F437495

General Info

Members Datasets Scaffolds Average Seq Length
411 212 822 335

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10088374|Ga0099794_100883742
Length 377
Sequence MLSRGIRKARIAVGRLRKLIEPGARSRSYMIKVSVKERQGGQVNQGKVKWGVLGVAAIAVKKVIPGMQQGSWSEIAAIASREAGKAKKAAKSLGIPKAYGSYEDLLADPEIEAVYNPLPNHLHVPWSVKAAEAGKHVLCEKPLSLTVAEAKTLLDVRNRCGVKIGEAFMVKTHPQWLRTRELILKGVIGELRAIVGAFSYFNRDPQNVRNVAEWGGGGMMDIGCYPITTSRFIFGEEPLRVAGLIERDPDFKTDRLASAILEFPSGQSVFTCSTQLVAYQRMQFLGTTGRIEIEIPFNAPPDRATRIFIDDGRDVFGGGIRIETIPVCDQYTVQGDAFSRAIREESEVPVPLEDAIANMAVIEAVFRAGESGRWEQP

Samples

Sample ID Description Type Environment
1 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
84 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
129 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
130 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
131 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
132 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
134 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
135 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
136 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
137 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
138 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
139 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
141 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
142 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
150 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
151 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
152 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
153 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
154 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
155 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
156 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
157 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
158 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
161 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
162 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
163 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
164 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
165 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
166 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
167 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
168 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
192 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
193 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
194 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
195 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
196 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
197 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
198 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
199 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
200 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
201 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
202 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
203 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
204 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
209 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
210 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
211 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
212 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.68
Rhizosphere 92.21
Stem 0
Stem Tuber 0
Unclassified 9.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099794_10088374 3300007265 Bacteria 1536
2 Ga0070676_10088817 3300005328 Bacteria 1889
3 Ga0070670_100000865 3300005331 Bacteria 23780
4 Ga0070670_100006257 3300005331 Bacteria 10077
5 Ga0068869_100007458 3300005334 Bacteria 6995
6 Ga0070680_100024667 3300005336 Unclassified 4806
7 Ga0068868_100002463 3300005338 Bacteria 12855
8 Ga0070660_100033123 3300005339 Bacteria 3893
9 Ga0070661_100004183 3300005344 Bacteria 9963
10 Ga0070661_100051765 3300005344 Bacteria 3006
11 Ga0070661_100127114 3300005344 Bacteria 1913
12 Ga0070671_100169439 3300005355 Bacteria 1847
13 Ga0070673_100023606 3300005364 Bacteria 4495
14 Ga0070709_10028656 3300005434 Unclassified 3323
15 Ga0070714_100000733 3300005435 Bacteria 23229
16 Ga0070714_100006306 3300005435 Bacteria 9139
17 Ga0070714_100287188 3300005435 Bacteria 1530
18 Ga0070713_100001094 3300005436 Bacteria 17325
19 Ga0070713_100022711 3300005436 Bacteria 4853
20 Ga0070713_100114075 3300005436 Bacteria 2360
21 Ga0070710_10081729 3300005437 Bacteria 1887
22 Ga0070711_100001977 3300005439 Bacteria 11516
23 Ga0070711_100022327 3300005439 Bacteria 4100
24 Ga0070711_100119818 3300005439 Bacteria 1944
25 Ga0070705_100001290 3300005440 Bacteria 13442
