F437503

General Info

Members Datasets Scaffolds Average Seq Length
411 272 822 93

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_11332334|Ga0111539_113323341
Length 106
Sequence MHSNPAHEGDHMKDKRGRIGSSHDDYLKEEGIYEEVTARAIKRVIARQLDALMREQGLTKSALAKRMHTSRAQLDRLLDPENESVTLATLTRAARVVGRQLRMELV

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
75 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
100 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
101 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
102 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
147 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
152 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
153 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
154 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
158 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
159 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
160 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
161 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
162 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
163 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
164 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
165 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
166 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
167 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
168 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
169 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
172 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
173 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
174 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
175 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
176 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
177 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
178 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
182 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
183 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
184 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
185 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
186 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
187 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
188 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
189 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
190 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
191 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
194 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
195 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
196 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
197 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
198 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
199 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
200 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
201 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
202 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
203 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
204 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
205 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
206 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
207 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
208 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
209 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
210 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
211 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
212 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
213 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
214 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
215 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
216 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
217 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
218 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
219 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
220 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
221 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
222 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
223 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
224 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
225 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
226 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
227 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
228 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
231 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
232 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
235 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
236 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
237 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
238 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
239 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
240 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
241 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
242 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
243 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
248 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
249 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
250 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
251 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
252 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
253 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
254 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
255 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
257 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
258 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
259 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
260 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
261 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
262 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
263 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
264 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
265 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
266 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
267 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
268 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
269 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
270 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
271 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
272 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.59
Metatranscriptomes 1.95
Isolates 1.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.97
Nodule 0.24
Rhizoplane 1.7
Rhizosphere 89.78
Stem 0
Stem Tuber 0
Unclassified 30.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_11332334 3300009094 Unclassified 833
2 JGI25406J46586_10000165 3300003203 Bacteria 29331
3 JGI25405J52794_10034957 3300003911 Unclassified 1051
4 Ga0065714_10082371 3300005288 Bacteria 2306
5 Ga0070676_10873548 3300005328 Unclassified 668
6 Ga0070683_100282101 3300005329 Bacteria 1580
7 Ga0070683_101516685 3300005329 Bacteria 644
8 Ga0070683_102023347 3300005329 Unclassified 553
9 Ga0070690_100401855 3300005330 Unclassified 1006
10 Ga0070690_101270936 3300005330 Unclassified 589
11 Ga0070670_100242757 3300005331 Unclassified 1568
12 Ga0070666_10227167 3300005335 Unclassified 1318
13 Ga0070680_100369772 3300005336 Unclassified 1220
14 Ga0070680_100939498 3300005336 Bacteria 746
15 Ga0068868_100651542 3300005338 Unclassified 938
16 Ga0070689_100893074 3300005340 Bacteria 786
17 Ga0070691_11023672 3300005341 Bacteria 516
18 Ga0070661_100012870 3300005344 Bacteria 5860
19 Ga0070661_100587497 3300005344 Unclassified 899
20 Ga0070668_100837527 3300005347 Unclassified 819
21 Ga0070669_100226911 3300005353 Unclassified 1479
22 Ga0070675_100009625 3300005354 Bacteria 7519
23 Ga0070671_100345538 3300005355 Unclassified 1269
24 Ga0070671_101935787 3300005355 Unclassified 524
25 Ga0070673_100321233 3300005364 Unclassified 1367
26 Ga0070667_100271247 3300005367 Unclassified 1521
27 Ga0070667_101662649 3300005367 Unclassified 600
28 Ga0070709_10406871 3300005434 Bacteria 1017
29 Ga0070709_10910091 3300005434 Unclassified 696
30 Ga0070709_11202558 3300005434 Unclassified 609
31 Ga0070714_100060688 3300005435 Bacteria 3246
32 Ga0070713_101245148 3300005436 Unclassified 721
33 Ga0070713_101413247 3300005436 Bacteria 675
34 Ga0070701_10539783 3300005438 Unclassified 763
35 Ga0070711_100323502 3300005439 Bacteria 1233
36 Ga0070705_100683325 3300005440 Unclassified 804
37 Ga0070700_100297048 3300005441 Bacteria 1177
38 Ga0070694_101160266 3300005444 Unclassified 646
39 Ga0070663_100143062 3300005455 Bacteria 1828
40 Ga0070678_100768667 3300005456 Unclassified 872
41 Ga0070681_10373932 3300005458 Bacteria 1335
42 Ga0068867_100235539 3300005459 Unclassified 1482
43 Ga0068867_101137684 3300005459 Bacteria 714
44 Ga0070706_100105457 3300005467 Unclassified 2622
45 Ga0070707_100462876 3300005468 Unclassified 1229
46 Ga0070698_101169551 3300005471 Bacteria 718
47 Ga0070699_100146506 3300005518 Unclassified 2086
48 Ga0070679_100401990 3300005530 Bacteria 1316
49 Ga0070684_100072217 3300005535 Bacteria 3038
50 Ga0070684_100817960 3300005535 Bacteria 871
51 Ga0070697_100060911 3300005536 Unclassified 3077
52 Ga0070697_100968500 3300005536 Bacteria 756
53 Ga0068853_100147814 3300005539 Bacteria 2113
