F437516

General Info

Members Datasets Scaffolds Average Seq Length
411 230 411 142

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10000109|Ga0157378_1000010970
Length 169
Sequence VPRLRGDRTNEFFRYDSPFTSPEEIMYDERIAGPMRAELTQLGFEETRTPQEVDAVLQEKKGTVLVVVNSVCGCAAGVARPAIAMALENEVRPDRMITVFAGNDREATQRAREYFVGYRPSSPSVALFRDGELVKMIERHQIEGRAAHDIASELAMSFNQFCAKEAAVQ

Samples

Sample ID Description Type Environment
1 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
95 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
145 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
149 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
150 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
151 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
152 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
153 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
154 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
155 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
156 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
157 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
160 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
161 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
162 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
163 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
164 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
165 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
166 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
167 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
168 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
169 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
170 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
171 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
172 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
173 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
174 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
175 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
176 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
180 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
181 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
182 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
183 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
184 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
185 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
186 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
187 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
188 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
189 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
190 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
193 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
194 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
195 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
212 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
215 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
216 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
217 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
218 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
224 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
225 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
226 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
227 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
228 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
229 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
230 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0.49
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.73
Nodule 0
Rhizoplane 5.84
Rhizosphere 89.78
Stem 0
Stem Tuber 0
Unclassified 3.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0032354_1144683 3300003693 Unclassified 791
2 Ga0058859_11303181 3300004798 Bacteria 593
3 Ga0065714_10343657 3300005288 Unclassified 599
4 Ga0065712_10000156 3300005290 Bacteria 37789
5 Ga0065715_10001125 3300005293 Bacteria 11430
6 Ga0065707_10279574 3300005295 Unclassified 1051
7 Ga0070683_100000085 3300005329 Bacteria 62547
8 Ga0070683_100562992 3300005329 Bacteria 1090
9 Ga0070690_100812417 3300005330 Bacteria 726
10 Ga0070670_100000080 3300005331 Bacteria 92128
11 Ga0070670_100126604 3300005331 Bacteria 2205
12 Ga0070670_100488956 3300005331 Bacteria 1093
13 Ga0068869_100016319 3300005334 Bacteria 5004
14 Ga0068869_101488389 3300005334 Archaea 601
15 Ga0070682_100116004 3300005337 Bacteria 1791
16 Ga0070682_100171549 3300005337 Unclassified 1508
17 Ga0070682_101749078 3300005337 Bacteria 541
18 Ga0068868_100000206 3300005338 Bacteria 39880
19 Ga0068868_100000862 3300005338 Bacteria 20527
20 Ga0068868_100406335 3300005338 Bacteria 1176
21 Ga0068868_101566197 3300005338 Bacteria 618
22 Ga0070689_100005284 3300005340 Bacteria 8799
23 Ga0070689_100897870 3300005340 Bacteria 784
24 Ga0070687_100003380 3300005343 Bacteria 6190
25 Ga0070687_100043337 3300005343 Bacteria 2286
26 Ga0070692_10079158 3300005345 Bacteria 1766
27 Ga0070668_100064955 3300005347 Bacteria 2830
28 Ga0070669_100176659 3300005353 Bacteria 1668
29 Ga0070675_100000013 3300005354 Bacteria 206266
30 Ga0070675_100069233 3300005354 Bacteria 2923
31 Ga0070675_100086765 3300005354 Bacteria 2616
32 Ga0070675_100665024 3300005354 Bacteria 947
33 Ga0070674_100439755 3300005356 Bacteria 1074
34 Ga0070674_102078861 3300005356 Bacteria 518
35 Ga0070673_100051252 3300005364 Bacteria 3231
36 Ga0070673_100227698 3300005364 Bacteria 1616
37 Ga0070673_101782269 3300005364 Bacteria 583
38 Ga0070688_100053051 3300005365 Bacteria 2535
39 Ga0070709_10894762 3300005434 Unclassified 702
40 Ga0070701_10009560 3300005438 Bacteria 4252
41 Ga0070705_100938138 3300005440 Unclassified 698
42 Ga0070708_100015602 3300005445 Bacteria 6278
43 Ga0070708_100073265 3300005445 Bacteria 3086
44 Ga0070708_100222534 3300005445 Bacteria 1770
45 Ga0070708_100659342 3300005445 Bacteria 986
46 Ga0070662_100442293 3300005457 Bacteria 1078
47 Ga0070681_10752944 3300005458 Unclassified 891
48 Ga0068867_100972963 3300005459 Bacteria 768
49 Ga0068867_101700035 3300005459 Bacteria 592
50 Ga0070685_10002070 3300005466 Bacteria 10371
51 Ga0070685_10024034 3300005466 Bacteria 3344
52 Ga0070706_100014732 3300005467 Bacteria 7224
