F437516
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 411 | 230 | 411 | 142 |
Family's Representative Sequence
| Representative Sequence | 3300013297|Ga0157378_10000109|Ga0157378_1000010970 |
| Length | 169 |
| Sequence | VPRLRGDRTNEFFRYDSPFTSPEEIMYDERIAGPMRAELTQLGFEETRTPQEVDAVLQEKKGTVLVVVNSVCGCAAGVARPAIAMALENEVRPDRMITVFAGNDREATQRAREYFVGYRPSSPSVALFRDGELVKMIERHQIEGRAAHDIASELAMSFNQFCAKEAAVQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 2 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 3 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 52 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 53 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 54 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 57 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 59 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 60 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 61 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 62 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 63 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 64 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 65 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 68 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 93 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 94 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 95 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 141 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 145 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 146 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 147 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 148 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 149 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 150 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 151 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 152 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 153 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 154 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 155 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 156 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 157 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 158 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 159 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 160 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 161 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 162 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 163 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 164 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 165 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 166 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 167 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 168 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 169 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 170 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 171 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 172 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 173 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 174 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 175 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 176 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 177 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 178 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 179 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 197 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 199 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 200 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 201 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 202 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 203 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 204 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 205 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 206 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 207 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 208 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 209 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 210 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 211 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 215 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 216 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 219 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 224 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.51 |
| Metatranscriptomes | 0.49 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.73 |
| Nodule | 0 |
| Rhizoplane | 5.84 |
| Rhizosphere | 89.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0032354_1144683 | 3300003693 | Unclassified | 791 |
| 2 | Ga0058859_11303181 | 3300004798 | Bacteria | 593 |
| 3 | Ga0065714_10343657 | 3300005288 | Unclassified | 599 |
| 4 | Ga0065712_10000156 | 3300005290 | Bacteria | 37789 |
| 5 | Ga0065715_10001125 | 3300005293 | Bacteria | 11430 |
| 6 | Ga0065707_10279574 | 3300005295 | Unclassified | 1051 |
| 7 | Ga0070683_100000085 | 3300005329 | Bacteria | 62547 |
| 8 | Ga0070683_100562992 | 3300005329 | Bacteria | 1090 |
| 9 | Ga0070690_100812417 | 3300005330 | Bacteria | 726 |
| 10 | Ga0070670_100000080 | 3300005331 | Bacteria | 92128 |
| 11 | Ga0070670_100126604 | 3300005331 | Bacteria | 2205 |
| 12 | Ga0070670_100488956 | 3300005331 | Bacteria | 1093 |
| 13 | Ga0068869_100016319 | 3300005334 | Bacteria | 5004 |
| 14 | Ga0068869_101488389 | 3300005334 | Archaea | 601 |
| 15 | Ga0070682_100116004 | 3300005337 | Bacteria | 1791 |
| 16 | Ga0070682_100171549 | 3300005337 | Unclassified | 1508 |
| 17 | Ga0070682_101749078 | 3300005337 | Bacteria | 541 |
| 18 | Ga0068868_100000206 | 3300005338 | Bacteria | 39880 |
| 19 | Ga0068868_100000862 | 3300005338 | Bacteria | 20527 |
| 20 | Ga0068868_100406335 | 3300005338 | Bacteria | 1176 |
| 21 | Ga0068868_101566197 | 3300005338 | Bacteria | 618 |
| 22 | Ga0070689_100005284 | 3300005340 | Bacteria | 8799 |
| 23 | Ga0070689_100897870 | 3300005340 | Bacteria | 784 |
| 24 | Ga0070687_100003380 | 3300005343 | Bacteria | 6190 |
| 25 | Ga0070687_100043337 | 3300005343 | Bacteria | 2286 |
| 26 | Ga0070692_10079158 | 3300005345 | Bacteria | 1766 |
| 27 | Ga0070668_100064955 | 3300005347 | Bacteria | 2830 |
| 28 | Ga0070669_100176659 | 3300005353 | Bacteria | 1668 |
| 29 | Ga0070675_100000013 | 3300005354 | Bacteria | 206266 |
| 30 | Ga0070675_100069233 | 3300005354 | Bacteria | 2923 |
| 31 | Ga0070675_100086765 | 3300005354 | Bacteria | 2616 |
| 32 | Ga0070675_100665024 | 3300005354 | Bacteria | 947 |
| 33 | Ga0070674_100439755 | 3300005356 | Bacteria | 1074 |
| 34 | Ga0070674_102078861 | 3300005356 | Bacteria | 518 |
| 35 | Ga0070673_100051252 | 3300005364 | Bacteria | 3231 |
| 36 | Ga0070673_100227698 | 3300005364 | Bacteria | 1616 |
| 37 | Ga0070673_101782269 | 3300005364 | Bacteria | 583 |
| 38 | Ga0070688_100053051 | 3300005365 | Bacteria | 2535 |
| 39 | Ga0070709_10894762 | 3300005434 | Unclassified | 702 |
| 40 | Ga0070701_10009560 | 3300005438 | Bacteria | 4252 |
| 41 | Ga0070705_100938138 | 3300005440 | Unclassified | 698 |
| 42 | Ga0070708_100015602 | 3300005445 | Bacteria | 6278 |
| 43 | Ga0070708_100073265 | 3300005445 | Bacteria | 3086 |
| 44 | Ga0070708_100222534 | 3300005445 | Bacteria | 1770 |
| 45 | Ga0070708_100659342 | 3300005445 | Bacteria | 986 |
| 46 | Ga0070662_100442293 | 3300005457 | Bacteria | 1078 |
| 47 | Ga0070681_10752944 | 3300005458 | Unclassified | 891 |
| 48 | Ga0068867_100972963 | 3300005459 | Bacteria | 768 |