54 Ga0070672_100055782 3300005543 Plasmid 3096
55 Ga0070695_100339900 3300005545 Bacteria 1121
56 Ga0070696_100323454 3300005546 Bacteria 1187
57 Ga0070693_101162093 3300005547 Bacteria 591
58 Ga0070665_100745514 3300005548 Bacteria 992
59 Ga0068855_100542690 3300005563 Bacteria 1259
60 Ga0070664_100894874 3300005564 Bacteria 832
61 Ga0070664_102402903 3300005564 Unclassified 500
62 Ga0068857_101384356 3300005577 Unclassified 684
63 Ga0068854_100525190 3300005578 Bacteria 1000
64 Ga0068856_101394799 3300005614 Unclassified 715
65 Ga0068856_102452210 3300005614 Unclassified 529
66 Ga0068859_100222997 3300005617 Unclassified 1973
67 Ga0068864_100582079 3300005618 Unclassified 1085
68 Ga0068866_10259109 3300005718 Bacteria 1068
69 Ga0068861_100869283 3300005719 Unclassified 851
70 Ga0068870_10146269 3300005840 Unclassified 1387
71 Ga0068863_100109248 3300005841 Plasmid 2632
72 Ga0068862_100075858 3300005844 Bacteria 2909
73 Ga0068862_100249266 3300005844 Bacteria 1618
74 Ga0068862_100409153 3300005844 Bacteria 1270
75 Ga0081455_10021662 3300005937 Bacteria 6022
76 Ga0081538_10012348 3300005981 Bacteria 6848
77 Ga0081539_10000255 3300005985 Bacteria 123054
78 Ga0081539_10039688 3300005985 Bacteria 2774
79 Ga0070717_10136124 3300006028 Bacteria 2116
80 Ga0070717_10188641 3300006028 Unclassified 1800
81 Ga0070717_11921573 3300006028 Bacteria 534
82 Ga0070716_101399896 3300006173 Unclassified 568
83 Ga0070712_100470911 3300006175 Unclassified 1049
84 Ga0070712_101588445 3300006175 Unclassified 572
85 Ga0075367_10223810 3300006178 Bacteria 1178
86 Ga0097621_100005894 3300006237 Bacteria 8660
87 Ga0068871_100101786 3300006358 Unclassified 2407
88 Ga0075428_100067064 3300006844 Bacteria 3929
89 Ga0075428_101186208 3300006844 Bacteria 805
90 Ga0075430_100018426 3300006846 Bacteria 5940
91 Ga0075431_100060438 3300006847 Bacteria 3910
92 Ga0075431_100654472 3300006847 Bacteria 1031
93 Ga0075429_100079764 3300006880 Bacteria 2853
94 Ga0075429_101208597 3300006880 Bacteria 660
95 Ga0075429_101216457 3300006880 Unclassified 657
96 Ga0068865_101053473 3300006881 Unclassified 714
97 Ga0068865_101787050 3300006881 Bacteria 555
98 Ga0075436_100629284 3300006914 Unclassified 792
99 Ga0097620_100222977 3300006931 Unclassified 1973
100 Ga0099794_10003749 3300007265 Bacteria 5853
101 Ga0099794_10046190 3300007265 Bacteria 2085
102 Ga0099794_10075863 3300007265 Bacteria 1652
103 Ga0099794_10085662 3300007265 Bacteria 1559
104 Ga0099794_10088897 3300007265 Unclassified 1531
105 Ga0099794_10118574 3300007265 Unclassified 1330
106 Ga0099794_10170106 3300007265 Bacteria 1110
107 Ga0099795_10046269 3300007788 Bacteria 1567
108 Ga0105240_10002308 3300009093 Bacteria 30862
109 Ga0105240_10429979 3300009093 Bacteria 1482
110 Ga0105240_10585750 3300009093 Unclassified 1230
111 Ga0111539_11149401 3300009094 Bacteria 902
112 Ga0105245_10434468 3300009098 Bacteria 1318
113 Ga0105245_10772423 3300009098 Bacteria 998
114 Ga0105245_11279326 3300009098 Unclassified 782
115 Ga0105247_10330826 3300009101 Bacteria 1066
116 Ga0105243_11541910 3300009148 Bacteria 689
117 Ga0105241_12471685 3300009174 Unclassified 520
118 Ga0105242_10172574 3300009176 Unclassified 1901
119 Ga0105248_10159225 3300009177 Plasmid 2547
120 Ga0105248_10295177 3300009177 Bacteria 1825
121 Ga0105248_12359056 3300009177 Bacteria 606
122 Ga0105238_10056537 3300009551 Unclassified 3936
123 Ga0099796_10022442 3300010159 Bacteria 1958
124 Ga0105239_10987572 3300010375 Bacteria 968
125 Ga0105246_10446990 3300011119 Unclassified 1085
126 Ga0157373_10582409 3300013100 Bacteria 813
127 Ga0157370_10009616 3300013104 Bacteria 10291
128 Ga0157369_10072073 3300013105 Bacteria 3708
129 Ga0157369_11839534 3300013105 Bacteria 615
130 Ga0157369_12650466 3300013105 Unclassified 506
131 Ga0157374_10039849 3300013296 Bacteria 4325
132 Ga0157378_10430724 3300013297 Unclassified 1305
133 Ga0157378_10830533 3300013297 Unclassified 951
134 Ga0157378_11277881 3300013297 Bacteria 775
135 Ga0163162_10191351 3300013306 Bacteria 2174
136 Ga0163162_11320097 3300013306 Unclassified 820
137 Ga0157372_11204942 3300013307 Bacteria 875
138 Ga0157372_11492477 3300013307 Bacteria 779
139 Ga0157372_12000266 3300013307 Unclassified 666
140 Ga0157375_10121445 3300013308 Plasmid 2722
141 Ga0163163_10014250 3300014325 Bacteria 7307
142 Ga0163163_11204251 3300014325 Bacteria 820
143 Ga0182008_10001279 3300014497 Bacteria 17262
144 Ga0157379_10164900 3300014968 Bacteria 2000
145 Ga0157379_10467440 3300014968 Bacteria 1166
146 Ga0157376_10005326 3300014969 Bacteria 8981
147 Ga0182006_1000004 3300015261 Bacteria 622190
148 Ga0182007_10000028 3300015262 Bacteria 167122
149 Ga0182005_1000011 3300015265 Bacteria 420605
150 Ga0182005_1077668 3300015265 Bacteria 915