53 Ga0070706_100018935 3300005467 Bacteria 6350
54 Ga0070707_100007053 3300005468 Bacteria 10419
55 Ga0070707_100063383 3300005468 Unclassified 3548
56 Ga0070707_100079882 3300005468 Bacteria 3157
57 Ga0070707_100173297 3300005468 Unclassified 2102
58 Ga0070698_100015507 3300005471 Bacteria 8049
59 Ga0070698_100550098 3300005471 Bacteria 1094
60 Ga0070698_100728233 3300005471 Bacteria 934
61 Ga0070698_100730260 3300005471 Unclassified 933
62 Ga0070698_101244174 3300005471 Unclassified 694
63 Ga0070699_100008724 3300005518 Bacteria 8787
64 Ga0070699_100238755 3300005518 Bacteria 1622
65 Ga0070699_100320362 3300005518 Bacteria 1393
66 Ga0070679_100330368 3300005530 Unclassified 1473
67 Ga0070684_100000071 3300005535 Bacteria 64721
68 Ga0070684_100892985 3300005535 Bacteria 832
69 Ga0070697_100025867 3300005536 Bacteria 4682
70 Ga0070697_101886363 3300005536 Unclassified 535
71 Ga0068853_100163206 3300005539 Bacteria 2012
72 Ga0068853_100347564 3300005539 Bacteria 1379
73 Ga0070672_100000375 3300005543 Bacteria 25879
74 Ga0070672_100013577 3300005543 Bacteria 5759
75 Ga0070686_100213321 3300005544 Bacteria 1391
76 Ga0070686_100354751 3300005544 Bacteria 1103
77 Ga0070696_100000071 3300005546 Bacteria 49495
78 Ga0070696_100392347 3300005546 Unclassified 1084
79 Ga0070665_100035594 3300005548 Bacteria 5007
80 Ga0070704_100660590 3300005549 Unclassified 924
81 Ga0070704_100972086 3300005549 Bacteria 767
82 Ga0070704_101087922 3300005549 Bacteria 726
83 Ga0068857_100252514 3300005577 Bacteria 1617
84 Ga0068857_101687147 3300005577 Unclassified 619
85 Ga0068854_100010306 3300005578 Bacteria 6057
86 Ga0068854_100272828 3300005578 Bacteria 1359
87 Ga0068854_100319163 3300005578 Bacteria 1262
88 Ga0070702_100194536 3300005615 Bacteria 1337
89 Ga0070702_100651454 3300005615 Unclassified 796
90 Ga0068852_100506326 3300005616 Bacteria 1203
91 Ga0068859_101393538 3300005617 Bacteria 773
92 Ga0068864_100000026 3300005618 Bacteria 243111
93 Ga0068864_100082030 3300005618 Bacteria 2829
94 Ga0068864_101055208 3300005618 Unclassified 807
95 Ga0068861_100085635 3300005719 Bacteria 2476
96 Ga0068863_100110013 3300005841 Bacteria 2623
97 Ga0068863_100134029 3300005841 Bacteria 2366
98 Ga0068858_100003230 3300005842 Bacteria 16263
99 Ga0068858_100286898 3300005842 Bacteria 1568
100 Ga0068860_100101911 3300005843 Bacteria 2739
101 Ga0068862_100681422 3300005844 Bacteria 994
102 Ga0070717_10681102 3300006028 Bacteria 934
103 Ga0070717_10741504 3300006028 Unclassified 893
104 Ga0070716_100731126 3300006173 Bacteria 759
105 Ga0070716_101005108 3300006173 Bacteria 660
106 Ga0070716_101027386 3300006173 Bacteria 653
107 Ga0075362_10062277 3300006177 Bacteria 1690
108 Ga0097621_100304444 3300006237 Bacteria 1408
109 Ga0097621_101080840 3300006237 Unclassified 752
110 Ga0068871_100059057 3300006358 Bacteria 3124
111 Ga0068871_100176019 3300006358 Bacteria 1837
112 Ga0075428_100012693 3300006844 Bacteria 9370
113 Ga0075428_100895761 3300006844 Bacteria 941
114 Ga0075431_100012577 3300006847 Bacteria 8541
115 Ga0075433_11578112 3300006852 Unclassified 566
116 Ga0075434_100102273 3300006871 Bacteria 2873
117 Ga0075434_100655481 3300006871 Bacteria 1068
118 Ga0075429_100200725 3300006880 Bacteria 1747
119 Ga0068865_100301545 3300006881 Bacteria 1282
120 Ga0075436_101150493 3300006914 Bacteria 585
121 Ga0097620_101393364 3300006931 Bacteria 773
122 Ga0075435_100043823 3300007076 Bacteria 3583
123 Ga0075435_100179096 3300007076 Bacteria 1791
124 Ga0111539_10000004 3300009094 Bacteria 751278
125 Ga0111539_11776921 3300009094 Bacteria 715
126 Ga0105245_10000005 3300009098 Bacteria 335871
127 Ga0105245_10004113 3300009098 Bacteria 12919
128 Ga0105245_10352716 3300009098 Bacteria 1458
129 Ga0105245_10364810 3300009098 Bacteria 1434
130 Ga0105245_11037093 3300009098 Unclassified 865
131 Ga0105247_10123156 3300009101 Bacteria 1682
132 Ga0114129_10136378 3300009147 Bacteria 3367
133 Ga0114129_10567148 3300009147 Bacteria 1474
134 Ga0114129_11548825 3300009147 Bacteria 813
135 Ga0105243_10028699 3300009148 Bacteria 4273
136 Ga0105243_10387553 3300009148 Bacteria 1294
137 Ga0105241_10077012 3300009174 Bacteria 2602
138 Ga0105241_10269360 3300009174 Bacteria 1450
139 Ga0105242_10148883 3300009176 Bacteria 2039
140 Ga0105248_10080627 3300009177 Bacteria 3658
141 Ga0105248_10104872 3300009177 Bacteria 3187
142 Ga0105238_10000029 3300009551 Bacteria 182309
143 Ga0105249_10032354 3300009553 Bacteria 4731
144 Ga0105249_11470679 3300009553 Bacteria 753
145 Ga0105239_10423518 3300010375 Unclassified 1508
146 Ga0105239_11858008 3300010375 Bacteria 698
147 Ga0105246_11093905 3300011119 Bacteria 727
148 Ga0157369_10000232 3300013105 Bacteria 77009
149 Ga0157374_10000008 3300013296 Bacteria 588863
150 Ga0157374_10262183 3300013296 Bacteria 1702
151 Ga0157378_10000013 3300013297 Bacteria 151930
152 Ga0157378_10000109 3300013297 Bacteria 78488
153 Ga0157378_10018563 3300013297 Bacteria 6113
154 Ga0157378_10456610 3300013297 Bacteria 1269
155 Ga0163162_10295703 3300013306 Bacteria 1751
156 Ga0157372_13153801 3300013307 Unclassified 526
157 Ga0157375_10000022 3300013308 Bacteria 239765
158 Ga0157375_10000032 3300013308 Bacteria 187931
159 Ga0157375_10004303 3300013308 Bacteria 12349
160 Ga0157375_10009559 3300013308 Bacteria 8512
161 Ga0157375_10302882 3300013308 Bacteria 1762
162 Ga0157375_11986814 3300013308 Unclassified 691
163 Ga0157375_12364662 3300013308 Unclassified 634
164 Ga0163163_10373517 3300014325 Unclassified 1483
165 Ga0163163_11358824 3300014325 Bacteria 772
166 Ga0157380_10591145 3300014326 Bacteria 1096
167 Ga0157377_10000012 3300014745 Bacteria 274497
168 Ga0157377_10223891 3300014745 Unclassified 1206
169 Ga0157377_10580295 3300014745 Bacteria 797
170 Ga0157379_10199798 3300014968 Bacteria 1808
171 Ga0157379_11120352 3300014968 Bacteria 754
172 Ga0157376_10000013 3300014969 Bacteria 304287
173 Ga0157376_10342702 3300014969 Unclassified 1428
174 Ga0163161_10005969 3300017792 Bacteria 8443
175 Ga0213873_10000001 3300021358 Bacteria 1657979
176 Ga0213876_10000002 3300021384 Bacteria 1168769
177 Ga0213876_10003270 3300021384 Bacteria 9301
178 Ga0213876_10004005 3300021384 Bacteria 8295
179 Ga0213875_10257163 3300021388 Bacteria 824
180 Ga0207653_10031733 3300025885 Bacteria 1707