26 Ga0070705_100126774 3300005440 Bacteria 1658
27 Ga0070694_100001852 3300005444 Bacteria 12535
28 Ga0070694_100002523 3300005444 Bacteria 10812
29 Ga0070708_100343393 3300005445 Unclassified 1407
30 Ga0070681_10006931 3300005458 Bacteria 11029
31 Ga0070681_10028543 3300005458 Bacteria 5610
32 Ga0070681_10097298 3300005458 Unclassified 2891
33 Ga0068867_100007564 3300005459 Bacteria 7688
34 Ga0070706_100003529 3300005467 Bacteria 15378
35 Ga0070706_100021151 3300005467 Bacteria 5990
36 Ga0070706_100222045 3300005467 Bacteria 1764
37 Ga0070698_100004945 3300005471 Bacteria 14612
38 Ga0070699_100015933 3300005518 Bacteria 6455
39 Ga0070699_100054792 3300005518 Unclassified 3453
40 Ga0070679_100137930 3300005530 Bacteria 2420
41 Ga0070679_100176028 3300005530 Unclassified 2112
42 Ga0070697_100000634 3300005536 Bacteria 26650
43 Ga0070697_100001102 3300005536 Bacteria 20411
44 Ga0068853_100575732 3300005539 Bacteria 1068
45 Ga0070695_100006211 3300005545 Bacteria 7056
46 Ga0070695_100142789 3300005545 Unclassified 1662
47 Ga0070696_100020669 3300005546 Bacteria 4461
48 Ga0070693_100001809 3300005547 Bacteria 9753
49 Ga0070704_100093275 3300005549 Bacteria 2249
50 Ga0068855_100001938 3300005563 Bacteria 25699
51 Ga0068855_100030693 3300005563 Bacteria 6425
52 Ga0068855_100086507 3300005563 Bacteria 3625
53 Ga0068855_100504229 3300005563 Bacteria 1315
54 Ga0070664_100000499 3300005564 Bacteria 29728
55 Ga0070664_100026998 3300005564 Unclassified 4769
56 Ga0070664_100349968 3300005564 Bacteria 1344
57 Ga0068857_100022984 3300005577 Bacteria 5484
58 Ga0068854_100006019 3300005578 Bacteria 7684
59 Ga0068854_100316551 3300005578 Bacteria 1267
60 Ga0068856_100001233 3300005614 Bacteria 26823
61 Ga0068856_100002074 3300005614 Bacteria 20786
62 Ga0068856_100005121 3300005614 Bacteria 12947
63 Ga0068856_100013947 3300005614 Bacteria 7770
64 Ga0068856_100031223 3300005614 Bacteria 5212
65 Ga0068856_100105205 3300005614 Bacteria 2816
66 Ga0068856_100213385 3300005614 Bacteria 1945
67 Ga0070702_100012500 3300005615 Bacteria 4256
68 Ga0068852_100153305 3300005616 Bacteria 2145
69 Ga0068859_100000871 3300005617 Bacteria 30785
70 Ga0068859_100074025 3300005617 Unclassified 3445
71 Ga0068864_100000664 3300005618 Bacteria 28711
72 Ga0068864_100032685 3300005618 Bacteria 4422
73 Ga0068866_10001811 3300005718 Bacteria 8989
74 Ga0068861_100137015 3300005719 Bacteria 1993
75 Ga0068858_100002350 3300005842 Bacteria 19112
76 Ga0068858_100011222 3300005842 Bacteria 8466
77 Ga0068860_100047443 3300005843 Bacteria 4094
78 Ga0068860_100159299 3300005843 Unclassified 2176
79 Ga0081455_10045719 3300005937 Bacteria 3806
80 Ga0081538_10029058 3300005981 Bacteria 3786
81 Ga0081539_10031130 3300005985 Bacteria 3295
82 Ga0070717_10014543 3300006028 Bacteria 6057
83 Ga0070717_10033374 3300006028 Bacteria 4153
84 Ga0070717_10046546 3300006028 Bacteria 3549
85 Ga0070717_10118019 3300006028 Bacteria 2270
86 Ga0070717_10245661 3300006028 Bacteria 1580
87 Ga0070715_10000301 3300006163 Bacteria 12133
88 Ga0070715_10000351 3300006163 Bacteria 11514
89 Ga0070716_100005157 3300006173 Bacteria 6315
90 Ga0070716_100093068 3300006173 Bacteria 1829
91 Ga0070712_100000876 3300006175 Bacteria 17970
92 Ga0070712_100136371 3300006175 Bacteria 1866
93 Ga0097621_100000429 3300006237 Bacteria 29289
94 Ga0097621_100005350 3300006237 Bacteria 9042
95 Ga0097621_100047143 3300006237 Bacteria 3491
96 Ga0097621_100063713 3300006237 Bacteria 3030
97 Ga0097621_100198433 3300006237 Unclassified 1741
98 Ga0068871_100000253 3300006358 Bacteria 37196
99 Ga0068871_100022741 3300006358 Bacteria 4838
100 Ga0068871_100274455 3300006358 Bacteria 1473
101 Ga0075428_100110684 3300006844 Bacteria 2992
102 Ga0075433_10025415 3300006852 Bacteria 5006
103 Ga0075434_100000161 3300006871 Bacteria 42373
104 Ga0075434_100002626 3300006871 Bacteria 15851
105 Ga0075434_100422236 3300006871 Bacteria 1354
106 Ga0068865_100035185 3300006881 Bacteria 3366
107 Ga0068865_100058357 3300006881 Bacteria 2695
108 Ga0075436_100001161 3300006914 Bacteria 17848
109 Ga0075436_100090753 3300006914 Bacteria 2124
110 Ga0097620_100000871 3300006931 Bacteria 30785
111 Ga0097620_100074025 3300006931 Unclassified 3445
112 Ga0075435_100000423 3300007076 Bacteria 26136
113 Ga0075435_100003834 3300007076 Bacteria 10256
114 Ga0075435_100227184 3300007076 Bacteria 1585
115 Ga0075435_100390993 3300007076 Bacteria 1195
116 Ga0099794_10000909 3300007265 Bacteria 9978
117 Ga0099794_10001091 3300007265 Bacteria 9277
118 Ga0099794_10005678 3300007265 Bacteria 5026
119 Ga0099794_10009817 3300007265 Unclassified 4043
120 Ga0099794_10012650 3300007265 Bacteria 3649
121 Ga0099794_10013464 3300007265 Bacteria 3561