| 49 | Ga0068867_101700035 | 3300005459 | Bacteria | 592 |
| 50 | Ga0070685_10002070 | 3300005466 | Bacteria | 10371 |
| 51 | Ga0070685_10024034 | 3300005466 | Bacteria | 3344 |
| 52 | Ga0070706_100014732 | 3300005467 | Bacteria | 7224 |
| 53 | Ga0070706_100018935 | 3300005467 | Bacteria | 6350 |
| 54 | Ga0070707_100007053 | 3300005468 | Bacteria | 10419 |
| 55 | Ga0070707_100063383 | 3300005468 | Unclassified | 3548 |
| 56 | Ga0070707_100079882 | 3300005468 | Bacteria | 3157 |
| 57 | Ga0070707_100173297 | 3300005468 | Unclassified | 2102 |
| 58 | Ga0070698_100015507 | 3300005471 | Bacteria | 8049 |
| 59 | Ga0070698_100550098 | 3300005471 | Bacteria | 1094 |
| 60 | Ga0070698_100728233 | 3300005471 | Bacteria | 934 |
| 61 | Ga0070698_100730260 | 3300005471 | Unclassified | 933 |
| 62 | Ga0070698_101244174 | 3300005471 | Unclassified | 694 |
| 63 | Ga0070699_100008724 | 3300005518 | Bacteria | 8787 |
| 64 | Ga0070699_100238755 | 3300005518 | Bacteria | 1622 |
| 65 | Ga0070699_100320362 | 3300005518 | Bacteria | 1393 |
| 66 | Ga0070679_100330368 | 3300005530 | Unclassified | 1473 |
| 67 | Ga0070684_100000071 | 3300005535 | Bacteria | 64721 |
| 68 | Ga0070684_100892985 | 3300005535 | Bacteria | 832 |
| 69 | Ga0070697_100025867 | 3300005536 | Bacteria | 4682 |
| 70 | Ga0070697_101886363 | 3300005536 | Unclassified | 535 |
| 71 | Ga0068853_100163206 | 3300005539 | Bacteria | 2012 |
| 72 | Ga0068853_100347564 | 3300005539 | Bacteria | 1379 |
| 73 | Ga0070672_100000375 | 3300005543 | Bacteria | 25879 |
| 74 | Ga0070672_100013577 | 3300005543 | Bacteria | 5759 |
| 75 | Ga0070686_100213321 | 3300005544 | Bacteria | 1391 |
| 76 | Ga0070686_100354751 | 3300005544 | Bacteria | 1103 |
| 77 | Ga0070696_100000071 | 3300005546 | Bacteria | 49495 |
| 78 | Ga0070696_100392347 | 3300005546 | Unclassified | 1084 |
| 79 | Ga0070665_100035594 | 3300005548 | Bacteria | 5007 |
| 80 | Ga0070704_100660590 | 3300005549 | Unclassified | 924 |
| 81 | Ga0070704_100972086 | 3300005549 | Bacteria | 767 |
| 82 | Ga0070704_101087922 | 3300005549 | Bacteria | 726 |
| 83 | Ga0068857_100252514 | 3300005577 | Bacteria | 1617 |
| 84 | Ga0068857_101687147 | 3300005577 | Unclassified | 619 |
| 85 | Ga0068854_100010306 | 3300005578 | Bacteria | 6057 |
| 86 | Ga0068854_100272828 | 3300005578 | Bacteria | 1359 |
| 87 | Ga0068854_100319163 | 3300005578 | Bacteria | 1262 |
| 88 | Ga0070702_100194536 | 3300005615 | Bacteria | 1337 |
| 89 | Ga0070702_100651454 | 3300005615 | Unclassified | 796 |
| 90 | Ga0068852_100506326 | 3300005616 | Bacteria | 1203 |
| 91 | Ga0068859_101393538 | 3300005617 | Bacteria | 773 |
| 92 | Ga0068864_100000026 | 3300005618 | Bacteria | 243111 |
| 93 | Ga0068864_100082030 | 3300005618 | Bacteria | 2829 |
| 94 | Ga0068864_101055208 | 3300005618 | Unclassified | 807 |
| 95 | Ga0068861_100085635 | 3300005719 | Bacteria | 2476 |
| 96 | Ga0068863_100110013 | 3300005841 | Bacteria | 2623 |
| 97 | Ga0068863_100134029 | 3300005841 | Bacteria | 2366 |
| 98 | Ga0068858_100003230 | 3300005842 | Bacteria | 16263 |
| 99 | Ga0068858_100286898 | 3300005842 | Bacteria | 1568 |
| 100 | Ga0068860_100101911 | 3300005843 | Bacteria | 2739 |
| 101 | Ga0068862_100681422 | 3300005844 | Bacteria | 994 |
| 102 | Ga0070717_10681102 | 3300006028 | Bacteria | 934 |
| 103 | Ga0070717_10741504 | 3300006028 | Unclassified | 893 |
| 104 | Ga0070716_100731126 | 3300006173 | Bacteria | 759 |
| 105 | Ga0070716_101005108 | 3300006173 | Bacteria | 660 |
| 106 | Ga0070716_101027386 | 3300006173 | Bacteria | 653 |
| 107 | Ga0075362_10062277 | 3300006177 | Bacteria | 1690 |
| 108 | Ga0097621_100304444 | 3300006237 | Bacteria | 1408 |
| 109 | Ga0097621_101080840 | 3300006237 | Unclassified | 752 |
| 110 | Ga0068871_100059057 | 3300006358 | Bacteria | 3124 |
| 111 | Ga0068871_100176019 | 3300006358 | Bacteria | 1837 |
| 112 | Ga0075428_100012693 | 3300006844 | Bacteria | 9370 |
| 113 | Ga0075428_100895761 | 3300006844 | Bacteria | 941 |
| 114 | Ga0075431_100012577 | 3300006847 | Bacteria | 8541 |
| 115 | Ga0075433_11578112 | 3300006852 | Unclassified | 566 |
| 116 | Ga0075434_100102273 | 3300006871 | Bacteria | 2873 |
| 117 | Ga0075434_100655481 | 3300006871 | Bacteria | 1068 |
| 118 | Ga0075429_100200725 | 3300006880 | Bacteria | 1747 |
| 119 | Ga0068865_100301545 | 3300006881 | Bacteria | 1282 |
| 120 | Ga0075436_101150493 | 3300006914 | Bacteria | 585 |
| 121 | Ga0097620_101393364 | 3300006931 | Bacteria | 773 |
| 122 | Ga0075435_100043823 | 3300007076 | Bacteria | 3583 |
| 123 | Ga0075435_100179096 | 3300007076 | Bacteria | 1791 |
| 124 | Ga0111539_10000004 | 3300009094 | Bacteria | 751278 |
| 125 | Ga0111539_11776921 | 3300009094 | Bacteria | 715 |
| 126 | Ga0105245_10000005 | 3300009098 | Bacteria | 335871 |
| 127 | Ga0105245_10004113 | 3300009098 | Bacteria | 12919 |
| 128 | Ga0105245_10352716 | 3300009098 | Bacteria | 1458 |
| 129 | Ga0105245_10364810 | 3300009098 | Bacteria | 1434 |
| 130 | Ga0105245_11037093 | 3300009098 | Unclassified | 865 |
| 131 | Ga0105247_10123156 | 3300009101 | Bacteria | 1682 |
| 132 | Ga0114129_10136378 | 3300009147 | Bacteria | 3367 |
| 133 | Ga0114129_10567148 | 3300009147 | Bacteria | 1474 |
| 134 | Ga0114129_11548825 | 3300009147 | Bacteria | 813 |
| 135 | Ga0105243_10028699 | 3300009148 | Bacteria | 4273 |
| 136 | Ga0105243_10387553 | 3300009148 | Bacteria | 1294 |
| 137 | Ga0105241_10077012 | 3300009174 | Bacteria | 2602 |
| 138 | Ga0105241_10269360 | 3300009174 | Bacteria | 1450 |
| 139 | Ga0105242_10148883 | 3300009176 | Bacteria | 2039 |
| 140 | Ga0105248_10080627 | 3300009177 | Bacteria | 3658 |
| 141 | Ga0105248_10104872 | 3300009177 | Bacteria | 3187 |
| 142 | Ga0105238_10000029 | 3300009551 | Bacteria | 182309 |
| 143 | Ga0105249_10032354 | 3300009553 | Bacteria | 4731 |
| 144 | Ga0105249_11470679 | 3300009553 | Bacteria | 753 |
| 145 | Ga0105239_10423518 | 3300010375 | Unclassified | 1508 |
| 146 | Ga0105239_11858008 | 3300010375 | Bacteria | 698 |
| 147 | Ga0105246_11093905 | 3300011119 | Bacteria | 727 |
| 148 | Ga0157369_10000232 | 3300013105 | Bacteria | 77009 |
| 149 | Ga0157374_10000008 | 3300013296 | Bacteria | 588863 |
| 150 | Ga0157374_10262183 | 3300013296 | Bacteria | 1702 |
| 151 | Ga0157378_10000013 | 3300013297 | Bacteria | 151930 |
| 152 | Ga0157378_10000109 | 3300013297 | Bacteria | 78488 |
| 153 | Ga0157378_10018563 | 3300013297 | Bacteria | 6113 |
| 154 | Ga0157378_10456610 | 3300013297 | Bacteria | 1269 |
| 155 | Ga0163162_10295703 | 3300013306 | Bacteria | 1751 |
| 156 | Ga0157372_13153801 | 3300013307 | Unclassified | 526 |
| 157 | Ga0157375_10000022 | 3300013308 | Bacteria | 239765 |
| 158 | Ga0157375_10000032 | 3300013308 | Bacteria | 187931 |
| 159 | Ga0157375_10004303 | 3300013308 | Bacteria | 12349 |
| 160 | Ga0157375_10009559 | 3300013308 | Bacteria | 8512 |
| 161 | Ga0157375_10302882 | 3300013308 | Bacteria | 1762 |
| 162 | Ga0157375_11986814 | 3300013308 | Unclassified | 691 |
| 163 | Ga0157375_12364662 | 3300013308 | Unclassified | 634 |
| 164 | Ga0163163_10373517 | 3300014325 | Unclassified | 1483 |
| 165 | Ga0163163_11358824 | 3300014325 | Bacteria | 772 |
| 166 | Ga0157380_10591145 | 3300014326 | Bacteria | 1096 |
| 167 | Ga0157377_10000012 | 3300014745 | Bacteria | 274497 |
| 168 | Ga0157377_10223891 | 3300014745 | Unclassified | 1206 |
| 169 | Ga0157377_10580295 | 3300014745 | Bacteria | 797 |
| 170 | Ga0157379_10199798 | 3300014968 | Bacteria | 1808 |
| 171 | Ga0157379_11120352 | 3300014968 | Bacteria | 754 |
| 172 | Ga0157376_10000013 | 3300014969 | Bacteria | 304287 |
| 173 | Ga0157376_10342702 | 3300014969 | Unclassified | 1428 |