181 Ga0207642_10735501 3300025899 Bacteria 624
182 Ga0207710_10003108 3300025900 Bacteria 7437
183 Ga0207680_10048786 3300025903 Bacteria 2517
184 Ga0207647_10092641 3300025904 Bacteria 1801
185 Ga0207647_10133882 3300025904 Bacteria 1455
186 Ga0207643_11086408 3300025908 Bacteria 516
187 Ga0207684_10027996 3300025910 Bacteria 4801
188 Ga0207684_10122298 3300025910 Bacteria 2232
189 Ga0207684_10250702 3300025910 Bacteria 1527
190 Ga0207654_10231679 3300025911 Unclassified 1230
191 Ga0207654_10581524 3300025911 Bacteria 798
192 Ga0207707_10601402 3300025912 Bacteria 931
193 Ga0207662_10059061 3300025918 Bacteria 2298
194 Ga0207662_10117838 3300025918 Bacteria 1662
195 Ga0207662_10209154 3300025918 Unclassified 1266
196 Ga0207662_10474935 3300025918 Bacteria 858
197 Ga0207652_10532489 3300025921 Unclassified 1057
198 Ga0207652_11369483 3300025921 Unclassified 611
199 Ga0207646_10012149 3300025922 Bacteria 8285
200 Ga0207646_10033956 3300025922 Bacteria 4610
201 Ga0207646_10713412 3300025922 Bacteria 896
202 Ga0207681_10089444 3300025923 Bacteria 2195
203 Ga0207694_10000002 3300025924 Bacteria 1165763
204 Ga0207694_10000003 3300025924 Bacteria 1165533
205 Ga0207650_10000026 3300025925 Bacteria 264152
206 Ga0207650_10000028 3300025925 Bacteria 236867
207 Ga0207650_10664061 3300025925 Bacteria 879
208 Ga0207650_10745387 3300025925 Bacteria 829
209 Ga0207650_10784175 3300025925 Unclassified 807
210 Ga0207659_10000068 3300025926 Bacteria 65892
211 Ga0207659_10043658 3300025926 Bacteria 3150
212 Ga0207687_10000005 3300025927 Bacteria 770649
213 Ga0207687_10006157 3300025927 Bacteria 7938
214 Ga0207687_10152974 3300025927 Bacteria 1762
215 Ga0207644_10206792 3300025931 Bacteria 1550
216 Ga0207644_10576499 3300025931 Unclassified 933
217 Ga0207644_10810648 3300025931 Bacteria 783
218 Ga0207644_11228634 3300025931 Bacteria 630
219 Ga0207706_10123705 3300025933 Bacteria 2275
220 Ga0207706_10344015 3300025933 Unclassified 1297
221 Ga0207686_10084359 3300025934 Bacteria 2081
222 Ga0207686_10457916 3300025934 Unclassified 982
223 Ga0207686_10576574 3300025934 Unclassified 883
224 Ga0207709_10083151 3300025935 Bacteria 2069
225 Ga0207709_10386702 3300025935 Bacteria 1066
226 Ga0207709_11378355 3300025935 Bacteria 584
227 Ga0207670_10010009 3300025936 Bacteria 5439
228 Ga0207670_10095709 3300025936 Bacteria 2110
229 Ga0207670_10262830 3300025936 Bacteria 1338
230 Ga0207670_10892139 3300025936 Bacteria 744
231 Ga0207669_10165241 3300025937 Bacteria 1569
232 Ga0207704_10031829 3300025938 Bacteria 2977
233 Ga0207704_10164068 3300025938 Bacteria 1584
234 Ga0207704_10448483 3300025938 Bacteria 1029
235 Ga0207704_11084438 3300025938 Bacteria 680
236 Ga0207665_10206242 3300025939 Bacteria 1434
237 Ga0207665_11080854 3300025939 Bacteria 639
238 Ga0207691_10000551 3300025940 Bacteria 37577
239 Ga0207691_10110850 3300025940 Bacteria 2440
240 Ga0207691_10141432 3300025940 Unclassified 2120
241 Ga0207691_10176234 3300025940 Bacteria 1870
242 Ga0207711_10113121 3300025941 Bacteria 2416
243 Ga0207711_10681918 3300025941 Unclassified 958
244 Ga0207711_11788220 3300025941 Unclassified 558
245 Ga0207689_10003043 3300025942 Bacteria 15448
246 Ga0207689_10988777 3300025942 Bacteria 710
247 Ga0207689_11162246 3300025942 Bacteria 650
248 Ga0207689_11304800 3300025942 Archaea 610
249 Ga0207661_10000022 3300025944 Bacteria 198514
250 Ga0207661_10321948 3300025944 Bacteria 1390
251 Ga0207661_10545145 3300025944 Unclassified 1062
252 Ga0207679_10387608 3300025945 Bacteria 1226
253 Ga0207679_10644726 3300025945 Unclassified 958
254 Ga0207679_10896316 3300025945 Unclassified 811
255 Ga0207651_10009580 3300025960 Bacteria 5315
256 Ga0207651_10021287 3300025960 Bacteria 3938
257 Ga0207651_10147912 3300025960 Unclassified 1824
258 Ga0207651_10151317 3300025960 Bacteria 1807
259 Ga0207651_10295165 3300025960 Bacteria 1346
260 Ga0207651_11245264 3300025960 Bacteria 668
261 Ga0207651_11432342 3300025960 Bacteria 622
262 Ga0207712_10039512 3300025961 Bacteria 3233
263 Ga0207668_10088591 3300025972 Bacteria 2267
264 Ga0207640_10001424 3300025981 Bacteria 12950
265 Ga0207640_10141731 3300025981 Bacteria 1753
266 Ga0207640_11738302 3300025981 Unclassified 563
267 Ga0207677_10000048 3300026023 Bacteria 101555
268 Ga0207677_10000121 3300026023 Bacteria 64050
269 Ga0207677_10158360 3300026023 Bacteria 1756
270 Ga0207677_12092431 3300026023 Bacteria 526
271 Ga0207703_10000034 3300026035 Bacteria 184136
272 Ga0207703_10122493 3300026035 Bacteria 2234
273 Ga0207703_10256635 3300026035 Unclassified 1578
274 Ga0207703_10501389 3300026035 Bacteria 1139
275 Ga0207703_11401372 3300026035 Unclassified 672
276 Ga0207703_11403104 3300026035 Bacteria 672
277 Ga0207639_10100627 3300026041 Bacteria 2335
278 Ga0207639_10285365 3300026041 Bacteria 1453
279 Ga0207639_11029179 3300026041 Unclassified 772
280 Ga0207678_10636986 3300026067 Bacteria 936
281 Ga0207641_10067124 3300026088 Bacteria 3072
282 Ga0207641_10267793 3300026088 Bacteria 1602
283 Ga0207641_11152261 3300026088 Unclassified 774
284 Ga0207648_10197306 3300026089 Bacteria 1785
285 Ga0207648_10199012 3300026089 Unclassified 1777
286 Ga0207676_10000011 3300026095 Bacteria 382648
287 Ga0207676_10045952 3300026095 Bacteria 3376
288 Ga0207676_10585659 3300026095 Unclassified 1070
289 Ga0207674_10101387 3300026116 Bacteria 2860
290 Ga0207675_100233383 3300026118 Unclassified 1776
291 Ga0207675_100269003 3300026118 Bacteria 1654
292 Ga0207675_100909155 3300026118 Bacteria 897
293 Ga0207683_10018467 3300026121 Bacteria 5952
294 Ga0207683_10412948 3300026121 Unclassified 1242
295 Ga0207698_11061566 3300026142 Bacteria 822
296 Ga0207428_10000025 3300027907 Bacteria 259620
297 Ga0268266_10130387 3300028379 Bacteria 2248
298 Ga0268265_10783562 3300028380 Unclassified 928
299 Ga0268265_11124529 3300028380 Unclassified 781
300 Ga0268264_10014544 3300028381 Bacteria 6465
301 Ga0268264_10093808 3300028381 Unclassified 2594
302 Ga0268264_10149671 3300028381 Unclassified 2091
303 Ga0268264_11186633 3300028381 Unclassified 773
304 Ga0307511_10020270 3300030521 Bacteria 6298
305 Ga0265325_10360347 3300031241 Bacteria 641
306 Ga0307412_11894855 3300031911 Bacteria 550
307 Ga0307416_100710995 3300032002 Bacteria 1095
308 Ga0373934_0102899 3300035086 Bacteria 1155