122 Ga0099794_10049615 3300007265 Bacteria 2017
123 Ga0099794_10049811 3300007265 Unclassified 2014
124 Ga0105240_10024556 3300009093 Bacteria 7944
125 Ga0105240_10028510 3300009093 Bacteria 7292
126 Ga0105240_10122718 3300009093 Bacteria 3126
127 Ga0105240_10219742 3300009093 Bacteria 2214
128 Ga0105240_10279436 3300009093 Bacteria 1919
129 Ga0105245_10115409 3300009098 Unclassified 2502
130 Ga0114129_10062754 3300009147 Bacteria 5189
131 Ga0114129_10672792 3300009147 Bacteria 1334
132 Ga0105243_10015467 3300009148 Bacteria 5767
133 Ga0105243_10124749 3300009148 Bacteria 2176
134 Ga0105241_10011052 3300009174 Bacteria 6622
135 Ga0105248_10002674 3300009177 Bacteria 19791
136 Ga0105237_10001439 3300009545 Bacteria 31412
137 Ga0105237_10049374 3300009545 Bacteria 4230
138 Ga0105237_10162407 3300009545 Bacteria 2232
139 Ga0105237_10295759 3300009545 Bacteria 1622
140 Ga0105238_10073160 3300009551 Bacteria 3423
141 Ga0105238_10152064 3300009551 Bacteria 2289
142 Ga0105028_100783 3300009993 Bacteria 3403
143 Ga0105239_10016350 3300010375 Bacteria 8205
144 Ga0105239_10048128 3300010375 Bacteria 4675
145 Ga0105239_10235606 3300010375 Bacteria 2054
146 Ga0105246_10034630 3300011119 Bacteria 3367
147 Ga0157373_10224421 3300013100 Bacteria 1326
148 Ga0157373_10244610 3300013100 Bacteria 1268
149 Ga0157371_10031298 3300013102 Bacteria 3832
150 Ga0157371_10081472 3300013102 Bacteria 2292
151 Ga0157370_10105426 3300013104 Bacteria 2638
152 Ga0157370_10127537 3300013104 Bacteria 2375
153 Ga0157369_10004180 3300013105 Bacteria 17105
154 Ga0157369_10025903 3300013105 Bacteria 6508
155 Ga0157369_10053615 3300013105 Bacteria 4357
156 Ga0157374_10000554 3300013296 Bacteria 33376
157 Ga0157374_10000735 3300013296 Bacteria 28588
158 Ga0157374_10009581 3300013296 Bacteria 8319
159 Ga0157374_10049548 3300013296 Bacteria 3902
160 Ga0157378_10000055 3300013297 Bacteria 97875
161 Ga0157378_10000397 3300013297 Bacteria 42878
162 Ga0157378_10032293 3300013297 Bacteria 4626
163 Ga0157378_10108988 3300013297 Unclassified 2536
164 Ga0163162_10550804 3300013306 Bacteria 1282
165 Ga0157372_10000390 3300013307 Bacteria 48665
166 Ga0157372_10001666 3300013307 Bacteria 24077
167 Ga0157372_10013501 3300013307 Bacteria 8730
168 Ga0157372_10049732 3300013307 Bacteria 4663
169 Ga0157372_10238945 3300013307 Bacteria 2108
170 Ga0157376_10028989 3300014969 Bacteria 4406
171 Ga0157376_10099820 3300014969 Bacteria 2533
172 Ga0157376_10163406 3300014969 Bacteria 2020
173 Ga0213872_10000809 3300021361 Bacteria 22661
174 Ga0213876_10026734 3300021384 Bacteria 3044
175 Ga0213875_10000010 3300021388 Bacteria 370268
176 Ga0213875_10000017 3300021388 Bacteria 239813
177 Ga0213875_10012285 3300021388 Unclassified 4235
178 Ga0213871_10003914 3300021441 Bacteria 2928
179 Ga0207653_10002542 3300025885 Bacteria 5793
180 Ga0207647_10011293 3300025904 Bacteria 6269
181 Ga0207699_10017143 3300025906 Unclassified 3805
182 Ga0207699_10077279 3300025906 Bacteria 2053
183 Ga0207699_10258275 3300025906 Bacteria 1203
184 Ga0207684_10001356 3300025910 Bacteria 26825
185 Ga0207684_10009570 3300025910 Bacteria 8548
186 Ga0207654_10004397 3300025911 Bacteria 7102
187 Ga0207707_10005907 3300025912 Bacteria 10707
188 Ga0207707_10089517 3300025912 Unclassified 2690
189 Ga0207707_10128360 3300025912 Bacteria 2217
190 Ga0207695_10008921 3300025913 Bacteria 12484
191 Ga0207695_10177742 3300025913 Bacteria 2050
192 Ga0207695_10279010 3300025913 Bacteria 1565
193 Ga0207671_10012699 3300025914 Bacteria 6756
194 Ga0207671_10035004 3300025914 Bacteria 3729
195 Ga0207693_10001244 3300025915 Bacteria 22675
196 Ga0207693_10068025 3300025915 Bacteria 2788
197 Ga0207663_10007773 3300025916 Bacteria 5584
198 Ga0207663_10013265 3300025916 Bacteria 4476
199 Ga0207663_10022872 3300025916 Bacteria 3579
200 Ga0207663_10119676 3300025916 Bacteria 1801
201 Ga0207660_10097898 3300025917 Bacteria 2187
202 Ga0207657_10032513 3300025919 Bacteria 4713
203 Ga0207649_10015968 3300025920 Unclassified 4226
204 Ga0207652_10108597 3300025921 Bacteria 2459
205 Ga0207652_10115164 3300025921 Bacteria 2388
206 Ga0207652_10145548 3300025921 Bacteria 2121
207 Ga0207694_10040633 3300025924 Bacteria 3582
208 Ga0207694_10171801 3300025924 Bacteria 1755
209 Ga0207650_10003027 3300025925 Bacteria 11581
210 Ga0207650_10007372 3300025925 Bacteria 7485
211 Ga0207659_10264025 3300025926 Bacteria 1402
212 Ga0207700_10001600 3300025928 Bacteria 12853
213 Ga0207700_10008649 3300025928 Bacteria 6320
214 Ga0207700_10163322 3300025928 Bacteria 1851
215 Ga0207664_10001159 3300025929 Bacteria 17547
216 Ga0207664_10261900 3300025929 Bacteria 1512
217 Ga0207644_10047508 3300025931 Bacteria 3064