| 174 | Ga0163161_10005969 | 3300017792 | Bacteria | 8443 |
| 175 | Ga0213873_10000001 | 3300021358 | Bacteria | 1657979 |
| 176 | Ga0213876_10000002 | 3300021384 | Bacteria | 1168769 |
| 177 | Ga0213876_10003270 | 3300021384 | Bacteria | 9301 |
| 178 | Ga0213876_10004005 | 3300021384 | Bacteria | 8295 |
| 179 | Ga0213875_10257163 | 3300021388 | Bacteria | 824 |
| 180 | Ga0207653_10031733 | 3300025885 | Bacteria | 1707 |
| 181 | Ga0207642_10735501 | 3300025899 | Bacteria | 624 |
| 182 | Ga0207710_10003108 | 3300025900 | Bacteria | 7437 |
| 183 | Ga0207680_10048786 | 3300025903 | Bacteria | 2517 |
| 184 | Ga0207647_10092641 | 3300025904 | Bacteria | 1801 |
| 185 | Ga0207647_10133882 | 3300025904 | Bacteria | 1455 |
| 186 | Ga0207643_11086408 | 3300025908 | Bacteria | 516 |
| 187 | Ga0207684_10027996 | 3300025910 | Bacteria | 4801 |
| 188 | Ga0207684_10122298 | 3300025910 | Bacteria | 2232 |
| 189 | Ga0207684_10250702 | 3300025910 | Bacteria | 1527 |
| 190 | Ga0207654_10231679 | 3300025911 | Unclassified | 1230 |
| 191 | Ga0207654_10581524 | 3300025911 | Bacteria | 798 |
| 192 | Ga0207707_10601402 | 3300025912 | Bacteria | 931 |
| 193 | Ga0207662_10059061 | 3300025918 | Bacteria | 2298 |
| 194 | Ga0207662_10117838 | 3300025918 | Bacteria | 1662 |
| 195 | Ga0207662_10209154 | 3300025918 | Unclassified | 1266 |
| 196 | Ga0207662_10474935 | 3300025918 | Bacteria | 858 |
| 197 | Ga0207652_10532489 | 3300025921 | Unclassified | 1057 |
| 198 | Ga0207652_11369483 | 3300025921 | Unclassified | 611 |
| 199 | Ga0207646_10012149 | 3300025922 | Bacteria | 8285 |
| 200 | Ga0207646_10033956 | 3300025922 | Bacteria | 4610 |
| 201 | Ga0207646_10713412 | 3300025922 | Bacteria | 896 |
| 202 | Ga0207681_10089444 | 3300025923 | Bacteria | 2195 |
| 203 | Ga0207694_10000002 | 3300025924 | Bacteria | 1165763 |
| 204 | Ga0207694_10000003 | 3300025924 | Bacteria | 1165533 |
| 205 | Ga0207650_10000026 | 3300025925 | Bacteria | 264152 |
| 206 | Ga0207650_10000028 | 3300025925 | Bacteria | 236867 |
| 207 | Ga0207650_10664061 | 3300025925 | Bacteria | 879 |
| 208 | Ga0207650_10745387 | 3300025925 | Bacteria | 829 |
| 209 | Ga0207650_10784175 | 3300025925 | Unclassified | 807 |
| 210 | Ga0207659_10000068 | 3300025926 | Bacteria | 65892 |
| 211 | Ga0207659_10043658 | 3300025926 | Bacteria | 3150 |
| 212 | Ga0207687_10000005 | 3300025927 | Bacteria | 770649 |
| 213 | Ga0207687_10006157 | 3300025927 | Bacteria | 7938 |
| 214 | Ga0207687_10152974 | 3300025927 | Bacteria | 1762 |
| 215 | Ga0207644_10206792 | 3300025931 | Bacteria | 1550 |
| 216 | Ga0207644_10576499 | 3300025931 | Unclassified | 933 |
| 217 | Ga0207644_10810648 | 3300025931 | Bacteria | 783 |
| 218 | Ga0207644_11228634 | 3300025931 | Bacteria | 630 |
| 219 | Ga0207706_10123705 | 3300025933 | Bacteria | 2275 |
| 220 | Ga0207706_10344015 | 3300025933 | Unclassified | 1297 |
| 221 | Ga0207686_10084359 | 3300025934 | Bacteria | 2081 |
| 222 | Ga0207686_10457916 | 3300025934 | Unclassified | 982 |
| 223 | Ga0207686_10576574 | 3300025934 | Unclassified | 883 |
| 224 | Ga0207709_10083151 | 3300025935 | Bacteria | 2069 |
| 225 | Ga0207709_10386702 | 3300025935 | Bacteria | 1066 |
| 226 | Ga0207709_11378355 | 3300025935 | Bacteria | 584 |
| 227 | Ga0207670_10010009 | 3300025936 | Bacteria | 5439 |
| 228 | Ga0207670_10095709 | 3300025936 | Bacteria | 2110 |
| 229 | Ga0207670_10262830 | 3300025936 | Bacteria | 1338 |
| 230 | Ga0207670_10892139 | 3300025936 | Bacteria | 744 |
| 231 | Ga0207669_10165241 | 3300025937 | Bacteria | 1569 |
| 232 | Ga0207704_10031829 | 3300025938 | Bacteria | 2977 |
| 233 | Ga0207704_10164068 | 3300025938 | Bacteria | 1584 |
| 234 | Ga0207704_10448483 | 3300025938 | Bacteria | 1029 |
| 235 | Ga0207704_11084438 | 3300025938 | Bacteria | 680 |
| 236 | Ga0207665_10206242 | 3300025939 | Bacteria | 1434 |
| 237 | Ga0207665_11080854 | 3300025939 | Bacteria | 639 |
| 238 | Ga0207691_10000551 | 3300025940 | Bacteria | 37577 |
| 239 | Ga0207691_10110850 | 3300025940 | Bacteria | 2440 |
| 240 | Ga0207691_10141432 | 3300025940 | Unclassified | 2120 |
| 241 | Ga0207691_10176234 | 3300025940 | Bacteria | 1870 |
| 242 | Ga0207711_10113121 | 3300025941 | Bacteria | 2416 |
| 243 | Ga0207711_10681918 | 3300025941 | Unclassified | 958 |
| 244 | Ga0207711_11788220 | 3300025941 | Unclassified | 558 |
| 245 | Ga0207689_10003043 | 3300025942 | Bacteria | 15448 |
| 246 | Ga0207689_10988777 | 3300025942 | Bacteria | 710 |
| 247 | Ga0207689_11162246 | 3300025942 | Bacteria | 650 |
| 248 | Ga0207689_11304800 | 3300025942 | Archaea | 610 |
| 249 | Ga0207661_10000022 | 3300025944 | Bacteria | 198514 |
| 250 | Ga0207661_10321948 | 3300025944 | Bacteria | 1390 |
| 251 | Ga0207661_10545145 | 3300025944 | Unclassified | 1062 |
| 252 | Ga0207679_10387608 | 3300025945 | Bacteria | 1226 |
| 253 | Ga0207679_10644726 | 3300025945 | Unclassified | 958 |
| 254 | Ga0207679_10896316 | 3300025945 | Unclassified | 811 |
| 255 | Ga0207651_10009580 | 3300025960 | Bacteria | 5315 |
| 256 | Ga0207651_10021287 | 3300025960 | Bacteria | 3938 |
| 257 | Ga0207651_10147912 | 3300025960 | Unclassified | 1824 |
| 258 | Ga0207651_10151317 | 3300025960 | Bacteria | 1807 |
| 259 | Ga0207651_10295165 | 3300025960 | Bacteria | 1346 |
| 260 | Ga0207651_11245264 | 3300025960 | Bacteria | 668 |
| 261 | Ga0207651_11432342 | 3300025960 | Bacteria | 622 |
| 262 | Ga0207712_10039512 | 3300025961 | Bacteria | 3233 |
| 263 | Ga0207668_10088591 | 3300025972 | Bacteria | 2267 |
| 264 | Ga0207640_10001424 | 3300025981 | Bacteria | 12950 |
| 265 | Ga0207640_10141731 | 3300025981 | Bacteria | 1753 |
| 266 | Ga0207640_11738302 | 3300025981 | Unclassified | 563 |
| 267 | Ga0207677_10000048 | 3300026023 | Bacteria | 101555 |
| 268 | Ga0207677_10000121 | 3300026023 | Bacteria | 64050 |
| 269 | Ga0207677_10158360 | 3300026023 | Bacteria | 1756 |
| 270 | Ga0207677_12092431 | 3300026023 | Bacteria | 526 |
| 271 | Ga0207703_10000034 | 3300026035 | Bacteria | 184136 |
| 272 | Ga0207703_10122493 | 3300026035 | Bacteria | 2234 |
| 273 | Ga0207703_10256635 | 3300026035 | Unclassified | 1578 |
| 274 | Ga0207703_10501389 | 3300026035 | Bacteria | 1139 |
| 275 | Ga0207703_11401372 | 3300026035 | Unclassified | 672 |
| 276 | Ga0207703_11403104 | 3300026035 | Bacteria | 672 |
| 277 | Ga0207639_10100627 | 3300026041 | Bacteria | 2335 |
| 278 | Ga0207639_10285365 | 3300026041 | Bacteria | 1453 |
| 279 | Ga0207639_11029179 | 3300026041 | Unclassified | 772 |
| 280 | Ga0207678_10636986 | 3300026067 | Bacteria | 936 |
| 281 | Ga0207641_10067124 | 3300026088 | Bacteria | 3072 |
| 282 | Ga0207641_10267793 | 3300026088 | Bacteria | 1602 |
| 283 | Ga0207641_11152261 | 3300026088 | Unclassified | 774 |
| 284 | Ga0207648_10197306 | 3300026089 | Bacteria | 1785 |
| 285 | Ga0207648_10199012 | 3300026089 | Unclassified | 1777 |
| 286 | Ga0207676_10000011 | 3300026095 | Bacteria | 382648 |
| 287 | Ga0207676_10045952 | 3300026095 | Bacteria | 3376 |
| 288 | Ga0207676_10585659 | 3300026095 | Unclassified | 1070 |
| 289 | Ga0207674_10101387 | 3300026116 | Bacteria | 2860 |
| 290 | Ga0207675_100233383 | 3300026118 | Unclassified | 1776 |
| 291 | Ga0207675_100269003 | 3300026118 | Bacteria | 1654 |
| 292 | Ga0207675_100909155 | 3300026118 | Bacteria | 897 |
| 293 | Ga0207683_10018467 | 3300026121 | Bacteria | 5952 |
| 294 | Ga0207683_10412948 | 3300026121 | Unclassified | 1242 |
| 295 | Ga0207698_11061566 | 3300026142 | Bacteria | 822 |
| 296 | Ga0207428_10000025 | 3300027907 | Bacteria | 259620 |
| 297 | Ga0268266_10130387 | 3300028379 | Bacteria | 2248 |
| 298 | Ga0268265_10783562 | 3300028380 | Unclassified | 928 |