309 Ga0373940_0045013 3300035088 Bacteria 1224
310 Ga0373944_0066194 3300035089 Bacteria 1168
311 Ga0373932_0000115 3300035112 Bacteria 22238
312 Ga0373941_0007734 3300035115 Bacteria 2641
313 Ga0373954_0625006 3300035118 Bacteria 534
314 Ga0373957_0362369 3300035120 Bacteria 620
315 Ga0373943_0060244 3300035170 Bacteria 1894
316 Ga0373946_0077843 3300035171 Unclassified 1446
317 Ga0373947_0301026 3300035725 Bacteria 1069
318 Ga0373937_0048980 3300036401 Unclassified 3869
319 Ga0436364_1178622 3300037853 Bacteria 1876
320 Ga0436365_0169042 3300039437 Bacteria 856
321 Ga0436365_0703007 3300039437 Bacteria 34772
322 Ga0436365_0816620 3300039437 Bacteria 11480
323 Ga0436365_0862132 3300039437 Bacteria 257735
324 Ga0436365_1330752 3300039437 Bacteria 1217
325 Ga0436365_1852133 3300039437 Bacteria 2777
326 Ga0436362_0842419 3300039453 Bacteria 317447
327 Ga0451837_0407641 3300041494 Bacteria 588
328 Ga0451845_0006255 3300041501 Bacteria 875
329 Ga0439457_114890 3300042014 Bacteria 634
330 Ga0450920_072288 3300042122 Bacteria 702
331 Ga0450897_018096 3300042128 Bacteria 737
332 Ga0450894_031948 3300042131 Bacteria 736
333 Ga0450895_004709 3300042132 Bacteria 1082
334 Ga0450896_004311 3300042133 Bacteria 1927
335 Ga0450908_018617 3300042184 Bacteria 1226
336 Ga0439435_0072688 3300042436 Bacteria 1020
337 Ga0439464_0039976 3300042439 Bacteria 1335
338 Ga0439464_0239776 3300042439 Unclassified 584
339 Ga0450918_002700 3300042531 Bacteria 3333
340 Ga0451577_0003887 3300042876 Bacteria 16171
341 Ga0451577_0142261 3300042876 Bacteria 2156
342 Ga0453683_0108722 3300044673 Bacteria 1743
343 Ga0453684_1936318 3300044712 Unclassified 595
344 Ga0451576_2151493 3300045051 Bacteria 573
345 Ga0466967_1759706 3300045976 Unclassified 617
346 Ga0495590_0148187 3300046457 Unclassified 850
347 Ga0495629_0595163 3300046459 Unclassified 740
348 Ga0495629_0803327 3300046459 Bacteria 620
349 Ga0495608_0916433 3300046511 Bacteria 512
350 Ga0495620_0001133 3300046515 Bacteria 16259
351 Ga0495652_1063993 3300046529 Bacteria 527
352 Ga0495586_0611486 3300046535 Bacteria 630
353 Ga0495587_0405166 3300046536 Bacteria 758
354 Ga0495598_0119021 3300046537 Unclassified 894
355 Ga0495634_0075486 3300046642 Unclassified 2214
356 Ga0495657_0442028 3300046675 Bacteria 762
357 Ga0495658_0180154 3300046683 Bacteria 1311
358 Ga0495613_0121430 3300046689 Bacteria 1876
359 Ga0495604_0525957 3300047317 Bacteria 765
360 Ga0495636_0571060 3300047318 Bacteria 551
361 Ga0495674_0375340 3300047319 Bacteria 1151
362 Ga0495672_0242199 3300047320 Unclassified 880
363 Ga0495680_0493695 3300047322 Bacteria 832
364 Ga0496100_0097326 3300048903 Bacteria 2021
365 Ga0496101_0324017 3300048904 Unclassified 1209
366 Ga0496101_1386960 3300048904 Bacteria 548
367 Ga0496102_0826506 3300048905 Bacteria 849
368 Ga0496103_0192879 3300048906 Bacteria 1310
369 Ga0496104_0027085 3300048907 Bacteria 5301
370 Ga0496104_0116227 3300048907 Bacteria 2567
371 Ga0496105_0265780 3300048908 Unclassified 1386
372 Ga0496106_0118774 3300048909 Bacteria 2065
373 Ga0496107_0065793 3300048910 Bacteria 2628
374 Ga0496107_1000219 3300048910 Unclassified 607
375 Ga0496108_0020778 3300048911 Bacteria 5397
376 Ga0496108_0042345 3300048911 Bacteria 3801
377 Ga0496109_0001763 3300048912 Bacteria 17979
378 Ga0496109_0688682 3300048912 Bacteria 959
379 Ga0496111_0178116 3300048914 Bacteria 1580
380 Ga0496111_0230512 3300048914 Bacteria 1376
381 Ga0496112_0001651 3300048915 Bacteria 17324
382 Ga0496112_0758646 3300048915 Bacteria 896
383 Ga0496113_0251989 3300048916 Bacteria 1410
384 Ga0496114_0045407 3300048917 Bacteria 3649
385 Ga0496114_0056289 3300048917 Bacteria 3281
386 Ga0496114_1127590 3300048917 Unclassified 669
387 Ga0496115_0251805 3300048918 Unclassified 1454
388 Ga0501071_0753545 3300049587 Unclassified 750
389 Ga0501073_0004921 3300049589 Bacteria 10029
390 Ga0501074_0957403 3300049590 Bacteria 602
391 Ga0501217_205209 3300049661 Unclassified 616
392 Ga0501235_041769 3300049669 Unclassified 1050
393 Ga0501080_0031036 3300049742 Bacteria 4979
394 Ga0501081_1176682 3300049743 Unclassified 581
395 nmdc:mga03683_31998_c1 3300050489 Bacteria 2113
396 nmdc:mga05p37_1481193_c1 3300050507 Unclassified 677
397 nmdc:mga05p37_293139_c1 3300050507 Bacteria 1936
398 nmdc:mga06r32_27269_c1 3300050510 Bacteria 5334
399 nmdc:mga08y16_5_c1 3300050511 Bacteria 751284
400 nmdc:mga0n895_238781_c1 3300050512 Bacteria 1844
401 nmdc:mga0n895_875974_c1 3300050512 Unclassified 884
402 nmdc:mga0rr50_40122_c1 3300050513 Bacteria 3401
403 nmdc:mga0rr50_7437_c1 3300050513 Bacteria 6757
404 nmdc:mga08x19_319980_c1 3300050514 Unclassified 1079
405 nmdc:mga0a205_939914_c1 3300050515 Unclassified 711
406 Ga0495601_0029004 3300053077 Bacteria 3430
407 Ga0495601_0281021 3300053077 Bacteria 1085
408 Ga0495612_0044435 3300053078 Bacteria 1818
409 Ga0495595_0183692 3300053084 Bacteria 1037
410 Ga0495619_0004057 3300053085 Bacteria 9383
411 Ga0500566_0270685 3300053094 Bacteria 815

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005331 Ga0070670_100126604 Ga0070670_1001266042 132
2 3300005337 Ga0070682_100116004 Ga0070682_1001160042 132
3 3300005457 Ga0070662_100442293 Ga0070662_1004422932 132
4 3300005459 Ga0068867_100972963 Ga0068867_1009729632 132
5 3300005539 Ga0068853_100163206 Ga0068853_1001632062 132
6 3300005844 Ga0068862_100681422 Ga0068862_1006814222 132
7 3300025903 Ga0207680_10048786 Ga0207680_100487862 132
8 3300025931 Ga0207644_10810648 Ga0207644_108106482 132
9 3300042436 Ga0439435_0072688 Ga0439435_0072688_559_963 132
10 3300042439 Ga0439464_0239776 Ga0439464_0239776_98_502 132
11 3300049587 Ga0501071_0753545 Ga0501071_0753545_166_570 132
12 3300053077 Ga0495601_0281021 Ga0495601_0281021_595_999 132
13 3300005334 Ga0068869_101488389 Ga0068869_1014883891 133
14 3300005338 Ga0068868_101566197 Ga0068868_1015661971 133
15 3300005471 Ga0070698_101244174 Ga0070698_1012441741 133
16 3300005549 Ga0070704_100660590 Ga0070704_1006605902 133
17 3300005549 Ga0070704_100972086 Ga0070704_1009720862 133
18 3300005843 Ga0068860_100101911 Ga0068860_1001019113 133
19 3300050507 nmdc:mga05p37_293139_c1 nmdc:mga05p37_293139_c1_978_1382 133
20 3300050512 nmdc:mga0n895_875974_c1 nmdc:mga0n895_875974_c1_341_760 133
21 3300005546 Ga0070696_100392347 Ga0070696_1003923472 137