218 Ga0207690_10032373 3300025932 Unclassified 3355
219 Ga0207690_10252601 3300025932 Bacteria 1362
220 Ga0207706_10444620 3300025933 Bacteria 1122
221 Ga0207686_10032584 3300025934 Bacteria 3103
222 Ga0207670_10201098 3300025936 Bacteria 1514
223 Ga0207704_10008230 3300025938 Unclassified 4971
224 Ga0207704_10056630 3300025938 Bacteria 2403
225 Ga0207704_10228048 3300025938 Bacteria 1383
226 Ga0207665_10000137 3300025939 Bacteria 48764
227 Ga0207665_10032547 3300025939 Bacteria 3453
228 Ga0207665_10083202 3300025939 Unclassified 2207
229 Ga0207665_10228405 3300025939 Bacteria 1367
230 Ga0207711_10022494 3300025941 Bacteria 5272
231 Ga0207711_10193471 3300025941 Bacteria 1854
232 Ga0207689_10000828 3300025942 Bacteria 29823
233 Ga0207689_10027980 3300025942 Bacteria 4716
234 Ga0207679_10017597 3300025945 Unclassified 4771
235 Ga0207667_10009221 3300025949 Bacteria 11651
236 Ga0207667_10009888 3300025949 Bacteria 11189
237 Ga0207667_10097752 3300025949 Bacteria 3030
238 Ga0207667_10114928 3300025949 Bacteria 2774
239 Ga0207667_10151524 3300025949 Bacteria 2386
240 Ga0207667_10283135 3300025949 Bacteria 1694
241 Ga0207651_10014815 3300025960 Bacteria 4513
242 Ga0207640_10004283 3300025981 Bacteria 7723
243 Ga0207640_10019263 3300025981 Bacteria 4029
244 Ga0207677_10002661 3300026023 Bacteria 9408
245 Ga0207703_10002440 3300026035 Bacteria 16124
246 Ga0207639_10069724 3300026041 Bacteria 2744
247 Ga0207702_10003977 3300026078 Bacteria 13273
248 Ga0207702_10009395 3300026078 Bacteria 8212
249 Ga0207702_10015731 3300026078 Bacteria 6263
250 Ga0207702_10215703 3300026078 Bacteria 1786
251 Ga0207702_10280281 3300026078 Bacteria 1575
252 Ga0207648_10161571 3300026089 Unclassified 1978
253 Ga0207676_10014833 3300026095 Bacteria 5614
254 Ga0207676_10069555 3300026095 Bacteria 2819
255 Ga0207674_10018665 3300026116 Bacteria 7533
256 Ga0209588_1001604 3300027671 Bacteria 5958
257 Ga0209588_1002920 3300027671 Archaea 4698
258 Ga0209588_1008251 3300027671 Bacteria 3083
259 Ga0209588_1011887 3300027671 Unclassified 2636
260 Ga0209588_1016511 3300027671 Unclassified 2280
261 Ga0209588_1040309 3300027671 Unclassified 1507
262 Ga0265354_1000738 3300028016 Bacteria 5345
263 Ga0268265_10017039 3300028380 Bacteria 5005
264 Ga0268264_10074844 3300028381 Bacteria 2878
265 Ga0268264_10256623 3300028381 Unclassified 1626
266 Ga0265770_1000569 3300030878 Bacteria 5131
267 Ga0265340_10017157 3300031247 Bacteria 3744
268 Ga0265339_10000055 3300031249 Bacteria 99907
269 Ga0265342_10005519 3300031712 Bacteria 9612
270 Ga0373934_0002600 3300035086 Bacteria 6645
271 Ga0373923_0124906 3300035111 Bacteria 1152
272 Ga0373953_0021649 3300035117 Bacteria 2416
273 Ga0373954_0000878 3300035118 Bacteria 11685
274 Ga0373954_0118202 3300035118 Bacteria 1286
275 Ga0373956_0003945 3300035119 Bacteria 5959
276 Ga0373943_0170936 3300035170 Unclassified 1189
277 Ga0373955_0014979 3300035172 Bacteria 3786
278 Ga0373931_0015239 3300035691 Bacteria 3769
279 Ga0373935_0023020 3300035692 Bacteria 3825
280 Ga0373927_0005811 3300035695 Bacteria 8463
281 Ga0373927_0008051 3300035695 Bacteria 7117
282 Ga0373927_0185790 3300035695 Bacteria 1363
283 Ga0373933_0044593 3300035724 Bacteria 2627
284 Ga0373933_0116706 3300035724 Bacteria 1669
285 Ga0373947_0001201 3300035725 Bacteria 15923
286 Ga0373937_0000397 3300036401 Bacteria 40594
287 Ga0373937_0015224 3300036401 Bacteria 6799
288 Ga0373937_0366503 3300036401 Unclassified 1366
289 Ga0373937_0430690 3300036401 Bacteria 1252
290 Ga0373925_0001078 3300037068 Bacteria 24530
291 Ga0373925_0044841 3300037068 Bacteria 3284
292 Ga0373925_0091065 3300037068 Bacteria 2332
293 Ga0373925_0154944 3300037068 Unclassified 1801
294 Ga0395900_0274180 3300037418 Bacteria 1681
295 Ga0395898_0025259 3300037466 Bacteria 5989
296 Ga0395898_0102189 3300037466 Bacteria 2752
297 Ga0436364_0019296 3300037853 Bacteria 11137
298 Ga0436364_0339530 3300037853 Bacteria 240640
299 Ga0436364_0592781 3300037853 Bacteria 15434
300 Ga0436364_0814777 3300037853 Bacteria 1582
301 Ga0436364_0956709 3300037853 Bacteria 10638
302 Ga0436364_1386903 3300037853 Bacteria 15414
303 Ga0436364_1408701 3300037853 Bacteria 4193
304 Ga0436364_1448179 3300037853 Bacteria 40988
305 Ga0436364_1498055 3300037853 Bacteria 3708
306 Ga0436365_0200115 3300039437 Bacteria 9312
307 Ga0436365_0503411 3300039437 Bacteria 3854
308 Ga0436365_1133580 3300039437 Bacteria 1408
309 Ga0436365_1719840 3300039437 Bacteria 27075
310 Ga0436365_1831485 3300039437 Bacteria 5433
311 Ga0436360_0940946 3300039438 Unclassified 3054
312 Ga0436360_1294485 3300039438 Bacteria 10623
313 Ga0436361_0654162 3300039447 Bacteria 3923
314 Ga0436361_0972882 3300039447 Bacteria 108107
315 Ga0436363_1119619 3300039450 Bacteria 1823