151 Ga0206351_10992221 3300020077 Unclassified 513
152 Ga0206350_10724632 3300020080 Unclassified 930
153 Ga0213876_10052821 3300021384 Bacteria 2147
154 Ga0224712_10111029 3300022467 Bacteria 1176
155 Ga0207655_1219392 3300025728 Bacteria 555
156 Ga0207688_10008286 3300025901 Bacteria 5651
157 Ga0207699_10407363 3300025906 Bacteria 969
158 Ga0207699_10619960 3300025906 Bacteria 789
159 Ga0207643_10080348 3300025908 Unclassified 1889
160 Ga0207707_10715085 3300025912 Bacteria 840
161 Ga0207707_10724935 3300025912 Bacteria 833
162 Ga0207695_10001045 3300025913 Bacteria 48612
163 Ga0207695_10004902 3300025913 Bacteria 18030
164 Ga0207695_10569247 3300025913 Bacteria 1014
165 Ga0207671_10593642 3300025914 Unclassified 883
166 Ga0207663_10271455 3300025916 Unclassified 1256
167 Ga0207660_10569548 3300025917 Bacteria 922
168 Ga0207660_11002324 3300025917 Unclassified 681
169 Ga0207649_10053664 3300025920 Bacteria 2506
170 Ga0207649_11126067 3300025920 Unclassified 619
171 Ga0207652_10322646 3300025921 Bacteria 1394
172 Ga0207694_10124221 3300025924 Unclassified 2063
173 Ga0207650_10060807 3300025925 Bacteria 2819
174 Ga0207659_10003051 3300025926 Bacteria 10002
175 Ga0207687_10416439 3300025927 Bacteria 1108
176 Ga0207687_10841937 3300025927 Unclassified 783
177 Ga0207664_10050876 3300025929 Bacteria 3269
178 Ga0207664_10060222 3300025929 Bacteria 3025
179 Ga0207644_10413198 3300025931 Bacteria 1104
180 Ga0207644_10728815 3300025931 Unclassified 827
181 Ga0207686_10104389 3300025934 Bacteria 1898
182 Ga0207670_11020197 3300025936 Bacteria 697
183 Ga0207670_11473641 3300025936 Unclassified 578
184 Ga0207669_11777153 3300025937 Unclassified 527
185 Ga0207691_10525540 3300025940 Unclassified 1004
186 Ga0207711_11648369 3300025941 Bacteria 585
187 Ga0207711_12071333 3300025941 Unclassified 512
188 Ga0207661_10567852 3300025944 Bacteria 1040
189 Ga0207661_10573447 3300025944 Bacteria 1035
190 Ga0207679_10104256 3300025945 Bacteria 2225
191 Ga0207667_10267796 3300025949 Bacteria 1747
192 Ga0207651_10047286 3300025960 Plasmid 2900
193 Ga0207640_10531414 3300025981 Bacteria 985
194 Ga0207658_10170782 3300025986 Unclassified 1791
195 Ga0207658_10830513 3300025986 Bacteria 840
196 Ga0207677_10916468 3300026023 Unclassified 791
197 Ga0207639_10075745 3300026041 Bacteria 2647
198 Ga0207678_10982140 3300026067 Bacteria 747
199 Ga0207708_11850789 3300026075 Unclassified 529
200 Ga0207702_10123911 3300026078 Bacteria 2317
201 Ga0207641_10489902 3300026088 Unclassified 1192
202 Ga0207648_10397966 3300026089 Bacteria 1247
203 Ga0207676_10084370 3300026095 Bacteria 2589
204 Ga0207675_100255767 3300026118 Bacteria 1696
205 Ga0207675_101008705 3300026118 Unclassified 851
206 Ga0207683_10059016 3300026121 Bacteria 3369
207 Ga0209179_1028034 3300027512 Bacteria 1139
208 Ga0209588_1001356 3300027671 Bacteria 6377
209 Ga0209588_1013501 3300027671 Bacteria 2491
210 Ga0209588_1034703 3300027671 Unclassified 1621
211 Ga0209588_1043596 3300027671 Bacteria 1450
212 Ga0209588_1073409 3300027671 Unclassified 1105
213 Ga0209588_1079432 3300027671 Bacteria 1060
214 Ga0265354_1001419 3300028016 Bacteria 3449
215 Ga0265357_1000675 3300028023 Bacteria 2151
216 Ga0268266_10282713 3300028379 Bacteria 1543
217 Ga0268266_10677161 3300028379 Bacteria 993
218 Ga0268265_10257573 3300028380 Bacteria 1549
219 Ga0268264_10044080 3300028381 Bacteria 3699
220 Ga0268264_10485210 3300028381 Bacteria 1203
221 Ga0268264_11609556 3300028381 Unclassified 660
222 Ga0265323_10076385 3300028653 Bacteria 1137
223 Ga0265338_10098541 3300028800 Bacteria 2391
224 Ga0265338_10887762 3300028800 Unclassified 608
225 Ga0265324_10169057 3300029957 Bacteria 742
226 Ga0265770_1009836 3300030878 Unclassified 1382
227 Ga0265770_1053457 3300030878 Bacteria 736
228 Ga0265765_1007588 3300030879 Bacteria 1170
229 Ga0265765_1013799 3300030879 Bacteria 927
230 Ga0265760_10009421 3300031090 Unclassified 2789
231 Ga0265330_10072794 3300031235 Bacteria 1486
232 Ga0265330_10314647 3300031235 Bacteria 660
233 Ga0265332_10307128 3300031238 Bacteria 655
234 Ga0265332_10346651 3300031238 Unclassified 613
235 Ga0265328_10022269 3300031239 Bacteria 2413
236 Ga0265320_10001377 3300031240 Bacteria 17679
237 Ga0265325_10004668 3300031241 Bacteria 8593
238 Ga0265325_10008225 3300031241 Bacteria 6172
239 Ga0265325_10195621 3300031241 Bacteria 935
240 Ga0265340_10022379 3300031247 Unclassified 3232
241 Ga0265340_10238226 3300031247 Unclassified 812
242 Ga0265340_10424634 3300031247 Bacteria 586
243 Ga0265339_10023977 3300031249 Bacteria 3521
244 Ga0265339_10061922 3300031249 Bacteria 2012
245 Ga0265339_10208929 3300031249 Bacteria 959
246 Ga0265331_10004657 3300031250 Bacteria 8501