22 3300005615 Ga0070702_100651454 Ga0070702_1006514542 137
23 3300006177 Ga0075362_10062277 Ga0075362_100622773 137
24 3300009174 Ga0105241_10269360 Ga0105241_102693602 137
25 3300025885 Ga0207653_10031733 Ga0207653_100317333 137
26 3300025900 Ga0207710_10003108 Ga0207710_100031087 137
27 3300025911 Ga0207654_10231679 Ga0207654_102316792 137
28 3300025918 Ga0207662_10474935 Ga0207662_104749351 137
29 3300025921 Ga0207652_11369483 Ga0207652_113694832 137
30 3300025925 Ga0207650_10000028 Ga0207650_10000028151 137
31 3300025925 Ga0207650_10745387 Ga0207650_107453872 137
32 3300025925 Ga0207650_10784175 Ga0207650_107841751 137
33 3300025931 Ga0207644_10576499 Ga0207644_105764992 137
34 3300025933 Ga0207706_10344015 Ga0207706_103440151 137
35 3300025934 Ga0207686_10457916 Ga0207686_104579162 137
36 3300025935 Ga0207709_11378355 Ga0207709_113783552 137
37 3300025936 Ga0207670_10262830 Ga0207670_102628302 137
38 3300025936 Ga0207670_10892139 Ga0207670_108921392 137
39 3300025940 Ga0207691_10141432 Ga0207691_101414322 137
40 3300025941 Ga0207711_10113121 Ga0207711_101131212 137
41 3300025941 Ga0207711_10681918 Ga0207711_106819182 137
42 3300025941 Ga0207711_11788220 Ga0207711_117882201 137
43 3300025942 Ga0207689_11162246 Ga0207689_111622461 137
44 3300025945 Ga0207679_10387608 Ga0207679_103876082 137
45 3300025945 Ga0207679_10896316 Ga0207679_108963161 137
46 3300025960 Ga0207651_10147912 Ga0207651_101479122 137
47 3300025960 Ga0207651_10151317 Ga0207651_101513173 137
48 3300025960 Ga0207651_10295165 Ga0207651_102951652 137
49 3300025960 Ga0207651_11245264 Ga0207651_112452641 137
50 3300025981 Ga0207640_11738302 Ga0207640_117383021 137
51 3300026023 Ga0207677_12092431 Ga0207677_120924311 137
52 3300026035 Ga0207703_10122493 Ga0207703_101224931 137
53 3300026035 Ga0207703_10501389 Ga0207703_105013891 137
54 3300026035 Ga0207703_11401372 Ga0207703_114013721 137
55 3300026035 Ga0207703_11403104 Ga0207703_114031041 137
56 3300026041 Ga0207639_10100627 Ga0207639_101006273 137
57 3300026041 Ga0207639_11029179 Ga0207639_110291792 137
58 3300026088 Ga0207641_11152261 Ga0207641_111522612 137
59 3300026089 Ga0207648_10199012 Ga0207648_101990123 137
60 3300026095 Ga0207676_10585659 Ga0207676_105856592 137
61 3300026116 Ga0207674_10101387 Ga0207674_101013872 137
62 3300026118 Ga0207675_100233383 Ga0207675_1002333832 137
63 3300026121 Ga0207683_10412948 Ga0207683_104129482 137
64 3300026142 Ga0207698_11061566 Ga0207698_110615662 137
65 3300028380 Ga0268265_10783562 Ga0268265_107835622 137
66 3300028380 Ga0268265_11124529 Ga0268265_111245292 137
67 3300028381 Ga0268264_10014544 Ga0268264_100145447 137
68 3300028381 Ga0268264_10093808 Ga0268264_100938083 137
69 3300028381 Ga0268264_10149671 Ga0268264_101496712 137
70 3300028381 Ga0268264_11186633 Ga0268264_111866332 137
71 3300042876 Ga0451577_0142261 Ga0451577_0142261_499_933 137
72 3300045976 Ga0466967_1759706 Ga0466967_1759706_108_524 137
73 3300046457 Ga0495590_0148187 Ga0495590_0148187_335_751 137
74 3300048915 Ga0496112_0758646 Ga0496112_0758646_21_437 137
75 3300048916 Ga0496113_0251989 Ga0496113_0251989_199_615 137
76 3300049661 Ga0501217_205209 Ga0501217_205209_10_426 137
77 3300049669 Ga0501235_041769 Ga0501235_041769_269_685 137
78 3300050489 nmdc:mga03683_31998_c1 nmdc:mga03683_31998_c1_595_1035 137
79 3300048917 Ga0496114_1127590 Ga0496114_1127590_32_478 138
80 3300025918 Ga0207662_10209154 Ga0207662_102091542 139
81 3300035086 Ga0373934_0102899 Ga0373934_0102899_192_617 139
82 3300035089 Ga0373944_0066194 Ga0373944_0066194_408_833 139
83 3300035118 Ga0373954_0625006 Ga0373954_0625006_45_470 139
84 3300035120 Ga0373957_0362369 Ga0373957_0362369_30_455 139
85 3300035171 Ga0373946_0077843 Ga0373946_0077843_738_1163 139
86 3300035725 Ga0373947_0301026 Ga0373947_0301026_563_988 139
87 3300036401 Ga0373937_0048980 Ga0373937_0048980_1021_1446 139
88 3300042876 Ga0451577_0003887 Ga0451577_0003887_15045_15473 139
89 3300046459 Ga0495629_0803327 Ga0495629_0803327_70_495 139
90 3300046511 Ga0495608_0916433 Ga0495608_0916433_63_488 139
91 3300046536 Ga0495587_0405166 Ga0495587_0405166_298_723 139
92 3300046642 Ga0495634_0075486 Ga0495634_0075486_1207_1632 139
93 3300046675 Ga0495657_0442028 Ga0495657_0442028_255_680 139
94 3300046683 Ga0495658_0180154 Ga0495658_0180154_150_575 139
95 3300046689 Ga0495613_0121430 Ga0495613_0121430_122_547 139
96 3300047317 Ga0495604_0525957 Ga0495604_0525957_272_697 139
97 3300047319 Ga0495674_0375340 Ga0495674_0375340_69_494 139
98 3300047322 Ga0495680_0493695 Ga0495680_0493695_250_675 139
99 3300053077 Ga0495601_0029004 Ga0495601_0029004_697_1122 139
100 3300053078 Ga0495612_0044435 Ga0495612_0044435_945_1370 139
101 3300053084 Ga0495595_0183692 Ga0495595_0183692_563_988 139
102 3300053085 Ga0495619_0004057 Ga0495619_0004057_5379_5804 139
103 3300053094 Ga0500566_0270685 Ga0500566_0270685_321_746 139
104 3300005288 Ga0065714_10343657 Ga0065714_103436571 141
105 3300005290 Ga0065712_10000156 Ga0065712_100001568 141
106 3300005293 Ga0065715_10001125 Ga0065715_100011257 141
107 3300005295 Ga0065707_10279574 Ga0065707_102795742 141
108 3300005330 Ga0070690_100812417 Ga0070690_1008124171 141
109 3300005338 Ga0068868_100406335 Ga0068868_1004063352 141
110 3300005340 Ga0070689_100897870 Ga0070689_1008978701 141
111 3300005343 Ga0070687_100043337 Ga0070687_1000433372 141
112 3300005347 Ga0070668_100064955 Ga0070668_1000649553 141
113 3300005353 Ga0070669_100176659 Ga0070669_1001766592 141
114 3300005354 Ga0070675_100069233 Ga0070675_1000692334 141
115 3300005354 Ga0070675_100086765 Ga0070675_1000867653 141
116 3300005356 Ga0070674_102078861 Ga0070674_1020788611 141
117 3300005364 Ga0070673_100227698 Ga0070673_1002276982 141
118 3300005365 Ga0070688_100053051 Ga0070688_1000530514 141
119 3300005440 Ga0070705_100938138 Ga0070705_1009381382 141
120 3300005466 Ga0070685_10024034 Ga0070685_100240342 141
121 3300005543 Ga0070672_100013577 Ga0070672_1000135772 141
122 3300005544 Ga0070686_100213321 Ga0070686_1002133212 141
123 3300005544 Ga0070686_100354751 Ga0070686_1003547511 141
124 3300005548 Ga0070665_100035594 Ga0070665_1000355945 141
125 3300005549 Ga0070704_101087922 Ga0070704_1010879222 141
126 3300005577 Ga0068857_100252514 Ga0068857_1002525142 141
127 3300005577 Ga0068857_101687147 Ga0068857_1016871472 141