316 Ga0436363_1579475 3300039450 Bacteria 2012
317 Ga0451853_1394212 3300041512 Bacteria 1185
318 Ga0451577_0069564 3300042876 Bacteria 3139
319 Ga0451577_0563591 3300042876 Bacteria 1034
320 Ga0453684_0016556 3300044712 Bacteria 11515
321 Ga0466959_0286846 3300045049 Bacteria 1129
322 Ga0451576_0064561 3300045051 Bacteria 3813
323 Ga0451576_0524640 3300045051 Bacteria 1244
324 Ga0495617_033734 3300046452 Bacteria 1718
325 Ga0495651_0049396 3300046462 Bacteria 3247
326 Ga0495580_0052213 3300046472 Unclassified 2888
327 Ga0495580_0059233 3300046472 Unclassified 2691
328 Ga0495580_0066688 3300046472 Unclassified 2519
329 Ga0495587_0014637 3300046536 Bacteria 4914
330 Ga0495587_0109127 3300046536 Bacteria 1590
331 Ga0495635_0095126 3300046663 Bacteria 2037
332 Ga0495599_0180158 3300046678 Unclassified 1303
333 Ga0495623_0059383 3300046679 Bacteria 2402
334 Ga0495623_0071341 3300046679 Bacteria 2161
335 Ga0495604_0001503 3300047317 Bacteria 19219
336 Ga0495674_0267213 3300047319 Bacteria 1404
337 Ga0495672_0125321 3300047320 Bacteria 1359
338 Ga0495675_0028159 3300047444 Bacteria 3582
339 Ga0495675_0061132 3300047444 Bacteria 2387
340 Ga0495602_0070195 3300048088 Bacteria 3000
341 Ga0495602_0145937 3300048088 Bacteria 1867
342 Ga0496101_0032067 3300048904 Bacteria 3696
343 Ga0496102_0197840 3300048905 Bacteria 1894
344 Ga0496106_0298437 3300048909 Bacteria 1292
345 Ga0496107_0004658 3300048910 Bacteria 9308
346 Ga0496111_0083389 3300048914 Bacteria 2335
347 Ga0496112_0018337 3300048915 Bacteria 6589
348 Ga0496112_0043929 3300048915 Unclassified 4376
349 Ga0496112_0052779 3300048915 Unclassified 3991
350 Ga0496113_0297083 3300048916 Bacteria 1293
351 Ga0496115_0069478 3300048918 Bacteria 2853
352 Ga0496115_0081937 3300048918 Bacteria 2628
353 Ga0501031_0001371 3300049568 Bacteria 15040
354 Ga0501033_0007117 3300049570 Bacteria 8731
355 Ga0501034_0011221 3300049571 Bacteria 9304
356 Ga0501034_0027931 3300049571 Bacteria 5738
357 Ga0501034_0066052 3300049571 Bacteria 3631
358 Ga0501036_0002501 3300049572 Bacteria 14415
359 Ga0501036_0287713 3300049572 Bacteria 1375
360 Ga0501037_0095957 3300049573 Bacteria 2143
361 Ga0501038_0000375 3300049574 Bacteria 38556
362 Ga0501038_0035051 3300049574 Bacteria 4410
363 Ga0501039_0006638 3300049575 Bacteria 8793
364 Ga0501040_0265034 3300049576 Bacteria 1226
365 Ga0501041_0160229 3300049577 Bacteria 1407
366 Ga0501042_0117896 3300049578 Bacteria 1911
367 Ga0501042_0236007 3300049578 Bacteria 1319
368 Ga0501043_0001225 3300049579 Bacteria 22636
369 Ga0501043_0284307 3300049579 Bacteria 1267
370 Ga0501046_0000316 3300049580 Bacteria 48752
371 Ga0501046_0140377 3300049580 Bacteria 1829
372 Ga0501047_0007438 3300049581 Bacteria 10306
373 Ga0501048_0035282 3300049582 Bacteria 3601
374 Ga0501048_0117364 3300049582 Bacteria 1880
375 Ga0501067_0005726 3300049583 Bacteria 6897
376 Ga0501069_0107463 3300049585 Bacteria 1587
377 Ga0501070_0199477 3300049586 Bacteria 1644
378 Ga0501071_0052163 3300049587 Bacteria 2949
379 Ga0501072_0000213 3300049588 Bacteria 42312
380 Ga0501072_0010960 3300049588 Bacteria 6913
381 Ga0501073_0000234 3300049589 Bacteria 36616
382 Ga0501073_0042399 3300049589 Bacteria 3212
383 Ga0501074_0005808 3300049590 Bacteria 8898
384 Ga0501076_0012917 3300049592 Bacteria 6251
385 Ga0501077_0002454 3300049593 Bacteria 11106
386 Ga0501079_0001022 3300049741 Bacteria 19415
387 Ga0501079_0082093 3300049741 Bacteria 2493
388 Ga0501080_0003600 3300049742 Bacteria 13643
389 Ga0501081_0112833 3300049743 Bacteria 1930
390 Ga0501083_0002003 3300049744 Bacteria 14017
391 Ga0501083_0056617 3300049744 Bacteria 2627
392 Ga0501035_0014049 3300049822 Bacteria 7387
393 Ga0501035_0015190 3300049822 Bacteria 7107
394 Ga0501044_0000490 3300049823 Bacteria 47935
395 Ga0501044_0013363 3300049823 Bacteria 8878
396 Ga0501045_0021440 3300049824 Bacteria 4622
397 Ga0501045_0059970 3300049824 Unclassified 2789
398 nmdc:mga0n895_33_c1 3300050512 Bacteria 80749
399 nmdc:mga0n895_9261_c1 3300050512 Bacteria 8604
400 nmdc:mga0rr50_1_c1 3300050513 Bacteria 558123
401 nmdc:mga0rr50_227021_c1 3300050513 Bacteria 1544
402 nmdc:mga0rr50_77840_c1 3300050513 Bacteria 2550
403 nmdc:mga08x19_1978_c1 3300050514 Bacteria 12548
404 nmdc:mga08x19_335062_c1 3300050514 Bacteria 1055
405 nmdc:mga08x19_342535_c1 3300050514 Bacteria 1043
406 nmdc:mga0a205_14461_c1 3300050515 Bacteria 7360
407 nmdc:mga0a205_180697_c1 3300050515 Bacteria 2004
408 nmdc:mga0a205_4899_c2 3300050515 Bacteria 8968
409 Ga0501084_0000365 3300054114 Bacteria 34541
410 Ga0501084_0101189 3300054114 Bacteria 2420
411 Ga0590077_016409 3300059426 Bacteria 1554
412 Ga0099794_10088374
413 Ga0070676_10088817
414 Ga0070670_100000865
