1001451 3300035691 Bacteria 565
314 Ga0436365_0092728 3300039437 Bacteria 6719
315 Ga0439465_0061186 3300041413 Bacteria 1248
316 Ga0451791_0709300 3300041451 Bacteria 804
317 Ga0451800_1176597 3300041459 Bacteria 520
318 Ga0451849_1010241 3300041505 Bacteria 632
319 Ga0451843_0993660 3300041509 Bacteria 1339
320 Ga0451853_1177481 3300041512 Bacteria 840
321 Ga0439432_038396 3300042006 Bacteria 1525
322 Ga0450898_049615 3300042134 Bacteria 809
323 Ga0466972_0236666 3300044658 Bacteria 854
324 Ga0453683_0718668 3300044673 Bacteria 655
325 Ga0495650_0133572 3300046471 Bacteria 903
326 Ga0495583_0406244 3300046506 Bacteria 535
327 Ga0495643_0035446 3300046522 Bacteria 2748
328 Ga0495643_0134211 3300046522 Bacteria 1240
329 Ga0495663_0138828 3300046525 Bacteria 824
330 Ga0495598_0030641 3300046537 Bacteria 1508
331 Ga0495621_0003928 3300046539 Bacteria 4133
332 Ga0495633_0033537 3300046558 Bacteria 2476
333 Ga0495625_0159761 3300046660 Bacteria 1510
334 Ga0495669_0208179 3300046684 Bacteria 936
335 Ga0495670_0103336 3300046691 Bacteria 1469
336 Ga0495589_0400974 3300046794 Plasmid 630
337 Ga0496100_0012002 3300048903 Bacteria 4951
338 Ga0496100_0275916 3300048903 Bacteria 1252
339 Ga0496101_0002646 3300048904 Bacteria 10997
340 Ga0496101_0241425 3300048904 Bacteria 1406
341 Ga0496102_0015870 3300048905 Bacteria 6569
342 Ga0496102_0064975 3300048905 Bacteria 3343
343 Ga0496102_0434497 3300048905 Bacteria 1232
344 Ga0496102_1089450 3300048905 Bacteria 719
345 Ga0496103_0143782 3300048906 Bacteria 1526
346 Ga0496103_0394899 3300048906 Bacteria 888
347 Ga0496105_0009920 3300048908 Bacteria 7470
348 Ga0496105_0050928 3300048908 Bacteria 3421
349 Ga0496106_0019368 3300048909 Bacteria 5047
350 Ga0496107_0000488 3300048910 Bacteria 21814
351 Ga0496108_0004017 3300048911 Bacteria 11804
352 Ga0496109_0049988 3300048912 Bacteria 3808
353 Ga0496109_0206193 3300048912 Bacteria 1848
354 Ga0496109_1316276 3300048912 Bacteria 658
355 Ga0496110_0004428 3300048913 Bacteria 10884
356 Ga0496110_0068738 3300048913 Bacteria 3136
357 Ga0496111_0018487 3300048914 Bacteria 4829
358 Ga0496111_0205212 3300048914 Bacteria 1465
359 Ga0496112_0036229 3300048915 Bacteria 4811
360 Ga0496112_0061309 3300048915 Bacteria 3707
361 Ga0496113_0004184 3300048916 Bacteria 8816
362 Ga0496113_0043456 3300048916 Bacteria 3325
363 Ga0496114_0000006 3300048917 Bacteria 472921
364 Ga0496114_0083134 3300048917 Bacteria 2708
365 Ga0496114_0139540 3300048917 Bacteria 2097
366 Ga0496124_0037725 3300048927 Bacteria 4200
367 Ga0496125_0454941 3300048928 Bacteria 732
368 Ga0496126_0004719 3300048929 Bacteria 16082
369 Ga0496126_0268955 3300048929 Bacteria 1415
370 Ga0501317_064375 3300049533 Bacteria 607
371 Ga0501067_0111178 3300049583 Bacteria 1523
372 Ga0501069_0093745 3300049585 Bacteria 1699
373 Ga0501069_0576966 3300049585 Bacteria 674
374 Ga0501071_0661756 3300049587 Bacteria 804
375 Ga0501217_140944 3300049661 Bacteria 714
376 Ga0501217_305365 3300049661 Bacteria 526
377 Ga0501230_007311 3300049667 Bacteria 1634
378 Ga0501235_036770 3300049669 Bacteria 1114
379 Ga0501243_085646 3300049675 Bacteria 619
380 Ga0501249_063950 3300049679 Bacteria 854
381 Ga0501253_018412 3300049683 Bacteria 1192