| 299 | Ga0268265_11124529 | 3300028380 | Unclassified | 781 |
| 300 | Ga0268264_10014544 | 3300028381 | Bacteria | 6465 |
| 301 | Ga0268264_10093808 | 3300028381 | Unclassified | 2594 |
| 302 | Ga0268264_10149671 | 3300028381 | Unclassified | 2091 |
| 303 | Ga0268264_11186633 | 3300028381 | Unclassified | 773 |
| 304 | Ga0307511_10020270 | 3300030521 | Bacteria | 6298 |
| 305 | Ga0265325_10360347 | 3300031241 | Bacteria | 641 |
| 306 | Ga0307412_11894855 | 3300031911 | Bacteria | 550 |
| 307 | Ga0307416_100710995 | 3300032002 | Bacteria | 1095 |
| 308 | Ga0373934_0102899 | 3300035086 | Bacteria | 1155 |
| 309 | Ga0373940_0045013 | 3300035088 | Bacteria | 1224 |
| 310 | Ga0373944_0066194 | 3300035089 | Bacteria | 1168 |
| 311 | Ga0373932_0000115 | 3300035112 | Bacteria | 22238 |
| 312 | Ga0373941_0007734 | 3300035115 | Bacteria | 2641 |
| 313 | Ga0373954_0625006 | 3300035118 | Bacteria | 534 |
| 314 | Ga0373957_0362369 | 3300035120 | Bacteria | 620 |
| 315 | Ga0373943_0060244 | 3300035170 | Bacteria | 1894 |
| 316 | Ga0373946_0077843 | 3300035171 | Unclassified | 1446 |
| 317 | Ga0373947_0301026 | 3300035725 | Bacteria | 1069 |
| 318 | Ga0373937_0048980 | 3300036401 | Unclassified | 3869 |
| 319 | Ga0436364_1178622 | 3300037853 | Bacteria | 1876 |
| 320 | Ga0436365_0169042 | 3300039437 | Bacteria | 856 |
| 321 | Ga0436365_0703007 | 3300039437 | Bacteria | 34772 |
| 322 | Ga0436365_0816620 | 3300039437 | Bacteria | 11480 |
| 323 | Ga0436365_0862132 | 3300039437 | Bacteria | 257735 |
| 324 | Ga0436365_1330752 | 3300039437 | Bacteria | 1217 |
| 325 | Ga0436365_1852133 | 3300039437 | Bacteria | 2777 |
| 326 | Ga0436362_0842419 | 3300039453 | Bacteria | 317447 |
| 327 | Ga0451837_0407641 | 3300041494 | Bacteria | 588 |
| 328 | Ga0451845_0006255 | 3300041501 | Bacteria | 875 |
| 329 | Ga0439457_114890 | 3300042014 | Bacteria | 634 |
| 330 | Ga0450920_072288 | 3300042122 | Bacteria | 702 |
| 331 | Ga0450897_018096 | 3300042128 | Bacteria | 737 |
| 332 | Ga0450894_031948 | 3300042131 | Bacteria | 736 |
| 333 | Ga0450895_004709 | 3300042132 | Bacteria | 1082 |
| 334 | Ga0450896_004311 | 3300042133 | Bacteria | 1927 |
| 335 | Ga0450908_018617 | 3300042184 | Bacteria | 1226 |
| 336 | Ga0439435_0072688 | 3300042436 | Bacteria | 1020 |
| 337 | Ga0439464_0039976 | 3300042439 | Bacteria | 1335 |
| 338 | Ga0439464_0239776 | 3300042439 | Unclassified | 584 |
| 339 | Ga0450918_002700 | 3300042531 | Bacteria | 3333 |
| 340 | Ga0451577_0003887 | 3300042876 | Bacteria | 16171 |
| 341 | Ga0451577_0142261 | 3300042876 | Bacteria | 2156 |
| 342 | Ga0453683_0108722 | 3300044673 | Bacteria | 1743 |
| 343 | Ga0453684_1936318 | 3300044712 | Unclassified | 595 |
| 344 | Ga0451576_2151493 | 3300045051 | Bacteria | 573 |
| 345 | Ga0466967_1759706 | 3300045976 | Unclassified | 617 |
| 346 | Ga0495590_0148187 | 3300046457 | Unclassified | 850 |
| 347 | Ga0495629_0595163 | 3300046459 | Unclassified | 740 |
| 348 | Ga0495629_0803327 | 3300046459 | Bacteria | 620 |
| 349 | Ga0495608_0916433 | 3300046511 | Bacteria | 512 |
| 350 | Ga0495620_0001133 | 3300046515 | Bacteria | 16259 |
| 351 | Ga0495652_1063993 | 3300046529 | Bacteria | 527 |
| 352 | Ga0495586_0611486 | 3300046535 | Bacteria | 630 |
| 353 | Ga0495587_0405166 | 3300046536 | Bacteria | 758 |
| 354 | Ga0495598_0119021 | 3300046537 | Unclassified | 894 |
| 355 | Ga0495634_0075486 | 3300046642 | Unclassified | 2214 |
| 356 | Ga0495657_0442028 | 3300046675 | Bacteria | 762 |
| 357 | Ga0495658_0180154 | 3300046683 | Bacteria | 1311 |
| 358 | Ga0495613_0121430 | 3300046689 | Bacteria | 1876 |
| 359 | Ga0495604_0525957 | 3300047317 | Bacteria | 765 |
| 360 | Ga0495636_0571060 | 3300047318 | Bacteria | 551 |
| 361 | Ga0495674_0375340 | 3300047319 | Bacteria | 1151 |
| 362 | Ga0495672_0242199 | 3300047320 | Unclassified | 880 |
| 363 | Ga0495680_0493695 | 3300047322 | Bacteria | 832 |
| 364 | Ga0496100_0097326 | 3300048903 | Bacteria | 2021 |
| 365 | Ga0496101_0324017 | 3300048904 | Unclassified | 1209 |
| 366 | Ga0496101_1386960 | 3300048904 | Bacteria | 548 |
| 367 | Ga0496102_0826506 | 3300048905 | Bacteria | 849 |
| 368 | Ga0496103_0192879 | 3300048906 | Bacteria | 1310 |
| 369 | Ga0496104_0027085 | 3300048907 | Bacteria | 5301 |
| 370 | Ga0496104_0116227 | 3300048907 | Bacteria | 2567 |
| 371 | Ga0496105_0265780 | 3300048908 | Unclassified | 1386 |
| 372 | Ga0496106_0118774 | 3300048909 | Bacteria | 2065 |
| 373 | Ga0496107_0065793 | 3300048910 | Bacteria | 2628 |
| 374 | Ga0496107_1000219 | 3300048910 | Unclassified | 607 |
| 375 | Ga0496108_0020778 | 3300048911 | Bacteria | 5397 |
| 376 | Ga0496108_0042345 | 3300048911 | Bacteria | 3801 |
| 377 | Ga0496109_0001763 | 3300048912 | Bacteria | 17979 |
| 378 | Ga0496109_0688682 | 3300048912 | Bacteria | 959 |
| 379 | Ga0496111_0178116 | 3300048914 | Bacteria | 1580 |
| 380 | Ga0496111_0230512 | 3300048914 | Bacteria | 1376 |
| 381 | Ga0496112_0001651 | 3300048915 | Bacteria | 17324 |
| 382 | Ga0496112_0758646 | 3300048915 | Bacteria | 896 |
| 383 | Ga0496113_0251989 | 3300048916 | Bacteria | 1410 |
| 384 | Ga0496114_0045407 | 3300048917 | Bacteria | 3649 |
| 385 | Ga0496114_0056289 | 3300048917 | Bacteria | 3281 |
| 386 | Ga0496114_1127590 | 3300048917 | Unclassified | 669 |
| 387 | Ga0496115_0251805 | 3300048918 | Unclassified | 1454 |
| 388 | Ga0501071_0753545 | 3300049587 | Unclassified | 750 |
| 389 | Ga0501073_0004921 | 3300049589 | Bacteria | 10029 |
| 390 | Ga0501074_0957403 | 3300049590 | Bacteria | 602 |
| 391 | Ga0501217_205209 | 3300049661 | Unclassified | 616 |
| 392 | Ga0501235_041769 | 3300049669 | Unclassified | 1050 |
| 393 | Ga0501080_0031036 | 3300049742 | Bacteria | 4979 |
| 394 | Ga0501081_1176682 | 3300049743 | Unclassified | 581 |
| 395 | nmdc:mga03683_31998_c1 | 3300050489 | Bacteria | 2113 |
| 396 | nmdc:mga05p37_1481193_c1 | 3300050507 | Unclassified | 677 |
| 397 | nmdc:mga05p37_293139_c1 | 3300050507 | Bacteria | 1936 |
| 398 | nmdc:mga06r32_27269_c1 | 3300050510 | Bacteria | 5334 |
| 399 | nmdc:mga08y16_5_c1 | 3300050511 | Bacteria | 751284 |
| 400 | nmdc:mga0n895_238781_c1 | 3300050512 | Bacteria | 1844 |
| 401 | nmdc:mga0n895_875974_c1 | 3300050512 | Unclassified | 884 |
| 402 | nmdc:mga0rr50_40122_c1 | 3300050513 | Bacteria | 3401 |
| 403 | nmdc:mga0rr50_7437_c1 | 3300050513 | Bacteria | 6757 |
| 404 | nmdc:mga08x19_319980_c1 | 3300050514 | Unclassified | 1079 |
| 405 | nmdc:mga0a205_939914_c1 | 3300050515 | Unclassified | 711 |
| 406 | Ga0495601_0029004 | 3300053077 | Bacteria | 3430 |
| 407 | Ga0495601_0281021 | 3300053077 | Bacteria | 1085 |
| 408 | Ga0495612_0044435 | 3300053078 | Bacteria | 1818 |
| 409 | Ga0495595_0183692 | 3300053084 | Bacteria | 1037 |
| 410 | Ga0495619_0004057 | 3300053085 | Bacteria | 9383 |
| 411 | Ga0500566_0270685 | 3300053094 | Bacteria | 815 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005331 | Ga0070670_100126604 | Ga0070670_1001266042 | 132 |
| 2 | 3300005337 | Ga0070682_100116004 | Ga0070682_1001160042 | 132 |
| 3 | 3300005457 | Ga0070662_100442293 | Ga0070662_1004422932 | 132 |
| 4 | 3300005459 | Ga0068867_100972963 | Ga0068867_1009729632 | 132 |
| 5 | 3300005539 | Ga0068853_100163206 | Ga0068853_1001632062 | 132 |
| 6 | 3300005844 | Ga0068862_100681422 | Ga0068862_1006814222 | 132 |
| 7 | 3300025903 | Ga0207680_10048786 | Ga0207680_100487862 | 132 |
| 8 | 3300025931 | Ga0207644_10810648 | Ga0207644_108106482 | 132 |
| 9 | 3300042436 | Ga0439435_0072688 | Ga0439435_0072688_559_963 | 132 |
| 10 | 3300042439 | Ga0439464_0239776 | Ga0439464_0239776_98_502 | 132 |
| 11 | 3300049587 | Ga0501071_0753545 | Ga0501071_0753545_166_570 | 132 |