128 3300005578 Ga0068854_100319163 Ga0068854_1003191632 141
129 3300005616 Ga0068852_100506326 Ga0068852_1005063263 141
130 3300005618 Ga0068864_100082030 Ga0068864_1000820304 141
131 3300005719 Ga0068861_100085635 Ga0068861_1000856352 141
132 3300005841 Ga0068863_100110013 Ga0068863_1001100134 141
133 3300005841 Ga0068863_100134029 Ga0068863_1001340292 141
134 3300006237 Ga0097621_100304444 Ga0097621_1003044442 141
135 3300006358 Ga0068871_100059057 Ga0068871_1000590573 141
136 3300006881 Ga0068865_100301545 Ga0068865_1003015452 141
137 3300009094 Ga0111539_11776921 Ga0111539_117769211 141
138 3300009098 Ga0105245_10364810 Ga0105245_103648102 141
139 3300009098 Ga0105245_11037093 Ga0105245_110370932 141
140 3300009148 Ga0105243_10028699 Ga0105243_100286991 141
141 3300009148 Ga0105243_10387553 Ga0105243_103875532 141
142 3300009174 Ga0105241_10077012 Ga0105241_100770123 141
143 3300009176 Ga0105242_10148883 Ga0105242_101488831 141
144 3300009177 Ga0105248_10080627 Ga0105248_100806272 141
145 3300009177 Ga0105248_10104872 Ga0105248_101048721 141
146 3300009553 Ga0105249_10032354 Ga0105249_100323543 141
147 3300009553 Ga0105249_11470679 Ga0105249_114706792 141
148 3300010375 Ga0105239_11858008 Ga0105239_118580082 141
149 3300013296 Ga0157374_10262183 Ga0157374_102621833 141
150 3300013297 Ga0157378_10456610 Ga0157378_104566102 141
151 3300013306 Ga0163162_10295703 Ga0163162_102957032 141
152 3300013308 Ga0157375_10009559 Ga0157375_100095596 141
153 3300013308 Ga0157375_10302882 Ga0157375_103028822 141
154 3300013308 Ga0157375_12364662 Ga0157375_123646621 141
155 3300014325 Ga0163163_11358824 Ga0163163_113588242 141
156 3300014745 Ga0157377_10223891 Ga0157377_102238912 141
157 3300014968 Ga0157379_10199798 Ga0157379_101997982 141
158 3300014968 Ga0157379_11120352 Ga0157379_111203521 141
159 3300014969 Ga0157376_10342702 Ga0157376_103427021 141
160 3300017792 Ga0163161_10005969 Ga0163161_100059699 141
161 3300025899 Ga0207642_10735501 Ga0207642_107355012 141
162 3300025904 Ga0207647_10092641 Ga0207647_100926412 141
163 3300025904 Ga0207647_10133882 Ga0207647_101338822 141
164 3300025911 Ga0207654_10581524 Ga0207654_105815241 141
165 3300025918 Ga0207662_10059061 Ga0207662_100590612 141
166 3300025923 Ga0207681_10089444 Ga0207681_100894442 141
167 3300025926 Ga0207659_10043658 Ga0207659_100436583 141
168 3300025931 Ga0207644_10206792 Ga0207644_102067922 141
169 3300025933 Ga0207706_10123705 Ga0207706_101237053 141
170 3300025934 Ga0207686_10084359 Ga0207686_100843592 141
171 3300025934 Ga0207686_10576574 Ga0207686_105765742 141
172 3300025935 Ga0207709_10083151 Ga0207709_100831512 141
173 3300025935 Ga0207709_10386702 Ga0207709_103867022 141
174 3300025936 Ga0207670_10095709 Ga0207670_100957094 141
175 3300025938 Ga0207704_10164068 Ga0207704_101640682 141
176 3300025938 Ga0207704_10448483 Ga0207704_104484832 141
177 3300025938 Ga0207704_11084438 Ga0207704_110844382 141
178 3300025939 Ga0207665_11080854 Ga0207665_110808541 141
179 3300025940 Ga0207691_10110850 Ga0207691_101108502 141
180 3300025940 Ga0207691_10176234 Ga0207691_101762342 141
181 3300025942 Ga0207689_10988777 Ga0207689_109887771 141
182 3300025944 Ga0207661_10321948 Ga0207661_103219482 141
183 3300025960 Ga0207651_10021287 Ga0207651_100212872 141
184 3300025961 Ga0207712_10039512 Ga0207712_100395122 141
185 3300025972 Ga0207668_10088591 Ga0207668_100885913 141
186 3300026023 Ga0207677_10158360 Ga0207677_101583602 141
187 3300026067 Ga0207678_10636986 Ga0207678_106369862 141
188 3300026088 Ga0207641_10067124 Ga0207641_100671244 141
189 3300026088 Ga0207641_10267793 Ga0207641_102677932 141
190 3300026089 Ga0207648_10197306 Ga0207648_101973062 141
191 3300026095 Ga0207676_10045952 Ga0207676_100459522 141
192 3300026118 Ga0207675_100269003 Ga0207675_1002690032 141
193 3300026121 Ga0207683_10018467 Ga0207683_100184675 141
194 3300028379 Ga0268266_10130387 Ga0268266_101303872 141
195 3300041501 Ga0451845_0006255 Ga0451845_0006255_273_704 141
196 3300042014 Ga0439457_114890 Ga0439457_114890_13_447 141
197 3300042122 Ga0450920_072288 Ga0450920_072288_97_531 141
198 3300042128 Ga0450897_018096 Ga0450897_018096_70_504 141
199 3300042131 Ga0450894_031948 Ga0450894_031948_174_608 141
200 3300042132 Ga0450895_004709 Ga0450895_004709_614_1048 141
201 3300042133 Ga0450896_004311 Ga0450896_004311_594_1028 141
202 3300042184 Ga0450908_018617 Ga0450908_018617_545_979 141
203 3300042439 Ga0439464_0039976 Ga0439464_0039976_716_1195 141
204 3300042531 Ga0450918_002700 Ga0450918_002700_1468_1902 141
205 3300045051 Ga0451576_2151493 Ga0451576_2151493_127_558 141
206 3300046459 Ga0495629_0595163 Ga0495629_0595163_233_664 141
207 3300046529 Ga0495652_1063993 Ga0495652_1063993_56_487 141
208 3300046535 Ga0495586_0611486 Ga0495586_0611486_100_531 141
209 3300048903 Ga0496100_0097326 Ga0496100_0097326_952_1383 141
210 3300048904 Ga0496101_0324017 Ga0496101_0324017_299_730 141
211 3300048904 Ga0496101_1386960 Ga0496101_1386960_64_495 141
212 3300048905 Ga0496102_0826506 Ga0496102_0826506_122_553 141
213 3300048906 Ga0496103_0192879 Ga0496103_0192879_537_968 141
214 3300048907 Ga0496104_0027085 Ga0496104_0027085_1224_1655 141
215 3300048907 Ga0496104_0116227 Ga0496104_0116227_1743_2174 141
216 3300048908 Ga0496105_0265780 Ga0496105_0265780_415_846 141
217 3300048909 Ga0496106_0118774 Ga0496106_0118774_992_1423 141
218 3300048910 Ga0496107_0065793 Ga0496107_0065793_1221_1652 141
219 3300048910 Ga0496107_1000219 Ga0496107_1000219_49_480 141
220 3300048911 Ga0496108_0020778 Ga0496108_0020778_1500_1931 141
221 3300048911 Ga0496108_0042345 Ga0496108_0042345_1136_1567 141
222 3300048912 Ga0496109_0001763 Ga0496109_0001763_4286_4717 141
223 3300048912 Ga0496109_0688682 Ga0496109_0688682_316_747 141
224 3300048914 Ga0496111_0178116 Ga0496111_0178116_1060_1491 141
225 3300048914 Ga0496111_0230512 Ga0496111_0230512_273_704 141
226 3300048915 Ga0496112_0001651 Ga0496112_0001651_13959_14390 141
227 3300048917 Ga0496114_0045407 Ga0496114_0045407_1032_1463 141
228 3300048917 Ga0496114_0056289 Ga0496114_0056289_41_472 141
229 3300048918 Ga0496115_0251805 Ga0496115_0251805_66_497 141
230 3300003693 Ga0032354_1144683 Ga0032354_11446832 142
231 3300004798 Ga0058859_11303181 Ga0058859_113031811 142
232 3300005329 Ga0070683_100000085 Ga0070683_1000000852 142
233 3300005329 Ga0070683_100562992 Ga0070683_1005629922 142
234 3300005331 Ga0070670_100000080 Ga0070670_10000008031 142
235 3300005331 Ga0070670_100488956 Ga0070670_1004889562 142
236 3300005334 Ga0068869_100016319 Ga0068869_1000163192 142
237 3300005337 Ga0070682_100171549 Ga0070682_1001715492 142
238 3300005337 Ga0070682_101749078 Ga0070682_1017490781 142
239 3300005338 Ga0068868_100000206 Ga0068868_10000020610 142
240 3300005338 Ga0068868_100000862 Ga0068868_1000008629 142
241 3300005340 Ga0070689_100005284 Ga0070689_1000052843 142
242 3300005343 Ga0070687_100003380 Ga0070687_1000033804 142
243 3300005345 Ga0070692_10079158 Ga0070692_100791581 142
244 3300005354 Ga0070675_100000013 Ga0070675_10000001321 142
245 3300005354 Ga0070675_100665024 Ga0070675_1006650242 142
246 3300005356 Ga0070674_100439755 Ga0070674_1004397552 142
247 3300005364 Ga0070673_100051252 Ga0070673_1000512523 142
248 3300005364 Ga0070673_101782269 Ga0070673_1017822691 142
249 3300005434 Ga0070709_10894762 Ga0070709_108947621 142
250 3300005438 Ga0070701_10009560 Ga0070701_100095603 142
251 3300005445 Ga0070708_100015602 Ga0070708_1000156024 142
252 3300005445 Ga0070708_100073265 Ga0070708_1000732653 142
253 3300005445 Ga0070708_100222534 Ga0070708_1002225342 142
254 3300005445 Ga0070708_100659342 Ga0070708_1006593421 142
255 3300005458 Ga0070681_10752944 Ga0070681_107529441 142
256 3300005459 Ga0068867_101700035 Ga0068867_1017000351 142
257 3300005466 Ga0070685_10002070 Ga0070685_100020707 142
258 3300005467 Ga0070706_100014732 Ga0070706_1000147324 142
259 3300005467 Ga0070706_100018935 Ga0070706_1000189352 142
260 3300005468 Ga0070707_100007053 Ga0070707_1000070534 142
261 3300005468 Ga0070707_100063383 Ga0070707_1000633833 142
262 3300005468 Ga0070707_100079882 Ga0070707_1000798823 142
263 3300005468 Ga0070707_100173297 Ga0070707_1001732972 142
264 3300005471 Ga0070698_100015507 Ga0070698_1000155076 142
265 3300005471 Ga0070698_100550098 Ga0070698_1005500982 142
266 3300005471 Ga0070698_100728233 Ga0070698_1007282333 142
267 3300005471 Ga0070698_100730260 Ga0070698_1007302602 142
268 3300005518 Ga0070699_100008724 Ga0070699_1000087246 142
269 3300005518 Ga0070699_100238755 Ga0070699_1002387551 142
270 3300005518 Ga0070699_100320362 Ga0070699_1003203622 142
271 3300005530 Ga0070679_100330368 Ga0070679_1003303682 142
272 3300005535 Ga0070684_100000071 Ga0070684_10000007161 142
273 3300005535 Ga0070684_100892985 Ga0070684_1008929852 142
274 3300005536 Ga0070697_100025867 Ga0070697_1000258673 142
275 3300005536 Ga0070697_101886363 Ga0070697_1018863631 142
276 3300005539 Ga0068853_100347564 Ga0068853_1003475641 142
277 3300005543 Ga0070672_100000375 Ga0070672_1000003755 142
278 3300005546 Ga0070696_100000071 Ga0070696_10000007126 142
279 3300005578 Ga0068854_100010306 Ga0068854_1000103064 142
280 3300005578 Ga0068854_100272828 Ga0068854_1002728282 142
281 3300005615 Ga0070702_100194536 Ga0070702_1001945361 142
282 3300005617 Ga0068859_101393538 Ga0068859_1013935382 142
283 3300005618 Ga0068864_100000026 Ga0068864_10000002627 142
284 3300005618 Ga0068864_101055208 Ga0068864_1010552082 142
285 3300005842 Ga0068858_100003230 Ga0068858_1000032303 142
286 3300005842 Ga0068858_100286898 Ga0068858_1002868982 142
287 3300006028 Ga0070717_10681102 Ga0070717_106811022 142
288 3300006028 Ga0070717_10741504 Ga0070717_107415042 142
289 3300006173 Ga0070716_100731126 Ga0070716_1007311262 142
290 3300006173 Ga0070716_101005108 Ga0070716_1010051081 142
291 3300006173 Ga0070716_101027386 Ga0070716_1010273861 142
292 3300006237 Ga0097621_101080840 Ga0097621_1010808402 142
293 3300006358 Ga0068871_100176019 Ga0068871_1001760192 142
294 3300006844 Ga0075428_100012693 Ga0075428_1000126936 142
295 3300006844 Ga0075428_100895761 Ga0075428_1008957611 142
296 3300006847 Ga0075431_100012577 Ga0075431_1000125779 142
297 3300006852 Ga0075433_11578112 Ga0075433_115781121 142
298 3300006871 Ga0075434_100102273 Ga0075434_1001022732 142
299 3300006871 Ga0075434_100655481 Ga0075434_1006554811 142
300 3300006880 Ga0075429_100200725 Ga0075429_1002007253 142
301 3300006914 Ga0075436_101150493 Ga0075436_1011504931 142
302 3300006931 Ga0097620_101393364 Ga0097620_1013933642 142
303 3300007076 Ga0075435_100043823 Ga0075435_1000438232 142
304 3300007076 Ga0075435_100179096 Ga0075435_1001790963 142
305 3300009094 Ga0111539_10000004 Ga0111539_10000004613 142
306 3300009098 Ga0105245_10000005 Ga0105245_10000005165 142
307 3300009098 Ga0105245_10004113 Ga0105245_100041138 142
308 3300009098 Ga0105245_10352716 Ga0105245_103527162 142
309 3300009101 Ga0105247_10123156 Ga0105247_101231561 142
310 3300009147 Ga0114129_10136378 Ga0114129_101363784 142
311 3300009147 Ga0114129_10567148 Ga0114129_105671482 142
312 3300009147 Ga0114129_11548825 Ga0114129_115488252 142
313 3300009551 Ga0105238_10000029 Ga0105238_1000002974 142
314 3300010375 Ga0105239_10423518 Ga0105239_104235182 142
315 3300011119 Ga0105246_11093905 Ga0105246_110939051 142
316 3300013105 Ga0157369_10000232 Ga0157369_1000023257 142
317 3300013296 Ga0157374_10000008 Ga0157374_10000008278 142
318 3300013297 Ga0157378_10000013 Ga0157378_1000001396 142
319 3300013297 Ga0157378_10000109 Ga0157378_1000010970 142
320 3300013297 Ga0157378_10018563 Ga0157378_100185634 142
321 3300013307 Ga0157372_13153801 Ga0157372_131538011 142
322 3300013308 Ga0157375_10000022 Ga0157375_1000002269 142
323 3300013308 Ga0157375_10000032 Ga0157375_10000032110 142
324 3300013308 Ga0157375_10004303 Ga0157375_100043034 142
325 3300013308 Ga0157375_11986814 Ga0157375_119868142 142
326 3300014325 Ga0163163_10373517 Ga0163163_103735172 142
327 3300014326 Ga0157380_10591145 Ga0157380_105911452 142
328 3300014745 Ga0157377_10000012 Ga0157377_10000012165 142
329 3300014745 Ga0157377_10580295 Ga0157377_105802952 142
330 3300014969 Ga0157376_10000013 Ga0157376_1000001344 142
331 3300021358 Ga0213873_10000001 Ga0213873_100000011320 142
332 3300021384 Ga0213876_10000002 Ga0213876_10000002220 142
333 3300021384 Ga0213876_10003270 Ga0213876_100032702 142
334 3300021384 Ga0213876_10004005 Ga0213876_100040055 142
335 3300021388 Ga0213875_10257163 Ga0213875_102571632 142
336 3300025908 Ga0207643_11086408 Ga0207643_110864081 142
337 3300025910 Ga0207684_10027996 Ga0207684_100279964 142