415 Ga0070670_100006257
416 Ga0068869_100007458
417 Ga0070680_100024667
418 Ga0068868_100002463
419 Ga0070660_100033123
420 Ga0070661_100004183
421 Ga0070661_100051765
422 Ga0070661_100127114
423 Ga0070671_100169439
424 Ga0070673_100023606
425 Ga0070709_10028656
426 Ga0070714_100000733
427 Ga0070714_100006306
428 Ga0070714_100287188
429 Ga0070713_100001094
430 Ga0070713_100022711
431 Ga0070713_100114075
432 Ga0070710_10081729
433 Ga0070711_100001977
434 Ga0070711_100022327
435 Ga0070711_100119818
436 Ga0070705_100001290
437 Ga0070705_100126774
438 Ga0070694_100001852
439 Ga0070694_100002523
440 Ga0070708_100343393
441 Ga0070681_10006931
442 Ga0070681_10028543
443 Ga0070681_10097298
444 Ga0068867_100007564
445 Ga0070706_100003529
446 Ga0070706_100021151
447 Ga0070706_100222045
448 Ga0070698_100004945
449 Ga0070699_100015933
450 Ga0070699_100054792
451 Ga0070679_100137930
452 Ga0070679_100176028
453 Ga0070697_100000634
454 Ga0070697_100001102
455 Ga0068853_100575732
456 Ga0070695_100006211
457 Ga0070695_100142789
458 Ga0070696_100020669
459 Ga0070693_100001809
460 Ga0070704_100093275
461 Ga0068855_100001938
462 Ga0068855_100030693
463 Ga0068855_100086507
464 Ga0068855_100504229
465 Ga0070664_100000499
466 Ga0070664_100026998
467 Ga0070664_100349968
468 Ga0068857_100022984
469 Ga0068854_100006019
470 Ga0068854_100316551
471 Ga0068856_100001233
472 Ga0068856_100002074
473 Ga0068856_100005121
474 Ga0068856_100013947
475 Ga0068856_100031223
476 Ga0068856_100105205
477 Ga0068856_100213385
478 Ga0070702_100012500
479 Ga0068852_100153305
480 Ga0068859_100000871
481 Ga0068859_100074025
482 Ga0068864_100000664
483 Ga0068864_100032685
484 Ga0068866_10001811
485 Ga0068861_100137015
486 Ga0068858_100002350
487 Ga0068858_100011222
488 Ga0068860_100047443
489 Ga0068860_100159299
490 Ga0081455_10045719
491 Ga0081538_10029058
492 Ga0081539_10031130
493 Ga0070717_10014543
494 Ga0070717_10033374
495 Ga0070717_10046546
496 Ga0070717_10118019
497 Ga0070717_10245661
498 Ga0070715_10000301
499 Ga0070715_10000351
500 Ga0070716_100005157
501 Ga0070716_100093068
502 Ga0070712_100000876
503 Ga0070712_100136371
504 Ga0097621_100000429
505 Ga0097621_100005350
506 Ga0097621_100047143
507 Ga0097621_100063713
508 Ga0097621_100198433
509 Ga0068871_100000253
510 Ga0068871_100022741
511 Ga0068871_100274455
512 Ga0075428_100110684
513 Ga0075433_10025415
514 Ga0075434_100000161
515 Ga0075434_100002626
516 Ga0075434_100422236
517 Ga0068865_100035185
518 Ga0068865_100058357
519 Ga0075436_100001161
520 Ga0075436_100090753
521 Ga0097620_100000871
522 Ga0097620_100074025
523 Ga0075435_100000423
524 Ga0075435_100003834
525 Ga0075435_100227184
526 Ga0075435_100390993
527 Ga0099794_10000909
528 Ga0099794_10001091
529 Ga0099794_10005678
530 Ga0099794_10009817
531 Ga0099794_10012650
532 Ga0099794_10013464
533 Ga0099794_10049615
534 Ga0099794_10049811
535 Ga0105240_10024556
536 Ga0105240_10028510
537 Ga0105240_10122718
538 Ga0105240_10219742
539 Ga0105240_10279436
540 Ga0105245_10115409
541 Ga0114129_10062754
542 Ga0114129_10672792
543 Ga0105243_10015467
544 Ga0105243_10124749
545 Ga0105241_10011052
546 Ga0105248_10002674
547 Ga0105237_10001439
548 Ga0105237_10049374
549 Ga0105237_10162407
550 Ga0105237_10295759
551 Ga0105238_10073160
552 Ga0105238_10152064
553 Ga0105028_100783
554 Ga0105239_10016350
555 Ga0105239_10048128
556 Ga0105239_10235606
557 Ga0105246_10034630
558 Ga0157373_10224421
559 Ga0157373_10244610
560 Ga0157371_10031298
561 Ga0157371_10081472
562 Ga0157370_10105426
563 Ga0157370_10127537
564 Ga0157369_10004180
565 Ga0157369_10025903
566 Ga0157369_10053615
567 Ga0157374_10000554
568 Ga0157374_10000735
569 Ga0157374_10009581
570 Ga0157374_10049548
571 Ga0157378_10000055
572 Ga0157378_10000397
573 Ga0157378_10032293
574 Ga0157378_10108988
575 Ga0163162_10550804
576 Ga0157372_10000390
577 Ga0157372_10001666
578 Ga0157372_10013501
579 Ga0157372_10049732
580 Ga0157372_10238945
581 Ga0157376_10028989
582 Ga0157376_10099820
583 Ga0157376_10163406
584 Ga0213872_10000809
585 Ga0213876_10026734
586 Ga0213875_10000010
587 Ga0213875_10000017
588 Ga0213875_10012285
589 Ga0213871_10003914
590 Ga0207653_10002542
591 Ga0207647_10011293
592 Ga0207699_10017143
593 Ga0207699_10077279
594 Ga0207699_10258275
595 Ga0207684_10001356
596 Ga0207684_10009570
597 Ga0207654_10004397
598 Ga0207707_10005907
599 Ga0207707_10089517
600 Ga0207707_10128360
601 Ga0207695_10008921
602 Ga0207695_10177742
603 Ga0207695_10279010
604 Ga0207671_10012699
605 Ga0207671_10035004
606 Ga0207693_10001244
607 Ga0207693_10068025
608 Ga0207663_10007773
609 Ga0207663_10013265
610 Ga0207663_10022872
611 Ga0207663_10119676
612 Ga0207660_10097898
613 Ga0207657_10032513
614 Ga0207649_10015968