| 12 | 3300053077 | Ga0495601_0281021 | Ga0495601_0281021_595_999 | 132 |
| 13 | 3300005334 | Ga0068869_101488389 | Ga0068869_1014883891 | 133 |
| 14 | 3300005338 | Ga0068868_101566197 | Ga0068868_1015661971 | 133 |
| 15 | 3300005471 | Ga0070698_101244174 | Ga0070698_1012441741 | 133 |
| 16 | 3300005549 | Ga0070704_100660590 | Ga0070704_1006605902 | 133 |
| 17 | 3300005549 | Ga0070704_100972086 | Ga0070704_1009720862 | 133 |
| 18 | 3300005843 | Ga0068860_100101911 | Ga0068860_1001019113 | 133 |
| 19 | 3300050507 | nmdc:mga05p37_293139_c1 | nmdc:mga05p37_293139_c1_978_1382 | 133 |
| 20 | 3300050512 | nmdc:mga0n895_875974_c1 | nmdc:mga0n895_875974_c1_341_760 | 133 |
| 21 | 3300005546 | Ga0070696_100392347 | Ga0070696_1003923472 | 137 |
| 22 | 3300005615 | Ga0070702_100651454 | Ga0070702_1006514542 | 137 |
| 23 | 3300006177 | Ga0075362_10062277 | Ga0075362_100622773 | 137 |
| 24 | 3300009174 | Ga0105241_10269360 | Ga0105241_102693602 | 137 |
| 25 | 3300025885 | Ga0207653_10031733 | Ga0207653_100317333 | 137 |
| 26 | 3300025900 | Ga0207710_10003108 | Ga0207710_100031087 | 137 |
| 27 | 3300025911 | Ga0207654_10231679 | Ga0207654_102316792 | 137 |
| 28 | 3300025918 | Ga0207662_10474935 | Ga0207662_104749351 | 137 |
| 29 | 3300025921 | Ga0207652_11369483 | Ga0207652_113694832 | 137 |
| 30 | 3300025925 | Ga0207650_10000028 | Ga0207650_10000028151 | 137 |
| 31 | 3300025925 | Ga0207650_10745387 | Ga0207650_107453872 | 137 |
| 32 | 3300025925 | Ga0207650_10784175 | Ga0207650_107841751 | 137 |
| 33 | 3300025931 | Ga0207644_10576499 | Ga0207644_105764992 | 137 |
| 34 | 3300025933 | Ga0207706_10344015 | Ga0207706_103440151 | 137 |
| 35 | 3300025934 | Ga0207686_10457916 | Ga0207686_104579162 | 137 |
| 36 | 3300025935 | Ga0207709_11378355 | Ga0207709_113783552 | 137 |
| 37 | 3300025936 | Ga0207670_10262830 | Ga0207670_102628302 | 137 |
| 38 | 3300025936 | Ga0207670_10892139 | Ga0207670_108921392 | 137 |
| 39 | 3300025940 | Ga0207691_10141432 | Ga0207691_101414322 | 137 |
| 40 | 3300025941 | Ga0207711_10113121 | Ga0207711_101131212 | 137 |
| 41 | 3300025941 | Ga0207711_10681918 | Ga0207711_106819182 | 137 |
| 42 | 3300025941 | Ga0207711_11788220 | Ga0207711_117882201 | 137 |
| 43 | 3300025942 | Ga0207689_11162246 | Ga0207689_111622461 | 137 |
| 44 | 3300025945 | Ga0207679_10387608 | Ga0207679_103876082 | 137 |
| 45 | 3300025945 | Ga0207679_10896316 | Ga0207679_108963161 | 137 |
| 46 | 3300025960 | Ga0207651_10147912 | Ga0207651_101479122 | 137 |
| 47 | 3300025960 | Ga0207651_10151317 | Ga0207651_101513173 | 137 |
| 48 | 3300025960 | Ga0207651_10295165 | Ga0207651_102951652 | 137 |
| 49 | 3300025960 | Ga0207651_11245264 | Ga0207651_112452641 | 137 |
| 50 | 3300025981 | Ga0207640_11738302 | Ga0207640_117383021 | 137 |
| 51 | 3300026023 | Ga0207677_12092431 | Ga0207677_120924311 | 137 |
| 52 | 3300026035 | Ga0207703_10122493 | Ga0207703_101224931 | 137 |
| 53 | 3300026035 | Ga0207703_10501389 | Ga0207703_105013891 | 137 |
| 54 | 3300026035 | Ga0207703_11401372 | Ga0207703_114013721 | 137 |
| 55 | 3300026035 | Ga0207703_11403104 | Ga0207703_114031041 | 137 |
| 56 | 3300026041 | Ga0207639_10100627 | Ga0207639_101006273 | 137 |
| 57 | 3300026041 | Ga0207639_11029179 | Ga0207639_110291792 | 137 |
| 58 | 3300026088 | Ga0207641_11152261 | Ga0207641_111522612 | 137 |
| 59 | 3300026089 | Ga0207648_10199012 | Ga0207648_101990123 | 137 |
| 60 | 3300026095 | Ga0207676_10585659 | Ga0207676_105856592 | 137 |
| 61 | 3300026116 | Ga0207674_10101387 | Ga0207674_101013872 | 137 |
| 62 | 3300026118 | Ga0207675_100233383 | Ga0207675_1002333832 | 137 |
| 63 | 3300026121 | Ga0207683_10412948 | Ga0207683_104129482 | 137 |
| 64 | 3300026142 | Ga0207698_11061566 | Ga0207698_110615662 | 137 |
| 65 | 3300028380 | Ga0268265_10783562 | Ga0268265_107835622 | 137 |
| 66 | 3300028380 | Ga0268265_11124529 | Ga0268265_111245292 | 137 |
| 67 | 3300028381 | Ga0268264_10014544 | Ga0268264_100145447 | 137 |
| 68 | 3300028381 | Ga0268264_10093808 | Ga0268264_100938083 | 137 |
| 69 | 3300028381 | Ga0268264_10149671 | Ga0268264_101496712 | 137 |
| 70 | 3300028381 | Ga0268264_11186633 | Ga0268264_111866332 | 137 |
| 71 | 3300042876 | Ga0451577_0142261 | Ga0451577_0142261_499_933 | 137 |
| 72 | 3300045976 | Ga0466967_1759706 | Ga0466967_1759706_108_524 | 137 |
| 73 | 3300046457 | Ga0495590_0148187 | Ga0495590_0148187_335_751 | 137 |
| 74 | 3300048915 | Ga0496112_0758646 | Ga0496112_0758646_21_437 | 137 |
| 75 | 3300048916 | Ga0496113_0251989 | Ga0496113_0251989_199_615 | 137 |
| 76 | 3300049661 | Ga0501217_205209 | Ga0501217_205209_10_426 | 137 |
| 77 | 3300049669 | Ga0501235_041769 | Ga0501235_041769_269_685 | 137 |
| 78 | 3300050489 | nmdc:mga03683_31998_c1 | nmdc:mga03683_31998_c1_595_1035 | 137 |
| 79 | 3300048917 | Ga0496114_1127590 | Ga0496114_1127590_32_478 | 138 |
| 80 | 3300025918 | Ga0207662_10209154 | Ga0207662_102091542 | 139 |
| 81 | 3300035086 | Ga0373934_0102899 | Ga0373934_0102899_192_617 | 139 |
| 82 | 3300035089 | Ga0373944_0066194 | Ga0373944_0066194_408_833 | 139 |
| 83 | 3300035118 | Ga0373954_0625006 | Ga0373954_0625006_45_470 | 139 |
| 84 | 3300035120 | Ga0373957_0362369 | Ga0373957_0362369_30_455 | 139 |
| 85 | 3300035171 | Ga0373946_0077843 | Ga0373946_0077843_738_1163 | 139 |
| 86 | 3300035725 | Ga0373947_0301026 | Ga0373947_0301026_563_988 | 139 |
| 87 | 3300036401 | Ga0373937_0048980 | Ga0373937_0048980_1021_1446 | 139 |
| 88 | 3300042876 | Ga0451577_0003887 | Ga0451577_0003887_15045_15473 | 139 |
| 89 | 3300046459 | Ga0495629_0803327 | Ga0495629_0803327_70_495 | 139 |
| 90 | 3300046511 | Ga0495608_0916433 | Ga0495608_0916433_63_488 | 139 |
| 91 | 3300046536 | Ga0495587_0405166 | Ga0495587_0405166_298_723 | 139 |
| 92 | 3300046642 | Ga0495634_0075486 | Ga0495634_0075486_1207_1632 | 139 |
| 93 | 3300046675 | Ga0495657_0442028 | Ga0495657_0442028_255_680 | 139 |
| 94 | 3300046683 | Ga0495658_0180154 | Ga0495658_0180154_150_575 | 139 |
| 95 | 3300046689 | Ga0495613_0121430 | Ga0495613_0121430_122_547 | 139 |
| 96 | 3300047317 | Ga0495604_0525957 | Ga0495604_0525957_272_697 | 139 |
| 97 | 3300047319 | Ga0495674_0375340 | Ga0495674_0375340_69_494 | 139 |
| 98 | 3300047322 | Ga0495680_0493695 | Ga0495680_0493695_250_675 | 139 |
| 99 | 3300053077 | Ga0495601_0029004 | Ga0495601_0029004_697_1122 | 139 |
| 100 | 3300053078 | Ga0495612_0044435 | Ga0495612_0044435_945_1370 | 139 |
| 101 | 3300053084 | Ga0495595_0183692 | Ga0495595_0183692_563_988 | 139 |
| 102 | 3300053085 | Ga0495619_0004057 | Ga0495619_0004057_5379_5804 | 139 |
| 103 | 3300053094 | Ga0500566_0270685 | Ga0500566_0270685_321_746 | 139 |
| 104 | 3300005288 | Ga0065714_10343657 | Ga0065714_103436571 | 141 |
| 105 | 3300005290 | Ga0065712_10000156 | Ga0065712_100001568 | 141 |
| 106 | 3300005293 | Ga0065715_10001125 | Ga0065715_100011257 | 141 |
| 107 | 3300005295 | Ga0065707_10279574 | Ga0065707_102795742 | 141 |
| 108 | 3300005330 | Ga0070690_100812417 | Ga0070690_1008124171 | 141 |
| 109 | 3300005338 | Ga0068868_100406335 | Ga0068868_1004063352 | 141 |
| 110 | 3300005340 | Ga0070689_100897870 | Ga0070689_1008978701 | 141 |
| 111 | 3300005343 | Ga0070687_100043337 | Ga0070687_1000433372 | 141 |
| 112 | 3300005347 | Ga0070668_100064955 | Ga0070668_1000649553 | 141 |
| 113 | 3300005353 | Ga0070669_100176659 | Ga0070669_1001766592 | 141 |
| 114 | 3300005354 | Ga0070675_100069233 | Ga0070675_1000692334 | 141 |
| 115 | 3300005354 | Ga0070675_100086765 | Ga0070675_1000867653 | 141 |
| 116 | 3300005356 | Ga0070674_102078861 | Ga0070674_1020788611 | 141 |
| 117 | 3300005364 | Ga0070673_100227698 | Ga0070673_1002276982 | 141 |
| 118 | 3300005365 | Ga0070688_100053051 | Ga0070688_1000530514 | 141 |