338 3300025910 Ga0207684_10122298 Ga0207684_101222982 142
339 3300025910 Ga0207684_10250702 Ga0207684_102507022 142
340 3300025912 Ga0207707_10601402 Ga0207707_106014021 142
341 3300025918 Ga0207662_10117838 Ga0207662_101178382 142
342 3300025921 Ga0207652_10532489 Ga0207652_105324892 142
343 3300025922 Ga0207646_10012149 Ga0207646_100121496 142
344 3300025922 Ga0207646_10033956 Ga0207646_100339564 142
345 3300025922 Ga0207646_10713412 Ga0207646_107134121 142
346 3300025924 Ga0207694_10000002 Ga0207694_10000002103 142
347 3300025924 Ga0207694_10000003 Ga0207694_10000003997 142
348 3300025925 Ga0207650_10000026 Ga0207650_10000026187 142
349 3300025925 Ga0207650_10664061 Ga0207650_106640612 142
350 3300025926 Ga0207659_10000068 Ga0207659_1000006821 142
351 3300025927 Ga0207687_10000005 Ga0207687_10000005235 142
352 3300025927 Ga0207687_10006157 Ga0207687_100061574 142
353 3300025927 Ga0207687_10152974 Ga0207687_101529742 142
354 3300025931 Ga0207644_11228634 Ga0207644_112286341 142
355 3300025936 Ga0207670_10010009 Ga0207670_100100093 142
356 3300025937 Ga0207669_10165241 Ga0207669_101652412 142
357 3300025938 Ga0207704_10031829 Ga0207704_100318292 142
358 3300025939 Ga0207665_10206242 Ga0207665_102062422 142
359 3300025940 Ga0207691_10000551 Ga0207691_1000055124 142
360 3300025942 Ga0207689_10003043 Ga0207689_100030432 142
361 3300025942 Ga0207689_11304800 Ga0207689_113048001 142
362 3300025944 Ga0207661_10000022 Ga0207661_1000002244 142
363 3300025944 Ga0207661_10545145 Ga0207661_105451451 142
364 3300025945 Ga0207679_10644726 Ga0207679_106447261 142
365 3300025960 Ga0207651_10009580 Ga0207651_100095802 142
366 3300025960 Ga0207651_11432342 Ga0207651_114323421 142
367 3300025981 Ga0207640_10001424 Ga0207640_100014242 142
368 3300025981 Ga0207640_10141731 Ga0207640_101417312 142
369 3300026023 Ga0207677_10000048 Ga0207677_1000004884 142
370 3300026023 Ga0207677_10000121 Ga0207677_1000012142 142
371 3300026035 Ga0207703_10000034 Ga0207703_1000003445 142
372 3300026035 Ga0207703_10256635 Ga0207703_102566352 142
373 3300026041 Ga0207639_10285365 Ga0207639_102853652 142
374 3300026095 Ga0207676_10000011 Ga0207676_10000011241 142
375 3300026118 Ga0207675_100909155 Ga0207675_1009091551 142
376 3300027907 Ga0207428_10000025 Ga0207428_10000025235 142
377 3300030521 Ga0307511_10020270 Ga0307511_100202704 142
378 3300031241 Ga0265325_10360347 Ga0265325_103603471 142
379 3300031911 Ga0307412_11894855 Ga0307412_118948551 142
380 3300032002 Ga0307416_100710995 Ga0307416_1007109952 142
381 3300035088 Ga0373940_0045013 Ga0373940_0045013_515_943 142
382 3300035112 Ga0373932_0000115 Ga0373932_0000115_12243_12677 142
383 3300035115 Ga0373941_0007734 Ga0373941_0007734_686_1117 142
384 3300035170 Ga0373943_0060244 Ga0373943_0060244_170_598 142
385 3300037853 Ga0436364_1178622 Ga0436364_1178622_329_766 142
386 3300039437 Ga0436365_0169042 Ga0436365_0169042_170_598 142
387 3300039437 Ga0436365_0703007 Ga0436365_0703007_1395_1829 142
388 3300039437 Ga0436365_0816620 Ga0436365_0816620_3625_4053 142
389 3300039437 Ga0436365_0862132 Ga0436365_0862132_128353_128787 142
390 3300039437 Ga0436365_1330752 Ga0436365_1330752_490_918 142
391 3300039437 Ga0436365_1852133 Ga0436365_1852133_2015_2443 142
392 3300039453 Ga0436362_0842419 Ga0436362_0842419_195279_195713 142
393 3300041494 Ga0451837_0407641 Ga0451837_0407641_60_494 142
394 3300044673 Ga0453683_0108722 Ga0453683_0108722_676_1104 142
395 3300044712 Ga0453684_1936318 Ga0453684_1936318_42_473 142
396 3300046515 Ga0495620_0001133 Ga0495620_0001133_6616_7053 142
397 3300046537 Ga0495598_0119021 Ga0495598_0119021_10_444 142
398 3300047318 Ga0495636_0571060 Ga0495636_0571060_48_485 142
399 3300047320 Ga0495672_0242199 Ga0495672_0242199_334_774 142
400 3300049589 Ga0501073_0004921 Ga0501073_0004921_1308_1742 142
401 3300049590 Ga0501074_0957403 Ga0501074_0957403_30_464 142
402 3300049742 Ga0501080_0031036 Ga0501080_0031036_318_752 142
403 3300049743 Ga0501081_1176682 Ga0501081_1176682_117_557 142
404 3300050507 nmdc:mga05p37_1481193_c1 nmdc:mga05p37_1481193_c1_77_505 142
405 3300050510 nmdc:mga06r32_27269_c1 nmdc:mga06r32_27269_c1_642_1076 142
406 3300050511 nmdc:mga08y16_5_c1 nmdc:mga08y16_5_c1_24521_24955 142
407 3300050512 nmdc:mga0n895_238781_c1 nmdc:mga0n895_238781_c1_709_1143 142
408 3300050513 nmdc:mga0rr50_40122_c1 nmdc:mga0rr50_40122_c1_862_1293 142
409 3300050513 nmdc:mga0rr50_7437_c1 nmdc:mga0rr50_7437_c1_2399_2827 142
410 3300050514 nmdc:mga08x19_319980_c1 nmdc:mga08x19_319980_c1_23_451 142
411 3300050515 nmdc:mga0a205_939914_c1 nmdc:mga0a205_939914_c1_226_657 142

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06491

Disulph_isomer

Disulphide isomerase

27

162

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fhk-assembly1.cif.gz_A crystal structure of apc1446, b.subtilis yphp disulfide isomerase 0.9588 4 137
7rzb-assembly1.cif.gz_A-2 brxa from staphylococcus aureus with bacillithiol mixed disulfide 0.9453 3 138
7rzb-assembly1.cif.gz_A-2 brxa from staphylococcus aureus with bacillithiol mixed disulfide 0.9256 3 138
3fhk-assembly1.cif.gz_A crystal structure of apc1446, b.subtilis yphp disulfide isomerase 0.9002 4 137
3iv4-assembly1.cif.gz_A a putative oxidoreductase with a thioredoxin fold 0.8224 19 134
ID Description Score Start End Superfamily
af_Q2FY55_25_142_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9657 20 137 3.40.30.10
af_Q2FY55_25_142_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9499 20 137 3.40.30.10
af_Q2FYK4_24_144_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9263 19 137 3.40.30.10
af_Q2FYK4_24_144_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9047 19 137 3.40.30.10
af_I1NE04_569_675_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8069 19 136 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A3M2C6P9-F1-model_v4 BrxA/BrxB family bacilliredoxin 0.9827 2 137
AF-A0A2V9WJV3-F1-model_v4 BrxA/BrxB family bacilliredoxin 0.9809 1 142
AF-A0A2E6NKF6-F1-model_v4 BrxA/BrxB family bacilliredoxin 0.9803 1 142
AF-A0A2E3A8F5-F1-model_v4 BrxA/BrxB family bacilliredoxin 0.9772 2 139
AF-A0A7C4Y0K2-F1-model_v4 BrxA/BrxB family bacilliredoxin 0.9772 54 138

Feature Viewer

pLDDT pTM Quality
94.08 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map