382 Ga0501257_112796 3300049686 Bacteria 722
383 Ga0501258_054506 3300049687 Bacteria 565
384 Ga0501081_0339131 3300049743 Bacteria 1107
385 Ga0501263_013134 3300049760 Bacteria 1046
386 Ga0501267_041932 3300049764 Bacteria 573
387 Ga0501268_021433 3300049765 Bacteria 1109
388 Ga0501268_039797 3300049765 Bacteria 881
389 Ga0501270_015349 3300049767 Bacteria 1092
390 Ga0501270_039089 3300049767 Bacteria 819
391 Ga0501272_003822 3300049769 Bacteria 1547
392 Ga0501273_020736 3300049770 Bacteria 889
393 Ga0501044_0003420 3300049823 Bacteria 17889
394 nmdc:mga03683_3489_c1 3300050489 Bacteria 5085
395 nmdc:mga00v17_5400_c2 3300050491 Bacteria 5825
396 nmdc:mga07m45_20011_c1 3300050496 Bacteria 3632
397 nmdc:mga07m45_447261_c1 3300050496 Bacteria 749
398 nmdc:mga0sz30_4340_c2 3300050516 Bacteria 3960
399 Ga0500641_0391832 3300053096 Bacteria 548
400 Ga0500593_126075 3300053117 Bacteria 1030
401 Ga0500594_0030047 3300053118 Bacteria 1425
402 Ga0500642_0420767 3300053130 Bacteria 579
403 Ga0500564_148155 3300053138 Bacteria 1002
404 Ga0500622_0023414 3300053156 Bacteria 3271
405 2587918669 2585428106 Bacteria 5179711
406 2643950916 2643221588 Bacteria 3692460
407 2644225315 2643221640 Bacteria 5258820
408 2644232623 2643221642 Bacteria 5357871
409 2895890767 2895880812 Bacteria 11255272
410 2896185737 2896184354 Bacteria 3258548
411 2896256265 2896253425 Bacteria 3418029
412 Ga0163161_10003109
413 JGI24740J21852_10167468
414 JGI24739J22299_10025828
415 JGI24737J22298_10132706
416 Ga0065707_10084425
417 Ga0070658_10000527
418 Ga0070658_10004471
419 Ga0070658_10170187
420 Ga0070658_11959602
421 Ga0070690_100001298
422 Ga0070670_100102115
423 Ga0070670_100179352
424 Ga0070670_100472564
425 Ga0070677_10456473
426 Ga0068869_100221876
427 Ga0068869_101458324
428 Ga0070666_10008876
429 Ga0070666_10076417
430 Ga0070666_10780707
431 Ga0068868_100021042
432 Ga0068868_100328970
433 Ga0068868_102437118
434 Ga0070660_100002422
435 Ga0070660_100006995
436 Ga0070660_100007656
437 Ga0070660_100167038
438 Ga0070661_100019466
439 Ga0070668_100087794
440 Ga0070668_100498632
441 Ga0070668_101069754
442 Ga0070669_100000157
443 Ga0070669_100196021
444 Ga0070669_100325089
445 Ga0070675_100188972
446 Ga0070675_100280169
447 Ga0070671_100000003
448 Ga0070671_100024825
449 Ga0070671_100553038
450 Ga0070671_101423733
451 Ga0070674_100008555
452 Ga0070673_100000518
453 Ga0070673_100012870
454 Ga0070673_100146167
455 Ga0070659_100008766
456 Ga0070659_100581534
457 Ga0070659_101317784
458 Ga0070667_100007167
459 Ga0070667_100167561
460 Ga0070708_100757286
461 Ga0070663_100018632
462 Ga0070663_100030929
463 Ga0070663_100150124
464 Ga0070678_100006694
465 Ga0070678_100119013
466 Ga0070662_100003944
467 Ga0070662_100415008
468 Ga0068867_100003690
469 Ga0070685_11615228
470 Ga0070679_100479804
471 Ga0068853_100061364
472 Ga0070672_100017688
473 Ga0070672_100194937
474 Ga0070686_100003020
475 Ga0070665_100011161
476 Ga0070665_100029391
477 Ga0070665_100036454
478 Ga0068855_100012685
479 Ga0068855_100514020
480 Ga0068855_101607469
481 Ga0070664_100020553
482 Ga0070664_100430302
483 Ga0068857_100373643
484 Ga0068854_100033510
485 Ga0068854_100172576
486 Ga0068856_100036298