| 119 | 3300005440 | Ga0070705_100938138 | Ga0070705_1009381382 | 141 |
| 120 | 3300005466 | Ga0070685_10024034 | Ga0070685_100240342 | 141 |
| 121 | 3300005543 | Ga0070672_100013577 | Ga0070672_1000135772 | 141 |
| 122 | 3300005544 | Ga0070686_100213321 | Ga0070686_1002133212 | 141 |
| 123 | 3300005544 | Ga0070686_100354751 | Ga0070686_1003547511 | 141 |
| 124 | 3300005548 | Ga0070665_100035594 | Ga0070665_1000355945 | 141 |
| 125 | 3300005549 | Ga0070704_101087922 | Ga0070704_1010879222 | 141 |
| 126 | 3300005577 | Ga0068857_100252514 | Ga0068857_1002525142 | 141 |
| 127 | 3300005577 | Ga0068857_101687147 | Ga0068857_1016871472 | 141 |
| 128 | 3300005578 | Ga0068854_100319163 | Ga0068854_1003191632 | 141 |
| 129 | 3300005616 | Ga0068852_100506326 | Ga0068852_1005063263 | 141 |
| 130 | 3300005618 | Ga0068864_100082030 | Ga0068864_1000820304 | 141 |
| 131 | 3300005719 | Ga0068861_100085635 | Ga0068861_1000856352 | 141 |
| 132 | 3300005841 | Ga0068863_100110013 | Ga0068863_1001100134 | 141 |
| 133 | 3300005841 | Ga0068863_100134029 | Ga0068863_1001340292 | 141 |
| 134 | 3300006237 | Ga0097621_100304444 | Ga0097621_1003044442 | 141 |
| 135 | 3300006358 | Ga0068871_100059057 | Ga0068871_1000590573 | 141 |
| 136 | 3300006881 | Ga0068865_100301545 | Ga0068865_1003015452 | 141 |
| 137 | 3300009094 | Ga0111539_11776921 | Ga0111539_117769211 | 141 |
| 138 | 3300009098 | Ga0105245_10364810 | Ga0105245_103648102 | 141 |
| 139 | 3300009098 | Ga0105245_11037093 | Ga0105245_110370932 | 141 |
| 140 | 3300009148 | Ga0105243_10028699 | Ga0105243_100286991 | 141 |
| 141 | 3300009148 | Ga0105243_10387553 | Ga0105243_103875532 | 141 |
| 142 | 3300009174 | Ga0105241_10077012 | Ga0105241_100770123 | 141 |
| 143 | 3300009176 | Ga0105242_10148883 | Ga0105242_101488831 | 141 |
| 144 | 3300009177 | Ga0105248_10080627 | Ga0105248_100806272 | 141 |
| 145 | 3300009177 | Ga0105248_10104872 | Ga0105248_101048721 | 141 |
| 146 | 3300009553 | Ga0105249_10032354 | Ga0105249_100323543 | 141 |
| 147 | 3300009553 | Ga0105249_11470679 | Ga0105249_114706792 | 141 |
| 148 | 3300010375 | Ga0105239_11858008 | Ga0105239_118580082 | 141 |
| 149 | 3300013296 | Ga0157374_10262183 | Ga0157374_102621833 | 141 |
| 150 | 3300013297 | Ga0157378_10456610 | Ga0157378_104566102 | 141 |
| 151 | 3300013306 | Ga0163162_10295703 | Ga0163162_102957032 | 141 |
| 152 | 3300013308 | Ga0157375_10009559 | Ga0157375_100095596 | 141 |
| 153 | 3300013308 | Ga0157375_10302882 | Ga0157375_103028822 | 141 |
| 154 | 3300013308 | Ga0157375_12364662 | Ga0157375_123646621 | 141 |
| 155 | 3300014325 | Ga0163163_11358824 | Ga0163163_113588242 | 141 |
| 156 | 3300014745 | Ga0157377_10223891 | Ga0157377_102238912 | 141 |
| 157 | 3300014968 | Ga0157379_10199798 | Ga0157379_101997982 | 141 |
| 158 | 3300014968 | Ga0157379_11120352 | Ga0157379_111203521 | 141 |
| 159 | 3300014969 | Ga0157376_10342702 | Ga0157376_103427021 | 141 |
| 160 | 3300017792 | Ga0163161_10005969 | Ga0163161_100059699 | 141 |
| 161 | 3300025899 | Ga0207642_10735501 | Ga0207642_107355012 | 141 |
| 162 | 3300025904 | Ga0207647_10092641 | Ga0207647_100926412 | 141 |
| 163 | 3300025904 | Ga0207647_10133882 | Ga0207647_101338822 | 141 |
| 164 | 3300025911 | Ga0207654_10581524 | Ga0207654_105815241 | 141 |
| 165 | 3300025918 | Ga0207662_10059061 | Ga0207662_100590612 | 141 |
| 166 | 3300025923 | Ga0207681_10089444 | Ga0207681_100894442 | 141 |
| 167 | 3300025926 | Ga0207659_10043658 | Ga0207659_100436583 | 141 |
| 168 | 3300025931 | Ga0207644_10206792 | Ga0207644_102067922 | 141 |
| 169 | 3300025933 | Ga0207706_10123705 | Ga0207706_101237053 | 141 |
| 170 | 3300025934 | Ga0207686_10084359 | Ga0207686_100843592 | 141 |
| 171 | 3300025934 | Ga0207686_10576574 | Ga0207686_105765742 | 141 |
| 172 | 3300025935 | Ga0207709_10083151 | Ga0207709_100831512 | 141 |
| 173 | 3300025935 | Ga0207709_10386702 | Ga0207709_103867022 | 141 |
| 174 | 3300025936 | Ga0207670_10095709 | Ga0207670_100957094 | 141 |
| 175 | 3300025938 | Ga0207704_10164068 | Ga0207704_101640682 | 141 |
| 176 | 3300025938 | Ga0207704_10448483 | Ga0207704_104484832 | 141 |
| 177 | 3300025938 | Ga0207704_11084438 | Ga0207704_110844382 | 141 |
| 178 | 3300025939 | Ga0207665_11080854 | Ga0207665_110808541 | 141 |
| 179 | 3300025940 | Ga0207691_10110850 | Ga0207691_101108502 | 141 |
| 180 | 3300025940 | Ga0207691_10176234 | Ga0207691_101762342 | 141 |
| 181 | 3300025942 | Ga0207689_10988777 | Ga0207689_109887771 | 141 |
| 182 | 3300025944 | Ga0207661_10321948 | Ga0207661_103219482 | 141 |
| 183 | 3300025960 | Ga0207651_10021287 | Ga0207651_100212872 | 141 |
| 184 | 3300025961 | Ga0207712_10039512 | Ga0207712_100395122 | 141 |
| 185 | 3300025972 | Ga0207668_10088591 | Ga0207668_100885913 | 141 |
| 186 | 3300026023 | Ga0207677_10158360 | Ga0207677_101583602 | 141 |
| 187 | 3300026067 | Ga0207678_10636986 | Ga0207678_106369862 | 141 |
| 188 | 3300026088 | Ga0207641_10067124 | Ga0207641_100671244 | 141 |
| 189 | 3300026088 | Ga0207641_10267793 | Ga0207641_102677932 | 141 |
| 190 | 3300026089 | Ga0207648_10197306 | Ga0207648_101973062 | 141 |
| 191 | 3300026095 | Ga0207676_10045952 | Ga0207676_100459522 | 141 |
| 192 | 3300026118 | Ga0207675_100269003 | Ga0207675_1002690032 | 141 |
| 193 | 3300026121 | Ga0207683_10018467 | Ga0207683_100184675 | 141 |
| 194 | 3300028379 | Ga0268266_10130387 | Ga0268266_101303872 | 141 |
| 195 | 3300041501 | Ga0451845_0006255 | Ga0451845_0006255_273_704 | 141 |
| 196 | 3300042014 | Ga0439457_114890 | Ga0439457_114890_13_447 | 141 |
| 197 | 3300042122 | Ga0450920_072288 | Ga0450920_072288_97_531 | 141 |
| 198 | 3300042128 | Ga0450897_018096 | Ga0450897_018096_70_504 | 141 |
| 199 | 3300042131 | Ga0450894_031948 | Ga0450894_031948_174_608 | 141 |
| 200 | 3300042132 | Ga0450895_004709 | Ga0450895_004709_614_1048 | 141 |
| 201 | 3300042133 | Ga0450896_004311 | Ga0450896_004311_594_1028 | 141 |
| 202 | 3300042184 | Ga0450908_018617 | Ga0450908_018617_545_979 | 141 |
| 203 | 3300042439 | Ga0439464_0039976 | Ga0439464_0039976_716_1195 | 141 |
| 204 | 3300042531 | Ga0450918_002700 | Ga0450918_002700_1468_1902 | 141 |
| 205 | 3300045051 | Ga0451576_2151493 | Ga0451576_2151493_127_558 | 141 |
| 206 | 3300046459 | Ga0495629_0595163 | Ga0495629_0595163_233_664 | 141 |
| 207 | 3300046529 | Ga0495652_1063993 | Ga0495652_1063993_56_487 | 141 |
| 208 | 3300046535 | Ga0495586_0611486 | Ga0495586_0611486_100_531 | 141 |
| 209 | 3300048903 | Ga0496100_0097326 | Ga0496100_0097326_952_1383 | 141 |
| 210 | 3300048904 | Ga0496101_0324017 | Ga0496101_0324017_299_730 | 141 |
| 211 | 3300048904 | Ga0496101_1386960 | Ga0496101_1386960_64_495 | 141 |
| 212 | 3300048905 | Ga0496102_0826506 | Ga0496102_0826506_122_553 | 141 |
| 213 | 3300048906 | Ga0496103_0192879 | Ga0496103_0192879_537_968 | 141 |
| 214 | 3300048907 | Ga0496104_0027085 | Ga0496104_0027085_1224_1655 | 141 |
| 215 | 3300048907 | Ga0496104_0116227 | Ga0496104_0116227_1743_2174 | 141 |
| 216 | 3300048908 | Ga0496105_0265780 | Ga0496105_0265780_415_846 | 141 |
| 217 | 3300048909 | Ga0496106_0118774 | Ga0496106_0118774_992_1423 | 141 |
| 218 | 3300048910 | Ga0496107_0065793 | Ga0496107_0065793_1221_1652 | 141 |
| 219 | 3300048910 | Ga0496107_1000219 | Ga0496107_1000219_49_480 | 141 |
| 220 | 3300048911 | Ga0496108_0020778 | Ga0496108_0020778_1500_1931 | 141 |
| 221 | 3300048911 | Ga0496108_0042345 | Ga0496108_0042345_1136_1567 | 141 |
| 222 | 3300048912 | Ga0496109_0001763 | Ga0496109_0001763_4286_4717 | 141 |
| 223 | 3300048912 | Ga0496109_0688682 | Ga0496109_0688682_316_747 | 141 |
| 224 | 3300048914 | Ga0496111_0178116 | Ga0496111_0178116_1060_1491 | 141 |