615 Ga0207652_10108597
616 Ga0207652_10115164
617 Ga0207652_10145548
618 Ga0207694_10040633
619 Ga0207694_10171801
620 Ga0207650_10003027
621 Ga0207650_10007372
622 Ga0207659_10264025
623 Ga0207700_10001600
624 Ga0207700_10008649
625 Ga0207700_10163322
626 Ga0207664_10001159
627 Ga0207664_10261900
628 Ga0207644_10047508
629 Ga0207690_10032373
630 Ga0207690_10252601
631 Ga0207706_10444620
632 Ga0207686_10032584
633 Ga0207670_10201098
634 Ga0207704_10008230
635 Ga0207704_10056630
636 Ga0207704_10228048
637 Ga0207665_10000137
638 Ga0207665_10032547
639 Ga0207665_10083202
640 Ga0207665_10228405
641 Ga0207711_10022494
642 Ga0207711_10193471
643 Ga0207689_10000828
644 Ga0207689_10027980
645 Ga0207679_10017597
646 Ga0207667_10009221
647 Ga0207667_10009888
648 Ga0207667_10097752
649 Ga0207667_10114928
650 Ga0207667_10151524
651 Ga0207667_10283135
652 Ga0207651_10014815
653 Ga0207640_10004283
654 Ga0207640_10019263
655 Ga0207677_10002661
656 Ga0207703_10002440
657 Ga0207639_10069724
658 Ga0207702_10003977
659 Ga0207702_10009395
660 Ga0207702_10015731
661 Ga0207702_10215703
662 Ga0207702_10280281
663 Ga0207648_10161571
664 Ga0207676_10014833
665 Ga0207676_10069555
666 Ga0207674_10018665
667 Ga0209588_1001604
668 Ga0209588_1002920
669 Ga0209588_1008251
670 Ga0209588_1011887
671 Ga0209588_1016511
672 Ga0209588_1040309
673 Ga0265354_1000738
674 Ga0268265_10017039
675 Ga0268264_10074844
676 Ga0268264_10256623
677 Ga0265770_1000569
678 Ga0265340_10017157
679 Ga0265339_10000055
680 Ga0265342_10005519
681 Ga0373934_0002600
682 Ga0373923_0124906
683 Ga0373953_0021649
684 Ga0373954_0000878
685 Ga0373954_0118202
686 Ga0373956_0003945
687 Ga0373943_0170936
688 Ga0373955_0014979
689 Ga0373931_0015239
690 Ga0373935_0023020
691 Ga0373927_0005811
692 Ga0373927_0008051
693 Ga0373927_0185790
694 Ga0373933_0044593
695 Ga0373933_0116706
696 Ga0373947_0001201
697 Ga0373937_0000397
698 Ga0373937_0015224
699 Ga0373937_0366503
700 Ga0373937_0430690
701 Ga0373925_0001078
702 Ga0373925_0044841
703 Ga0373925_0091065
704 Ga0373925_0154944
705 Ga0395900_0274180
706 Ga0395898_0025259
707 Ga0395898_0102189
708 Ga0436364_0019296
709 Ga0436364_0339530
710 Ga0436364_0592781
711 Ga0436364_0814777
712 Ga0436364_0956709
713 Ga0436364_1386903
714 Ga0436364_1408701
715 Ga0436364_1448179
716 Ga0436364_1498055
717 Ga0436365_0200115
718 Ga0436365_0503411
719 Ga0436365_1133580
720 Ga0436365_1719840
721 Ga0436365_1831485
722 Ga0436360_0940946
723 Ga0436360_1294485
724 Ga0436361_0654162
725 Ga0436361_0972882
726 Ga0436363_1119619
727 Ga0436363_1579475
728 Ga0451853_1394212
729 Ga0451577_0069564
730 Ga0451577_0563591
731 Ga0453684_0016556
732 Ga0466959_0286846
733 Ga0451576_0064561
734 Ga0451576_0524640
735 Ga0495617_033734
736 Ga0495651_0049396
737 Ga0495580_0052213
738 Ga0495580_0059233
739 Ga0495580_0066688
740 Ga0495587_0014637
741 Ga0495587_0109127
742 Ga0495635_0095126
743 Ga0495599_0180158
744 Ga0495623_0059383
745 Ga0495623_0071341
746 Ga0495604_0001503
747 Ga0495674_0267213
748 Ga0495672_0125321
749 Ga0495675_0028159
750 Ga0495675_0061132
751 Ga0495602_0070195
752 Ga0495602_0145937
753 Ga0496101_0032067
754 Ga0496102_0197840
755 Ga0496106_0298437
756 Ga0496107_0004658
757 Ga0496111_0083389
758 Ga0496112_0018337
759 Ga0496112_0043929
760 Ga0496112_0052779
761 Ga0496113_0297083
762 Ga0496115_0069478
763 Ga0496115_0081937
764 Ga0501031_0001371
765 Ga0501033_0007117
766 Ga0501034_0011221
767 Ga0501034_0027931
768 Ga0501034_0066052
769 Ga0501036_0002501
770 Ga0501036_0287713
771 Ga0501037_0095957
772 Ga0501038_0000375
773 Ga0501038_0035051
774 Ga0501039_0006638
775 Ga0501040_0265034
776 Ga0501041_0160229
777 Ga0501042_0117896
778 Ga0501042_0236007
779 Ga0501043_0001225
780 Ga0501043_0284307
781 Ga0501046_0000316
782 Ga0501046_0140377
783 Ga0501047_0007438
784 Ga0501048_0035282
785 Ga0501048_0117364
786 Ga0501067_0005726
787 Ga0501069_0107463
788 Ga0501070_0199477
789 Ga0501071_0052163
790 Ga0501072_0000213
791 Ga0501072_0010960
792 Ga0501073_0000234
793 Ga0501073_0042399
794 Ga0501074_0005808
795 Ga0501076_0012917
796 Ga0501077_0002454
797 Ga0501079_0001022
798 Ga0501079_0082093
799 Ga0501080_0003600
800 Ga0501081_0112833
801 Ga0501083_0002003
802 Ga0501083_0056617
803 Ga0501035_0014049
804 Ga0501035_0015190
805 Ga0501044_0000490
806 Ga0501044_0013363
807 Ga0501045_0021440
808 Ga0501045_0059970
809 nmdc:mga0n895_33_c1
810 nmdc:mga0n895_9261_c1
811 nmdc:mga0rr50_1_c1
812 nmdc:mga0rr50_227021_c1
813 nmdc:mga0rr50_77840_c1
814 nmdc:mga08x19_1978_c1
815 nmdc:mga08x19_335062_c1
816 nmdc:mga08x19_342535_c1
817 nmdc:mga0a205_14461_c1
818 nmdc:mga0a205_180697_c1
819 nmdc:mga0a205_4899_c2
820 Ga0501084_0000365
821 Ga0501084_0101189
822 Ga0590077_016409

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

48

168

0.94

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

176

292

0.91

PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

180

376

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4had-assembly1.cif.gz_C crystal structure of probable oxidoreductase protein from rhizobium etli cfn 42 0.9629 3 334
4had-assembly1.cif.gz_D crystal structure of probable oxidoreductase protein from rhizobium etli cfn 42 0.9623 3 334
4had-assembly1.cif.gz_C crystal structure of probable oxidoreductase protein from rhizobium etli cfn 42 0.9599 3 334
4had-assembly1.cif.gz_D crystal structure of probable oxidoreductase protein from rhizobium etli cfn 42 0.9593 3 334
3rcb-assembly1.cif.gz_A crystal structure of the k102e mutant of kijd10, a 3-ketoreductase from actinomadura kijaniata in complex with tdp-benzene and nadp 0.9481 3 325
ID Description Score Start End Superfamily
4hadB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9766 4 121 3.40.50.720
af_P42599_1_134_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9549 5 137 3.40.50.720
4hadB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9524 4 121 3.40.50.720
af_M9PE54_6_126_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9493 4 121 3.40.50.720
2glxE01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9477 6 123 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3D0UQF4-F1-model_v4 NAD-binding protein 0.9778 47 334 GO:0000166
GO:0016491
AF-A0A659YI87-F1-model_v4 deleted 0.9771 43 234
AF-A0A367XK60-F1-model_v4 NAD-binding protein 0.977 5 333 GO:0000166
GO:0016491
AF-A0A659YI87-F1-model_v4 deleted 0.9721 43 234
AF-A0A7C5JT62-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9697 1 227 GO:0000166
GO:0016491

Map