247 Ga0265331_10137784 3300031250 Bacteria 1111
248 Ga0265331_10172318 3300031250 Unclassified 979
249 Ga0265331_10226021 3300031250 Bacteria 841
250 Ga0265331_10454209 3300031250 Unclassified 576
251 Ga0265316_10002549 3300031344 Bacteria 18826
252 Ga0265316_10017918 3300031344 Bacteria 6105
253 Ga0265316_10021628 3300031344 Bacteria 5442
254 Ga0265316_10159069 3300031344 Bacteria 1689
255 Ga0265316_10280155 3300031344 Bacteria 1218
256 Ga0265316_10345400 3300031344 Bacteria 1078
257 Ga0265313_10152863 3300031595 Unclassified 985
258 Ga0265313_10250673 3300031595 Bacteria 722
259 Ga0265313_10404630 3300031595 Bacteria 535
260 Ga0265314_10117680 3300031711 Bacteria 1678
261 Ga0265314_10119496 3300031711 Unclassified 1661
262 Ga0265342_10078211 3300031712 Bacteria 1914
263 Ga0265342_10228850 3300031712 Bacteria 999
264 Ga0265342_10270967 3300031712 Bacteria 901
265 Ga0265342_10300680 3300031712 Unclassified 845
266 Ga0307516_10670585 3300031730 Bacteria 693
267 Ga0307414_11316483 3300032004 Bacteria 670
268 Ga0316212_1003400 3300033547 Bacteria 2297
269 Ga0373926_0015787 3300035083 Bacteria 2577
270 Ga0373944_0420770 3300035089 Unclassified 517
271 Ga0373943_0043374 3300035170 Bacteria 2184
272 Ga0373943_0100210 3300035170 Unclassified 1514
273 Ga0373946_0415264 3300035171 Bacteria 681
274 Ga0373927_0001693 3300035695 Bacteria 16467
275 Ga0373927_0023468 3300035695 Bacteria 4040
276 Ga0373927_0023784 3300035695 Bacteria 4010
277 Ga0373933_0554633 3300035724 Unclassified 754
278 Ga0373947_0000055 3300035725 Bacteria 56308
279 Ga0373947_0051596 3300035725 Bacteria 2475
280 Ga0373947_0085253 3300035725 Bacteria 1962
281 Ga0373937_0104350 3300036401 Bacteria 2634
282 Ga0373925_0000936 3300037068 Bacteria 26614
283 Ga0373925_0085005 3300037068 Bacteria 2412
284 Ga0436364_0044578 3300037853 Unclassified 988
285 Ga0436364_0054874 3300037853 Bacteria 788
286 Ga0436364_0504711 3300037853 Bacteria 2110
287 Ga0436364_0901304 3300037853 Bacteria 712
288 Ga0436364_1117181 3300037853 Bacteria 778
289 Ga0436364_1280830 3300037853 Bacteria 1102
290 Ga0436365_0444792 3300039437 Unclassified 759
291 Ga0436365_1000920 3300039437 Bacteria 3503
292 Ga0436360_0347949 3300039438 Bacteria 1059
293 Ga0436360_0367798 3300039438 Unclassified 576
294 Ga0436363_0082099 3300039450 Unclassified 896
295 Ga0436363_0326008 3300039450 Unclassified 591
296 Ga0436363_0419810 3300039450 Bacteria 513
297 Ga0436363_0767448 3300039450 Unclassified 1097
298 Ga0436363_1285887 3300039450 Unclassified 769
299 Ga0436362_0611879 3300039453 Unclassified 830
300 Ga0451807_1591115 3300041486 Bacteria 1083
301 Ga0451833_1363508 3300041491 Bacteria 668
302 Ga0451853_0007858 3300041512 Bacteria 653
303 Ga0451576_0277626 3300045051 Bacteria 1752
304 Ga0466958_0757954 3300045836 Bacteria 633
305 Ga0495592_0004390 3300046454 Bacteria 10316
306 Ga0495629_0886493 3300046459 Bacteria 585
307 Ga0495651_0057580 3300046462 Bacteria 2983
308 Ga0495580_0067660 3300046472 Bacteria 2499
309 Ga0495580_0864043 3300046472 Unclassified 583
310 Ga0495582_0923326 3300046473 Unclassified 504
311 Ga0495639_0321328 3300046475 Bacteria 774
312 Ga0495639_0548614 3300046475 Unclassified 592
313 Ga0495662_0225354 3300046476 Bacteria 924
314 Ga0495664_0001913 3300046477 Bacteria 11081
315 Ga0495664_0544130 3300046477 Unclassified 692
316 Ga0495584_0020672 3300046491 Bacteria 3344
317 Ga0495618_0418794 3300046514 Bacteria 817
318 Ga0495628_0013142 3300046516 Bacteria 6970
319 Ga0495630_0080358 3300046517 Bacteria 2459
320 Ga0495666_0497293 3300046526 Unclassified 545
321 Ga0495652_0050444 3300046529 Bacteria 3557
322 Ga0495652_0180420 3300046529 Unclassified 1621
323 Ga0495654_0010826 3300046530 Bacteria 4953
324 Ga0495665_0623618 3300046531 Bacteria 538
325 Ga0495640_0185475 3300046533 Bacteria 1324
326 Ga0495640_0781204 3300046533 Unclassified 570
327 Ga0495586_0147659 3300046535 Bacteria 1322
328 Ga0495587_0013158 3300046536 Bacteria 5203
329 Ga0495598_0047051 3300046537 Unclassified 1284
330 Ga0495645_0015436 3300046543 Bacteria 5431
331 Ga0495645_0338620 3300046543 Unclassified 972
332 Ga0495633_0002863 3300046558 Bacteria 11840
333 Ga0495667_0029183 3300046559 Bacteria 3712
334 Ga0495667_0190903 3300046559 Bacteria 1313
335 Ga0495634_0061634 3300046642 Bacteria 2493
336 Ga0495611_0386990 3300046648 Bacteria 640
337 Ga0495635_0155427 3300046663 Bacteria 1557
338 Ga0495635_0444473 3300046663 Bacteria 858
339 Ga0495599_0003289 3300046678 Bacteria 9425
340 Ga0495623_0217266 3300046679 Bacteria 1091
341 Ga0495646_0029910 3300046680 Bacteria 3402
342 Ga0495658_0020540 3300046683 Unclassified 3467
343 Ga0495624_0315922 3300046690 Bacteria 941
344 Ga0495600_0041917 3300046809 Unclassified 2984
345 Ga0495604_0935627 3300047317 Unclassified 540
346 Ga0495674_0003756 3300047319 Bacteria 14760
347 Ga0495674_0046364 3300047319 Bacteria 3858
348 Ga0495674_0354721 3300047319 Bacteria 1190
349 Ga0495680_0077535 3300047322 Bacteria 2517
350 Ga0495680_0079376 3300047322 Bacteria 2482
351 Ga0495675_0264659 3300047444 Bacteria 1029
352 Ga0495684_0091473 3300047471 Unclassified 2304
353 Ga0495684_0350476 3300047471 Unclassified 1048
354 Ga0495684_0832912 3300047471 Bacteria 600
355 Ga0495684_0863372 3300047471 Bacteria 586
356 Ga0495602_0070425 3300048088 Bacteria 2993
357 Ga0495602_0285026 3300048088 Bacteria 1215
358 Ga0496100_0503646 3300048903 Bacteria 933
359 Ga0496106_1397821 3300048909 Unclassified 541
360 Ga0496108_0827075 3300048911 Unclassified 798
361 Ga0496111_0027635 3300048914 Bacteria 4016
362 Ga0496115_0472159 3300048918 Bacteria 1011
363 Ga0496116_0035809 3300048919 Bacteria 3482
364 Ga0496117_0000011 3300048920 Bacteria 610930
365 Ga0496117_0031337 3300048920 Bacteria 4062
366 Ga0496118_0000010 3300048921 Bacteria 610930
367 Ga0496118_0057487 3300048921 Bacteria 2915
368 Ga0496121_0009436 3300048924 Bacteria 11215
369 Ga0496121_0016793 3300048924 Bacteria 7528
370 Ga0496122_0033641 3300048925 Bacteria 4211
371 Ga0496123_0002591 3300048926 Bacteria 21992
372 Ga0496124_0092846 3300048927 Bacteria 2458
373 Ga0496125_0082111 3300048928 Bacteria 2458
374 Ga0495682_0009518 3300049460 Bacteria 3791
375 Ga0501033_0116461 3300049570 Bacteria 1942
376 Ga0501034_0845166 3300049571 Unclassified 806
377 Ga0501038_0980420 3300049574 Bacteria 621
378 Ga0501047_0456996 3300049581 Bacteria 1106
379 Ga0501070_0073339 3300049586 Bacteria 2832
380 Ga0501070_0872067 3300049586 Bacteria 703
381 Ga0501072_0670024 3300049588 Unclassified 816
382 Ga0501073_0023990 3300049589 Bacteria 4380
383 Ga0501073_0283998 3300049589 Bacteria 1142
384 Ga0501209_035108 3300049656 Bacteria 1297
385 Ga0501245_136412 3300049708 Bacteria 530
386 Ga0501080_0358334 3300049742 Bacteria 1316
387 Ga0501080_0799186 3300049742 Unclassified 827
388 Ga0501083_0038652 3300049744 Bacteria 3243
389 Ga0501241_150509 3300049758 Bacteria 536
390 Ga0501035_0854256 3300049822 Bacteria 724
391 Ga0501044_0106544 3300049823 Bacteria 2815
392 Ga0501044_0132944 3300049823 Bacteria 2481
393 nmdc:mga07m45_124845_c1 3300050496 Bacteria 1488
394 nmdc:mga09592_1103009_c1 3300050508 Bacteria 660
395 nmdc:mga09592_38784_c1 3300050508 Bacteria 4000
396 nmdc:mga0qj67_72899_c1 3300050509 Bacteria 2743
397 nmdc:mga06r32_127197_c1 3300050510 Bacteria 2518
398 nmdc:mga06r32_576656_c1 3300050510 Bacteria 1097
399 nmdc:mga06r32_620544_c1 3300050510 Bacteria 1051
400 nmdc:mga0rr50_1680825_c1 3300050513 Bacteria 535
401 nmdc:mga08x19_319727_c1 3300050514 Bacteria 1080
402 Ga0495595_0215450 3300053084 Bacteria 958
403 Ga0500647_0228061 3300053091 Bacteria 830
404 Ga0500636_0359813 3300053177 Unclassified 691
405 Ga0501082_1026160 3300060353 Bacteria 721
406 2513721068 2513237104 Bacteria 10034502
407 2601669287 2600255292 Bacteria 6300551
408 2857549414 2857547612 Bacteria 6179999
409 2885084895 2885080285 Bacteria 6355622
410 2932414544 2932410948 Bacteria 6312192
411 2932420935 2932416698 Bacteria 6315112
412 Ga0111539_11332334
413 JGI25406J46586_10000165
414 JGI25405J52794_10034957
415 Ga0065714_10082371
416 Ga0070676_10873548
417 Ga0070683_100282101
418 Ga0070683_101516685
419 Ga0070683_102023347
420 Ga0070690_100401855
421 Ga0070690_101270936
422 Ga0070670_100242757
423 Ga0070666_10227167
424 Ga0070680_100369772
425 Ga0070680_100939498
426 Ga0068868_100651542
427 Ga0070689_100893074
428 Ga0070691_11023672
429 Ga0070661_100012870
430 Ga0070661_100587497
431 Ga0070668_100837527
432 Ga0070669_100226911
433 Ga0070675_100009625
434 Ga0070671_100345538
435 Ga0070671_101935787
436 Ga0070673_100321233
437 Ga0070667_100271247
438 Ga0070667_101662649
439 Ga0070709_10406871
440 Ga0070709_10910091
441 Ga0070709_11202558
442 Ga0070714_100060688
443 Ga0070713_101245148
444 Ga0070713_101413247
445 Ga0070701_10539783
446 Ga0070711_100323502
447 Ga0070705_100683325
448 Ga0070700_100297048
449 Ga0070694_101160266
450 Ga0070663_100143062
451 Ga0070678_100768667
452 Ga0070681_10373932
453 Ga0068867_100235539
454 Ga0068867_101137684
455 Ga0070706_100105457
456 Ga0070707_100462876
457 Ga0070698_101169551
458 Ga0070699_100146506
459 Ga0070679_100401990
460 Ga0070684_100072217
461 Ga0070684_100817960
462 Ga0070697_100060911
463 Ga0070697_100968500
464 Ga0068853_100147814
465 Ga0070672_100055782
466 Ga0070695_100339900
467 Ga0070696_100323454
468 Ga0070693_101162093
469 Ga0070665_100745514
470 Ga0068855_100542690
471 Ga0070664_100894874
472 Ga0070664_102402903
473 Ga0068857_101384356
474 Ga0068854_100525190
475 Ga0068856_101394799