487 Ga0068856_100198936
488 Ga0068852_100002608
489 Ga0068852_100044210
490 Ga0068852_100282394
491 Ga0068859_100014851
492 Ga0068859_100349193
493 Ga0068859_100982000
494 Ga0068864_100014917
495 Ga0068864_101657002
496 Ga0068866_10005853
497 Ga0068851_10002874
498 Ga0068851_10311507
499 Ga0068863_100008141
500 Ga0068863_100533225
501 Ga0068863_101085069
502 Ga0068858_100000610
503 Ga0068858_100031702
504 Ga0068860_100014581
505 Ga0068860_100024486
506 Ga0068860_100594819
507 Ga0075364_10009290
508 Ga0075432_10271630
509 Ga0075362_10071721
510 Ga0097621_100009044
511 Ga0097621_102249044
512 Ga0075370_10092810
513 Ga0068871_100023371
514 Ga0068865_100027615
515 Ga0068865_101932620
516 Ga0097620_100014851
517 Ga0097620_100349227
518 Ga0097620_100982125
519 Ga0105251_10175796
520 Ga0105240_10226332
521 Ga0105240_10327878
522 Ga0105245_10003962
523 Ga0105245_10010776
524 Ga0105245_12031000
525 Ga0105247_10397862
526 Ga0105243_10013818
527 Ga0105241_10905232
528 Ga0105242_10006531
529 Ga0105248_10007659
530 Ga0105248_10023201
531 Ga0105248_10143867
532 Ga0105248_10445927
533 Ga0105238_10002340
534 Ga0105239_10095637
535 Ga0105246_11520407
536 Ga0157373_10011937
537 Ga0157371_10040387
538 Ga0157374_10012308
539 Ga0157374_10014204
540 Ga0157374_11752649
541 Ga0157378_11834943
542 Ga0163162_10057598
543 Ga0163162_10069791
544 Ga0163162_10250022
545 Ga0163162_10923902
546 Ga0157372_10885936
547 Ga0157372_11774447
548 Ga0157375_10011274
549 Ga0157380_12805830
550 Ga0157377_10077101
551 Ga0157377_10425538
552 Ga0157379_10008538
553 Ga0157379_10513439
554 Ga0157379_11402638
555 Ga0157376_10012204
556 Ga0157376_10081403
557 Ga0163161_10211792
558 Ga0163161_10602643
559 Ga0206354_10895363
560 Ga0213876_10019936
561 Ga0207697_10024148
562 Ga0207697_10185275
563 Ga0207656_10018940
564 Ga0207682_10341599
565 Ga0207642_10045749
566 Ga0207680_10002414
567 Ga0207680_10223362
568 Ga0207680_10476361
569 Ga0207705_10000071
570 Ga0207705_10005684
571 Ga0207705_10021254
572 Ga0207705_10100782
573 Ga0207695_10688251
574 Ga0207657_10000673
575 Ga0207657_10001759
576 Ga0207657_10036970
577 Ga0207657_10113305
578 Ga0207649_10029091
579 Ga0207649_10033131
580 Ga0207649_10254521
581 Ga0207652_10368365
582 Ga0207681_10000200
583 Ga0207681_10046413
584 Ga0207681_10555280
585 Ga0207694_10017819
586 Ga0207650_10118225
587 Ga0207650_10521471
588 Ga0207659_10172935
589 Ga0207659_10268527
590 Ga0207687_10010086
591 Ga0207687_10137283
592 Ga0207664_10685886
593 Ga0207644_10000004
594 Ga0207644_10000784
595 Ga0207644_10380857
596 Ga0207644_10520672
597 Ga0207644_10842473
598 Ga0207690_10077469
599 Ga0207690_10357790
600 Ga0207706_10002224
601 Ga0207706_10061296
602 Ga0207706_10196365
603 Ga0207706_10301102
604 Ga0207706_10368353
605 Ga0207686_10125975
606 Ga0207709_10007972
607 Ga0207669_10175984
608 Ga0207669_10249091
609 Ga0207704_10002737
610 Ga0207704_11243301
611 Ga0207691_10061191
612 Ga0207691_10685770
613 Ga0207711_10014405
614 Ga0207711_10037616
615 Ga0207711_10468323
616 Ga0207679_10007147
617 Ga0207679_10398007
618 Ga0207667_10043709
619 Ga0207667_10703461
620 Ga0207651_10001331
621 Ga0207651_10007394
622 Ga0207651_10443893
623 Ga0207668_10432740
624 Ga0207668_10516592
625 Ga0207668_10590639
626 Ga0207668_10806196
627 Ga0207640_10052215
628 Ga0207640_10152577
629 Ga0207658_10447325
630 Ga0207677_10002251
631 Ga0207677_10103799
632 Ga0207677_10356849
633 Ga0207677_10610848
634 Ga0207677_12087047
635 Ga0207703_10001161
636 Ga0207703_10002360
637 Ga0207639_10298276
638 Ga0207639_10429814
639 Ga0207678_10031849
640 Ga0207678_10049006
641 Ga0207678_10064927
642 Ga0207678_10941977
643 Ga0207702_10097515
644 Ga0207702_11010543
645 Ga0207702_11575001
646 Ga0207641_10025107
647 Ga0207641_10617689
648 Ga0207641_10806412
649 Ga0207648_10005776
650 Ga0207648_10056531
651 Ga0207676_10053812
652 Ga0207674_10336473
653 Ga0207675_100564928
654 Ga0207675_101631564
655 Ga0207683_10003798
656 Ga0207683_10055737
657 Ga0207698_10000948
658 Ga0207698_10057634
659 Ga0207698_10158712
660 Ga0207428_10042305
661 Ga0268266_10088238
662 Ga0268266_10089665
663 Ga0268266_10125831
664 Ga0268265_10430323
665 Ga0268264_10001689
666 Ga0307408_100039054
667 Ga0307408_100149639
668 Ga0307408_100655137
669 Ga0307405_10040261
670 Ga0307405_10110375
671 Ga0307405_10117162
672 Ga0307413_10035066
673 Ga0307413_10045254
674 Ga0307413_10076063
675 Ga0307413_10563488
676 Ga0307410_10018713
677 Ga0307410_10036452
678 Ga0307410_10038846
679 Ga0307406_10010796
680 Ga0307406_10526889
681 Ga0307407_10017409
682 Ga0307407_10069663
683 Ga0307407_10201956
684 Ga0307407_10769469
685 Ga0307412_10105087
686 Ga0307412_10192764
687 Ga0307412_10199741
688 Ga0307412_11523163
689 Ga0307412_12020755
690 Ga0307412_12195438
691 Ga0307409_100203175
692 Ga0307409_100406721
693 Ga0307409_100925669
694 Ga0307409_101079981
695 Ga0307409_101165836
696 Ga0307416_100021223
697 Ga0307416_100149298
698 Ga0307416_101135271
699 Ga0307416_102950427
700 Ga0307414_10021764
701 Ga0307414_10183240
702 Ga0307414_10219623
703 Ga0307414_10420493
704 Ga0307414_10524125
705 Ga0307414_10561032
706 Ga0307414_10685521
707 Ga0307414_10704186
708 Ga0307414_11384528
709 Ga0307411_10029277
710 Ga0307411_10092376
711 Ga0307411_10094669
712 Ga0307411_10132123
713 Ga0307415_100001996
714 Ga0307415_100016457
715 Ga0307415_100101968
716 Ga0307415_100604364
717 Ga0307415_100737842
718 Ga0307415_100917696
719 Ga0316583_10290252
720 Ga0373936_0023753
721 Ga0373960_0016347
722 Ga0373942_0014679
723 Ga0373961_0356268
724 Ga0373931_1001451
725 Ga0436365_0092728
726 Ga0439465_0061186
727 Ga0451791_0709300
728 Ga0451800_1176597
729 Ga0451849_1010241
730 Ga0451843_0993660
731 Ga0451853_1177481
732 Ga0439432_038396
733 Ga0450898_049615
734 Ga0466972_0236666
735 Ga0453683_0718668
736 Ga0495650_0133572
737 Ga0495583_0406244
738 Ga0495643_0035446
739 Ga0495643_0134211
740 Ga0495663_0138828
741 Ga0495598_0030641
742 Ga0495621_0003928
743 Ga0495633_0033537
744 Ga0495625_0159761
745 Ga0495669_0208179
746 Ga0495670_0103336
747 Ga0495589_0400974
748 Ga0496100_0012002
749 Ga0496100_0275916
750 Ga0496101_0002646
751 Ga0496101_0241425
752 Ga0496102_0015870
753 Ga0496102_0064975
754 Ga0496102_0434497
755 Ga0496102_1089450
756 Ga0496103_0143782
757 Ga0496103_0394899
758 Ga0496105_0009920
759 Ga0496105_0050928
760 Ga0496106_0019368
761 Ga0496107_0000488
762 Ga0496108_0004017
763 Ga0496109_0049988
764 Ga0496109_0206193
765 Ga0496109_1316276
766 Ga0496110_0004428
767 Ga0496110_0068738
768 Ga0496111_0018487
769 Ga0496111_0205212
770 Ga0496112_0036229
771 Ga0496112_0061309
772 Ga0496113_0004184
773 Ga0496113_0043456
774 Ga0496114_0000006
775 Ga0496114_0083134
776 Ga0496114_0139540
777 Ga0496124_0037725
778 Ga0496125_0454941
779 Ga0496126_0004719
780 Ga0496126_0268955
781 Ga0501317_064375
782 Ga0501067_0111178
783 Ga0501069_0093745
784 Ga0501069_0576966
785 Ga0501071_0661756
786 Ga0501217_140944
787 Ga0501217_305365
788 Ga0501230_007311
789 Ga0501235_036770
790 Ga0501243_085646
791 Ga0501249_063950
792 Ga0501253_018412
793 Ga0501257_112796
794 Ga0501258_054506
795 Ga0501081_0339131
796 Ga0501263_013134
797 Ga0501267_041932
798 Ga0501268_021433
799 Ga0501268_039797
800 Ga0501270_015349
801 Ga0501270_039089
802 Ga0501272_003822
803 Ga0501273_020736
804 Ga0501044_0003420
805 nmdc:mga03683_3489_c1
806 nmdc:mga00v17_5400_c2
807 nmdc:mga07m45_20011_c1
808 nmdc:mga07m45_447261_c1
809 nmdc:mga0sz30_4340_c2
810 Ga0500641_0391832
811 Ga0500593_126075
812 Ga0500594_0030047
813 Ga0500642_0420767
814 Ga0500564_148155
815 Ga0500622_0023414
816 2587918669
817 2643950916
818 2644225315
819 2644232623
820 2895890767
821 2896185737
822 2896256265

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04956

TrbC

TrbC/VIRB2 pilin

1

107

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7oq4-assembly1.cif.gz_Q cryo-em structure of the atv rnap inhibitory protein (rip) bound to the dna-binding channel of the host's rna polymerase 0.8067 47 86
7oqy-assembly1.cif.gz_Q cryo-em structure of the cellular negative regulator tfs4 bound to the archaeal rna polymerase 0.7757 45 86
6n58-assembly1.cif.gz_J cryo-em structure of escherichia coli rnap polymerase bound with trar in conformation ii 0.7756 45 83
4yfn-assembly2.cif.gz_J escherichia coli rna polymerase in complex with squaramide compound 14 (n-[3,4-dioxo-2-(4-{[4-(trifluoromethyl)benzyl]amino}piperidin-1-yl)cyclobut-1-en-1-yl]-3,5-dimethyl-1,2-oxazole-4-sulfonamide) 0.7709 45 83
6o35-assembly1.cif.gz_C-2 crystal structure of a de novo designed octameric helical-bundle protein 0.7518 31 96
ID Description Score Start End Superfamily
2zttC00 Special;Helix non-globular;Helix Hairpins; 0.8936 52 82 6.10.140.720
af_A0A368UIC7_137_209_1.20.1160.11 Mainly Alpha;Up-down Bundle;Paired amphipathic helix 2 (pah2 repeat);Paired amphipathic helix 0.8834 50 80 1.20.1160.11
3a1gA00 Special;Helix non-globular;Helix Hairpins; 0.8759 52 82 6.10.140.720
af_A0A0N7KPP5_14_76_1.20.1160.11 Mainly Alpha;Up-down Bundle;Paired amphipathic helix 2 (pah2 repeat);Paired amphipathic helix 0.8635 52 80 1.20.1160.11
af_A0A0G2K3D4_749_890_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.8587 44 85 3.10.20.90
ID Description Score Start End GO Terms
AF-A0A2N5KQX5-F1-model_v4 Uncharacterized protein 0.8714 25 96
AF-A0A5E7G2Z1-F1-model_v4 RND efflux pump membrane fusion protein barrel-sandwich domain-containing protein 0.7023 20 96
AF-A0A858PX67-F1-model_v4 Uncharacterized protein 0.6632 16 95 GO:0016020
AF-A0A2N5KQX5-F1-model_v4 Uncharacterized protein 0.6569 25 96
AF-A0A3A8IUU0-F1-model_v4 HlyD family efflux transporter periplasmic adaptor subunit 0.6456 32 96 GO:0016020

Map