| 225 | 3300048914 | Ga0496111_0230512 | Ga0496111_0230512_273_704 | 141 |
| 226 | 3300048915 | Ga0496112_0001651 | Ga0496112_0001651_13959_14390 | 141 |
| 227 | 3300048917 | Ga0496114_0045407 | Ga0496114_0045407_1032_1463 | 141 |
| 228 | 3300048917 | Ga0496114_0056289 | Ga0496114_0056289_41_472 | 141 |
| 229 | 3300048918 | Ga0496115_0251805 | Ga0496115_0251805_66_497 | 141 |
| 230 | 3300003693 | Ga0032354_1144683 | Ga0032354_11446832 | 142 |
| 231 | 3300004798 | Ga0058859_11303181 | Ga0058859_113031811 | 142 |
| 232 | 3300005329 | Ga0070683_100000085 | Ga0070683_1000000852 | 142 |
| 233 | 3300005329 | Ga0070683_100562992 | Ga0070683_1005629922 | 142 |
| 234 | 3300005331 | Ga0070670_100000080 | Ga0070670_10000008031 | 142 |
| 235 | 3300005331 | Ga0070670_100488956 | Ga0070670_1004889562 | 142 |
| 236 | 3300005334 | Ga0068869_100016319 | Ga0068869_1000163192 | 142 |
| 237 | 3300005337 | Ga0070682_100171549 | Ga0070682_1001715492 | 142 |
| 238 | 3300005337 | Ga0070682_101749078 | Ga0070682_1017490781 | 142 |
| 239 | 3300005338 | Ga0068868_100000206 | Ga0068868_10000020610 | 142 |
| 240 | 3300005338 | Ga0068868_100000862 | Ga0068868_1000008629 | 142 |
| 241 | 3300005340 | Ga0070689_100005284 | Ga0070689_1000052843 | 142 |
| 242 | 3300005343 | Ga0070687_100003380 | Ga0070687_1000033804 | 142 |
| 243 | 3300005345 | Ga0070692_10079158 | Ga0070692_100791581 | 142 |
| 244 | 3300005354 | Ga0070675_100000013 | Ga0070675_10000001321 | 142 |
| 245 | 3300005354 | Ga0070675_100665024 | Ga0070675_1006650242 | 142 |
| 246 | 3300005356 | Ga0070674_100439755 | Ga0070674_1004397552 | 142 |
| 247 | 3300005364 | Ga0070673_100051252 | Ga0070673_1000512523 | 142 |
| 248 | 3300005364 | Ga0070673_101782269 | Ga0070673_1017822691 | 142 |
| 249 | 3300005434 | Ga0070709_10894762 | Ga0070709_108947621 | 142 |
| 250 | 3300005438 | Ga0070701_10009560 | Ga0070701_100095603 | 142 |
| 251 | 3300005445 | Ga0070708_100015602 | Ga0070708_1000156024 | 142 |
| 252 | 3300005445 | Ga0070708_100073265 | Ga0070708_1000732653 | 142 |
| 253 | 3300005445 | Ga0070708_100222534 | Ga0070708_1002225342 | 142 |
| 254 | 3300005445 | Ga0070708_100659342 | Ga0070708_1006593421 | 142 |
| 255 | 3300005458 | Ga0070681_10752944 | Ga0070681_107529441 | 142 |
| 256 | 3300005459 | Ga0068867_101700035 | Ga0068867_1017000351 | 142 |
| 257 | 3300005466 | Ga0070685_10002070 | Ga0070685_100020707 | 142 |
| 258 | 3300005467 | Ga0070706_100014732 | Ga0070706_1000147324 | 142 |
| 259 | 3300005467 | Ga0070706_100018935 | Ga0070706_1000189352 | 142 |
| 260 | 3300005468 | Ga0070707_100007053 | Ga0070707_1000070534 | 142 |
| 261 | 3300005468 | Ga0070707_100063383 | Ga0070707_1000633833 | 142 |
| 262 | 3300005468 | Ga0070707_100079882 | Ga0070707_1000798823 | 142 |
| 263 | 3300005468 | Ga0070707_100173297 | Ga0070707_1001732972 | 142 |
| 264 | 3300005471 | Ga0070698_100015507 | Ga0070698_1000155076 | 142 |
| 265 | 3300005471 | Ga0070698_100550098 | Ga0070698_1005500982 | 142 |
| 266 | 3300005471 | Ga0070698_100728233 | Ga0070698_1007282333 | 142 |
| 267 | 3300005471 | Ga0070698_100730260 | Ga0070698_1007302602 | 142 |
| 268 | 3300005518 | Ga0070699_100008724 | Ga0070699_1000087246 | 142 |
| 269 | 3300005518 | Ga0070699_100238755 | Ga0070699_1002387551 | 142 |
| 270 | 3300005518 | Ga0070699_100320362 | Ga0070699_1003203622 | 142 |
| 271 | 3300005530 | Ga0070679_100330368 | Ga0070679_1003303682 | 142 |
| 272 | 3300005535 | Ga0070684_100000071 | Ga0070684_10000007161 | 142 |
| 273 | 3300005535 | Ga0070684_100892985 | Ga0070684_1008929852 | 142 |
| 274 | 3300005536 | Ga0070697_100025867 | Ga0070697_1000258673 | 142 |
| 275 | 3300005536 | Ga0070697_101886363 | Ga0070697_1018863631 | 142 |
| 276 | 3300005539 | Ga0068853_100347564 | Ga0068853_1003475641 | 142 |
| 277 | 3300005543 | Ga0070672_100000375 | Ga0070672_1000003755 | 142 |
| 278 | 3300005546 | Ga0070696_100000071 | Ga0070696_10000007126 | 142 |
| 279 | 3300005578 | Ga0068854_100010306 | Ga0068854_1000103064 | 142 |
| 280 | 3300005578 | Ga0068854_100272828 | Ga0068854_1002728282 | 142 |
| 281 | 3300005615 | Ga0070702_100194536 | Ga0070702_1001945361 | 142 |
| 282 | 3300005617 | Ga0068859_101393538 | Ga0068859_1013935382 | 142 |
| 283 | 3300005618 | Ga0068864_100000026 | Ga0068864_10000002627 | 142 |
| 284 | 3300005618 | Ga0068864_101055208 | Ga0068864_1010552082 | 142 |
| 285 | 3300005842 | Ga0068858_100003230 | Ga0068858_1000032303 | 142 |
| 286 | 3300005842 | Ga0068858_100286898 | Ga0068858_1002868982 | 142 |
| 287 | 3300006028 | Ga0070717_10681102 | Ga0070717_106811022 | 142 |
| 288 | 3300006028 | Ga0070717_10741504 | Ga0070717_107415042 | 142 |
| 289 | 3300006173 | Ga0070716_100731126 | Ga0070716_1007311262 | 142 |
| 290 | 3300006173 | Ga0070716_101005108 | Ga0070716_1010051081 | 142 |
| 291 | 3300006173 | Ga0070716_101027386 | Ga0070716_1010273861 | 142 |
| 292 | 3300006237 | Ga0097621_101080840 | Ga0097621_1010808402 | 142 |
| 293 | 3300006358 | Ga0068871_100176019 | Ga0068871_1001760192 | 142 |
| 294 | 3300006844 | Ga0075428_100012693 | Ga0075428_1000126936 | 142 |
| 295 | 3300006844 | Ga0075428_100895761 | Ga0075428_1008957611 | 142 |
| 296 | 3300006847 | Ga0075431_100012577 | Ga0075431_1000125779 | 142 |
| 297 | 3300006852 | Ga0075433_11578112 | Ga0075433_115781121 | 142 |
| 298 | 3300006871 | Ga0075434_100102273 | Ga0075434_1001022732 | 142 |
| 299 | 3300006871 | Ga0075434_100655481 | Ga0075434_1006554811 | 142 |
| 300 | 3300006880 | Ga0075429_100200725 | Ga0075429_1002007253 | 142 |
| 301 | 3300006914 | Ga0075436_101150493 | Ga0075436_1011504931 | 142 |
| 302 | 3300006931 | Ga0097620_101393364 | Ga0097620_1013933642 | 142 |
| 303 | 3300007076 | Ga0075435_100043823 | Ga0075435_1000438232 | 142 |
| 304 | 3300007076 | Ga0075435_100179096 | Ga0075435_1001790963 | 142 |
| 305 | 3300009094 | Ga0111539_10000004 | Ga0111539_10000004613 | 142 |
| 306 | 3300009098 | Ga0105245_10000005 | Ga0105245_10000005165 | 142 |
| 307 | 3300009098 | Ga0105245_10004113 | Ga0105245_100041138 | 142 |
| 308 | 3300009098 | Ga0105245_10352716 | Ga0105245_103527162 | 142 |
| 309 | 3300009101 | Ga0105247_10123156 | Ga0105247_101231561 | 142 |
| 310 | 3300009147 | Ga0114129_10136378 | Ga0114129_101363784 | 142 |
| 311 | 3300009147 | Ga0114129_10567148 | Ga0114129_105671482 | 142 |
| 312 | 3300009147 | Ga0114129_11548825 | Ga0114129_115488252 | 142 |
| 313 | 3300009551 | Ga0105238_10000029 | Ga0105238_1000002974 | 142 |
| 314 | 3300010375 | Ga0105239_10423518 | Ga0105239_104235182 | 142 |
| 315 | 3300011119 | Ga0105246_11093905 | Ga0105246_110939051 | 142 |
| 316 | 3300013105 | Ga0157369_10000232 | Ga0157369_1000023257 | 142 |
| 317 | 3300013296 | Ga0157374_10000008 | Ga0157374_10000008278 | 142 |
| 318 | 3300013297 | Ga0157378_10000013 | Ga0157378_1000001396 | 142 |
| 319 | 3300013297 | Ga0157378_10000109 | Ga0157378_1000010970 | 142 |
| 320 | 3300013297 | Ga0157378_10018563 | Ga0157378_100185634 | 142 |
| 321 | 3300013307 | Ga0157372_13153801 | Ga0157372_131538011 | 142 |
| 322 | 3300013308 | Ga0157375_10000022 | Ga0157375_1000002269 | 142 |
| 323 | 3300013308 | Ga0157375_10000032 | Ga0157375_10000032110 | 142 |
| 324 | 3300013308 | Ga0157375_10004303 | Ga0157375_100043034 | 142 |
| 325 | 3300013308 | Ga0157375_11986814 | Ga0157375_119868142 | 142 |
| 326 | 3300014325 | Ga0163163_10373517 | Ga0163163_103735172 | 142 |
| 327 | 3300014326 | Ga0157380_10591145 | Ga0157380_105911452 | 142 |
| 328 | 3300014745 | Ga0157377_10000012 | Ga0157377_10000012165 | 142 |
| 329 | 3300014745 | Ga0157377_10580295 | Ga0157377_105802952 | 142 |
| 330 | 3300014969 | Ga0157376_10000013 | Ga0157376_1000001344 | 142 |