476 Ga0068856_102452210
477 Ga0068859_100222997
478 Ga0068864_100582079
479 Ga0068866_10259109
480 Ga0068861_100869283
481 Ga0068870_10146269
482 Ga0068863_100109248
483 Ga0068862_100075858
484 Ga0068862_100249266
485 Ga0068862_100409153
486 Ga0081455_10021662
487 Ga0081538_10012348
488 Ga0081539_10000255
489 Ga0081539_10039688
490 Ga0070717_10136124
491 Ga0070717_10188641
492 Ga0070717_11921573
493 Ga0070716_101399896
494 Ga0070712_100470911
495 Ga0070712_101588445
496 Ga0075367_10223810
497 Ga0097621_100005894
498 Ga0068871_100101786
499 Ga0075428_100067064
500 Ga0075428_101186208
501 Ga0075430_100018426
502 Ga0075431_100060438
503 Ga0075431_100654472
504 Ga0075429_100079764
505 Ga0075429_101208597
506 Ga0075429_101216457
507 Ga0068865_101053473
508 Ga0068865_101787050
509 Ga0075436_100629284
510 Ga0097620_100222977
511 Ga0099794_10003749
512 Ga0099794_10046190
513 Ga0099794_10075863
514 Ga0099794_10085662
515 Ga0099794_10088897
516 Ga0099794_10118574
517 Ga0099794_10170106
518 Ga0099795_10046269
519 Ga0105240_10002308
520 Ga0105240_10429979
521 Ga0105240_10585750
522 Ga0111539_11149401
523 Ga0105245_10434468
524 Ga0105245_10772423
525 Ga0105245_11279326
526 Ga0105247_10330826
527 Ga0105243_11541910
528 Ga0105241_12471685
529 Ga0105242_10172574
530 Ga0105248_10159225
531 Ga0105248_10295177
532 Ga0105248_12359056
533 Ga0105238_10056537
534 Ga0099796_10022442
535 Ga0105239_10987572
536 Ga0105246_10446990
537 Ga0157373_10582409
538 Ga0157370_10009616
539 Ga0157369_10072073
540 Ga0157369_11839534
541 Ga0157369_12650466
542 Ga0157374_10039849
543 Ga0157378_10430724
544 Ga0157378_10830533
545 Ga0157378_11277881
546 Ga0163162_10191351
547 Ga0163162_11320097
548 Ga0157372_11204942
549 Ga0157372_11492477
550 Ga0157372_12000266
551 Ga0157375_10121445
552 Ga0163163_10014250
553 Ga0163163_11204251
554 Ga0182008_10001279
555 Ga0157379_10164900
556 Ga0157379_10467440
557 Ga0157376_10005326
558 Ga0182006_1000004
559 Ga0182007_10000028
560 Ga0182005_1000011
561 Ga0182005_1077668
562 Ga0206351_10992221
563 Ga0206350_10724632
564 Ga0213876_10052821
565 Ga0224712_10111029
566 Ga0207655_1219392
567 Ga0207688_10008286
568 Ga0207699_10407363
569 Ga0207699_10619960
570 Ga0207643_10080348
571 Ga0207707_10715085
572 Ga0207707_10724935
573 Ga0207695_10001045
574 Ga0207695_10004902
575 Ga0207695_10569247
576 Ga0207671_10593642
577 Ga0207663_10271455
578 Ga0207660_10569548
579 Ga0207660_11002324
580 Ga0207649_10053664
581 Ga0207649_11126067
582 Ga0207652_10322646
583 Ga0207694_10124221
584 Ga0207650_10060807
585 Ga0207659_10003051
586 Ga0207687_10416439
587 Ga0207687_10841937
588 Ga0207664_10050876
589 Ga0207664_10060222
590 Ga0207644_10413198
591 Ga0207644_10728815
592 Ga0207686_10104389
593 Ga0207670_11020197
594 Ga0207670_11473641
595 Ga0207669_11777153
596 Ga0207691_10525540
597 Ga0207711_11648369
598 Ga0207711_12071333
599 Ga0207661_10567852
600 Ga0207661_10573447
601 Ga0207679_10104256
602 Ga0207667_10267796
603 Ga0207651_10047286
604 Ga0207640_10531414
605 Ga0207658_10170782
606 Ga0207658_10830513
607 Ga0207677_10916468
608 Ga0207639_10075745
609 Ga0207678_10982140
610 Ga0207708_11850789
611 Ga0207702_10123911
612 Ga0207641_10489902
613 Ga0207648_10397966
614 Ga0207676_10084370
615 Ga0207675_100255767
616 Ga0207675_101008705
617 Ga0207683_10059016
618 Ga0209179_1028034
619 Ga0209588_1001356
620 Ga0209588_1013501
621 Ga0209588_1034703
622 Ga0209588_1043596
623 Ga0209588_1073409
624 Ga0209588_1079432
625 Ga0265354_1001419
626 Ga0265357_1000675
627 Ga0268266_10282713
628 Ga0268266_10677161
629 Ga0268265_10257573
630 Ga0268264_10044080
631 Ga0268264_10485210
632 Ga0268264_11609556
633 Ga0265323_10076385
634 Ga0265338_10098541
635 Ga0265338_10887762
636 Ga0265324_10169057
637 Ga0265770_1009836
638 Ga0265770_1053457
639 Ga0265765_1007588
640 Ga0265765_1013799
641 Ga0265760_10009421
642 Ga0265330_10072794
643 Ga0265330_10314647
644 Ga0265332_10307128
645 Ga0265332_10346651
646 Ga0265328_10022269
647 Ga0265320_10001377
648 Ga0265325_10004668
649 Ga0265325_10008225
650 Ga0265325_10195621
651 Ga0265340_10022379
652 Ga0265340_10238226
653 Ga0265340_10424634
654 Ga0265339_10023977
655 Ga0265339_10061922
656 Ga0265339_10208929
657 Ga0265331_10004657
658 Ga0265331_10137784
659 Ga0265331_10172318
660 Ga0265331_10226021
661 Ga0265331_10454209
662 Ga0265316_10002549
663 Ga0265316_10017918
664 Ga0265316_10021628
665 Ga0265316_10159069
666 Ga0265316_10280155
667 Ga0265316_10345400
668 Ga0265313_10152863
669 Ga0265313_10250673
670 Ga0265313_10404630
671 Ga0265314_10117680
672 Ga0265314_10119496
673 Ga0265342_10078211
674 Ga0265342_10228850
675 Ga0265342_10270967
676 Ga0265342_10300680
677 Ga0307516_10670585
678 Ga0307414_11316483
679 Ga0316212_1003400
680 Ga0373926_0015787
681 Ga0373944_0420770
682 Ga0373943_0043374
683 Ga0373943_0100210
684 Ga0373946_0415264
685 Ga0373927_0001693
686 Ga0373927_0023468
687 Ga0373927_0023784
688 Ga0373933_0554633
689 Ga0373947_0000055
690 Ga0373947_0051596
691 Ga0373947_0085253
692 Ga0373937_0104350
693 Ga0373925_0000936
694 Ga0373925_0085005
695 Ga0436364_0044578
696 Ga0436364_0054874
697 Ga0436364_0504711
698 Ga0436364_0901304
699 Ga0436364_1117181
700 Ga0436364_1280830
701 Ga0436365_0444792
702 Ga0436365_1000920
703 Ga0436360_0347949
704 Ga0436360_0367798
705 Ga0436363_0082099
706 Ga0436363_0326008
707 Ga0436363_0419810
708 Ga0436363_0767448
709 Ga0436363_1285887
710 Ga0436362_0611879
711 Ga0451807_1591115
712 Ga0451833_1363508
713 Ga0451853_0007858
714 Ga0451576_0277626
715 Ga0466958_0757954
716 Ga0495592_0004390
717 Ga0495629_0886493
718 Ga0495651_0057580
719 Ga0495580_0067660
720 Ga0495580_0864043
721 Ga0495582_0923326
722 Ga0495639_0321328
723 Ga0495639_0548614
724 Ga0495662_0225354
725 Ga0495664_0001913
726 Ga0495664_0544130
727 Ga0495584_0020672
728 Ga0495618_0418794
729 Ga0495628_0013142
730 Ga0495630_0080358
731 Ga0495666_0497293
732 Ga0495652_0050444
733 Ga0495652_0180420
734 Ga0495654_0010826
735 Ga0495665_0623618
736 Ga0495640_0185475
737 Ga0495640_0781204
738 Ga0495586_0147659
739 Ga0495587_0013158
740 Ga0495598_0047051
741 Ga0495645_0015436
742 Ga0495645_0338620
743 Ga0495633_0002863
744 Ga0495667_0029183
745 Ga0495667_0190903
746 Ga0495634_0061634
747 Ga0495611_0386990
748 Ga0495635_0155427
749 Ga0495635_0444473
750 Ga0495599_0003289
751 Ga0495623_0217266
752 Ga0495646_0029910
753 Ga0495658_0020540
754 Ga0495624_0315922
755 Ga0495600_0041917
756 Ga0495604_0935627
757 Ga0495674_0003756
758 Ga0495674_0046364
759 Ga0495674_0354721
760 Ga0495680_0077535
761 Ga0495680_0079376
762 Ga0495675_0264659
763 Ga0495684_0091473
764 Ga0495684_0350476
765 Ga0495684_0832912
766 Ga0495684_0863372
767 Ga0495602_0070425
768 Ga0495602_0285026
769 Ga0496100_0503646
770 Ga0496106_1397821
771 Ga0496108_0827075
772 Ga0496111_0027635
773 Ga0496115_0472159
774 Ga0496116_0035809
775 Ga0496117_0000011
776 Ga0496117_0031337
777 Ga0496118_0000010
778 Ga0496118_0057487
779 Ga0496121_0009436
780 Ga0496121_0016793
781 Ga0496122_0033641
782 Ga0496123_0002591
783 Ga0496124_0092846
784 Ga0496125_0082111
785 Ga0495682_0009518
786 Ga0501033_0116461
787 Ga0501034_0845166
788 Ga0501038_0980420
789 Ga0501047_0456996
790 Ga0501070_0073339
791 Ga0501070_0872067
792 Ga0501072_0670024
793 Ga0501073_0023990
794 Ga0501073_0283998
795 Ga0501209_035108
796 Ga0501245_136412
797 Ga0501080_0358334
798 Ga0501080_0799186
799 Ga0501083_0038652
800 Ga0501241_150509
801 Ga0501035_0854256
802 Ga0501044_0106544
803 Ga0501044_0132944
804 nmdc:mga07m45_124845_c1
805 nmdc:mga09592_1103009_c1
806 nmdc:mga09592_38784_c1
807 nmdc:mga0qj67_72899_c1
808 nmdc:mga06r32_127197_c1
809 nmdc:mga06r32_576656_c1
810 nmdc:mga06r32_620544_c1
811 nmdc:mga0rr50_1680825_c1
812 nmdc:mga08x19_319727_c1
813 Ga0495595_0215450
814 Ga0500647_0228061
815 Ga0500636_0359813
816 Ga0501082_1026160
817 2513721068
818 2601669287
819 2857549414
820 2885084895
821 2932414544
822 2932420935

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13443

HTH_26

Cro/C1-type HTH DNA-binding domain

48

101

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hpc-assembly1.cif.gz_A crystal structure of the hicb antitoxin from e. coli 0.8008 30 96
2a6c-assembly1.cif.gz_A crystal structure of a putative transcriptional regulator (ne_1354) from nitrosomonas europaea at 1.90 a resolution 0.7981 26 96
6ltz-assembly1.cif.gz_A induced dna bending by unique dimerization of higa antitoxin 0.7703 49 93
3f6w-assembly1.cif.gz_A xre-family like protein from pseudomonas syringae pv. tomato str. dc3000 0.7574 17 90
6lty-assembly1.cif.gz_B dna bound antitoxin higa3 0.757 36 93
ID Description Score Start End Superfamily
3f6wB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.7609 18 90 1.10.260.40
3f6wA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.7558 17 90 1.10.260.40
3kz3B00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.7494 31 89 1.10.260.40
1lmb400 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.7447 31 90 1.10.260.40
4pu7A00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.7412 32 94 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A3C0TDY6-F1-model_v4 Uncharacterized protein 0.8343 15 96 GO:0003677
AF-A0A2V7RWH0-F1-model_v4 Uncharacterized protein 0.8279 25 96 GO:0003677
AF-A0A2M7NGF8-F1-model_v4 HTH cro/C1-type domain-containing protein 0.8266 28 96 GO:0003677
AF-A0A1Q3SFC3-F1-model_v4 Uncharacterized protein 0.8241 25 96 GO:0003677
AF-A0A2B8BJU7-F1-model_v4 HicB family protein 0.8229 27 96 GO:0003677

Map