| 331 | 3300021358 | Ga0213873_10000001 | Ga0213873_100000011320 | 142 |
| 332 | 3300021384 | Ga0213876_10000002 | Ga0213876_10000002220 | 142 |
| 333 | 3300021384 | Ga0213876_10003270 | Ga0213876_100032702 | 142 |
| 334 | 3300021384 | Ga0213876_10004005 | Ga0213876_100040055 | 142 |
| 335 | 3300021388 | Ga0213875_10257163 | Ga0213875_102571632 | 142 |
| 336 | 3300025908 | Ga0207643_11086408 | Ga0207643_110864081 | 142 |
| 337 | 3300025910 | Ga0207684_10027996 | Ga0207684_100279964 | 142 |
| 338 | 3300025910 | Ga0207684_10122298 | Ga0207684_101222982 | 142 |
| 339 | 3300025910 | Ga0207684_10250702 | Ga0207684_102507022 | 142 |
| 340 | 3300025912 | Ga0207707_10601402 | Ga0207707_106014021 | 142 |
| 341 | 3300025918 | Ga0207662_10117838 | Ga0207662_101178382 | 142 |
| 342 | 3300025921 | Ga0207652_10532489 | Ga0207652_105324892 | 142 |
| 343 | 3300025922 | Ga0207646_10012149 | Ga0207646_100121496 | 142 |
| 344 | 3300025922 | Ga0207646_10033956 | Ga0207646_100339564 | 142 |
| 345 | 3300025922 | Ga0207646_10713412 | Ga0207646_107134121 | 142 |
| 346 | 3300025924 | Ga0207694_10000002 | Ga0207694_10000002103 | 142 |
| 347 | 3300025924 | Ga0207694_10000003 | Ga0207694_10000003997 | 142 |
| 348 | 3300025925 | Ga0207650_10000026 | Ga0207650_10000026187 | 142 |
| 349 | 3300025925 | Ga0207650_10664061 | Ga0207650_106640612 | 142 |
| 350 | 3300025926 | Ga0207659_10000068 | Ga0207659_1000006821 | 142 |
| 351 | 3300025927 | Ga0207687_10000005 | Ga0207687_10000005235 | 142 |
| 352 | 3300025927 | Ga0207687_10006157 | Ga0207687_100061574 | 142 |
| 353 | 3300025927 | Ga0207687_10152974 | Ga0207687_101529742 | 142 |
| 354 | 3300025931 | Ga0207644_11228634 | Ga0207644_112286341 | 142 |
| 355 | 3300025936 | Ga0207670_10010009 | Ga0207670_100100093 | 142 |
| 356 | 3300025937 | Ga0207669_10165241 | Ga0207669_101652412 | 142 |
| 357 | 3300025938 | Ga0207704_10031829 | Ga0207704_100318292 | 142 |
| 358 | 3300025939 | Ga0207665_10206242 | Ga0207665_102062422 | 142 |
| 359 | 3300025940 | Ga0207691_10000551 | Ga0207691_1000055124 | 142 |
| 360 | 3300025942 | Ga0207689_10003043 | Ga0207689_100030432 | 142 |
| 361 | 3300025942 | Ga0207689_11304800 | Ga0207689_113048001 | 142 |
| 362 | 3300025944 | Ga0207661_10000022 | Ga0207661_1000002244 | 142 |
| 363 | 3300025944 | Ga0207661_10545145 | Ga0207661_105451451 | 142 |
| 364 | 3300025945 | Ga0207679_10644726 | Ga0207679_106447261 | 142 |
| 365 | 3300025960 | Ga0207651_10009580 | Ga0207651_100095802 | 142 |
| 366 | 3300025960 | Ga0207651_11432342 | Ga0207651_114323421 | 142 |
| 367 | 3300025981 | Ga0207640_10001424 | Ga0207640_100014242 | 142 |
| 368 | 3300025981 | Ga0207640_10141731 | Ga0207640_101417312 | 142 |
| 369 | 3300026023 | Ga0207677_10000048 | Ga0207677_1000004884 | 142 |
| 370 | 3300026023 | Ga0207677_10000121 | Ga0207677_1000012142 | 142 |
| 371 | 3300026035 | Ga0207703_10000034 | Ga0207703_1000003445 | 142 |
| 372 | 3300026035 | Ga0207703_10256635 | Ga0207703_102566352 | 142 |
| 373 | 3300026041 | Ga0207639_10285365 | Ga0207639_102853652 | 142 |
| 374 | 3300026095 | Ga0207676_10000011 | Ga0207676_10000011241 | 142 |
| 375 | 3300026118 | Ga0207675_100909155 | Ga0207675_1009091551 | 142 |
| 376 | 3300027907 | Ga0207428_10000025 | Ga0207428_10000025235 | 142 |
| 377 | 3300030521 | Ga0307511_10020270 | Ga0307511_100202704 | 142 |
| 378 | 3300031241 | Ga0265325_10360347 | Ga0265325_103603471 | 142 |
| 379 | 3300031911 | Ga0307412_11894855 | Ga0307412_118948551 | 142 |
| 380 | 3300032002 | Ga0307416_100710995 | Ga0307416_1007109952 | 142 |
| 381 | 3300035088 | Ga0373940_0045013 | Ga0373940_0045013_515_943 | 142 |
| 382 | 3300035112 | Ga0373932_0000115 | Ga0373932_0000115_12243_12677 | 142 |
| 383 | 3300035115 | Ga0373941_0007734 | Ga0373941_0007734_686_1117 | 142 |
| 384 | 3300035170 | Ga0373943_0060244 | Ga0373943_0060244_170_598 | 142 |
| 385 | 3300037853 | Ga0436364_1178622 | Ga0436364_1178622_329_766 | 142 |
| 386 | 3300039437 | Ga0436365_0169042 | Ga0436365_0169042_170_598 | 142 |
| 387 | 3300039437 | Ga0436365_0703007 | Ga0436365_0703007_1395_1829 | 142 |
| 388 | 3300039437 | Ga0436365_0816620 | Ga0436365_0816620_3625_4053 | 142 |
| 389 | 3300039437 | Ga0436365_0862132 | Ga0436365_0862132_128353_128787 | 142 |
| 390 | 3300039437 | Ga0436365_1330752 | Ga0436365_1330752_490_918 | 142 |
| 391 | 3300039437 | Ga0436365_1852133 | Ga0436365_1852133_2015_2443 | 142 |
| 392 | 3300039453 | Ga0436362_0842419 | Ga0436362_0842419_195279_195713 | 142 |
| 393 | 3300041494 | Ga0451837_0407641 | Ga0451837_0407641_60_494 | 142 |
| 394 | 3300044673 | Ga0453683_0108722 | Ga0453683_0108722_676_1104 | 142 |
| 395 | 3300044712 | Ga0453684_1936318 | Ga0453684_1936318_42_473 | 142 |
| 396 | 3300046515 | Ga0495620_0001133 | Ga0495620_0001133_6616_7053 | 142 |
| 397 | 3300046537 | Ga0495598_0119021 | Ga0495598_0119021_10_444 | 142 |
| 398 | 3300047318 | Ga0495636_0571060 | Ga0495636_0571060_48_485 | 142 |
| 399 | 3300047320 | Ga0495672_0242199 | Ga0495672_0242199_334_774 | 142 |
| 400 | 3300049589 | Ga0501073_0004921 | Ga0501073_0004921_1308_1742 | 142 |
| 401 | 3300049590 | Ga0501074_0957403 | Ga0501074_0957403_30_464 | 142 |
| 402 | 3300049742 | Ga0501080_0031036 | Ga0501080_0031036_318_752 | 142 |
| 403 | 3300049743 | Ga0501081_1176682 | Ga0501081_1176682_117_557 | 142 |
| 404 | 3300050507 | nmdc:mga05p37_1481193_c1 | nmdc:mga05p37_1481193_c1_77_505 | 142 |
| 405 | 3300050510 | nmdc:mga06r32_27269_c1 | nmdc:mga06r32_27269_c1_642_1076 | 142 |
| 406 | 3300050511 | nmdc:mga08y16_5_c1 | nmdc:mga08y16_5_c1_24521_24955 | 142 |
| 407 | 3300050512 | nmdc:mga0n895_238781_c1 | nmdc:mga0n895_238781_c1_709_1143 | 142 |
| 408 | 3300050513 | nmdc:mga0rr50_40122_c1 | nmdc:mga0rr50_40122_c1_862_1293 | 142 |
| 409 | 3300050513 | nmdc:mga0rr50_7437_c1 | nmdc:mga0rr50_7437_c1_2399_2827 | 142 |
| 410 | 3300050514 | nmdc:mga08x19_319980_c1 | nmdc:mga08x19_319980_c1_23_451 | 142 |
| 411 | 3300050515 | nmdc:mga0a205_939914_c1 | nmdc:mga0a205_939914_c1_226_657 | 142 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3fhk-assembly1.cif.gz_A | crystal structure of apc1446, b.subtilis yphp disulfide isomerase | 0.9588 | 4 | 137 |
| 7rzb-assembly1.cif.gz_A-2 | brxa from staphylococcus aureus with bacillithiol mixed disulfide | 0.9453 | 3 | 138 |
| 7rzb-assembly1.cif.gz_A-2 | brxa from staphylococcus aureus with bacillithiol mixed disulfide | 0.9256 | 3 | 138 |
| 3fhk-assembly1.cif.gz_A | crystal structure of apc1446, b.subtilis yphp disulfide isomerase | 0.9002 | 4 | 137 |
| 3iv4-assembly1.cif.gz_A | a putative oxidoreductase with a thioredoxin fold | 0.8224 | 19 | 134 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FY55_25_142_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9657 | 20 | 137 | 3.40.30.10 |
| af_Q2FY55_25_142_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9499 | 20 | 137 | 3.40.30.10 |
| af_Q2FYK4_24_144_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9263 | 19 | 137 | 3.40.30.10 |
| af_Q2FYK4_24_144_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9047 | 19 | 137 | 3.40.30.10 |
| af_I1NE04_569_675_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8069 | 19 | 136 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3M2C6P9-F1-model_v4 | BrxA/BrxB family bacilliredoxin | 0.9827 | 2 | 137 |
|
| AF-A0A2V9WJV3-F1-model_v4 | BrxA/BrxB family bacilliredoxin | 0.9809 | 1 | 142 |
|
| AF-A0A2E6NKF6-F1-model_v4 | BrxA/BrxB family bacilliredoxin | 0.9803 | 1 | 142 |
|
| AF-A0A2E3A8F5-F1-model_v4 | BrxA/BrxB family bacilliredoxin | 0.9772 | 2 | 139 |
|
| AF-A0A7C4Y0K2-F1-model_v4 | BrxA/BrxB family bacilliredoxin | 0.9772 | 54 | 138 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar