F437443

General Info

Members Datasets Scaffolds Average Seq Length
411 185 411 261

Family's Representative Sequence

Representative Sequence 3300005333|Ga0070677_10012111|Ga0070677_100121112
Length 287
Sequence VEIAPGDLGRTRWRVHFPCGPRAIRFPRVEIQPPPLPDVQLEPEPQLALYGRVIVIVGGTTGLGFSAARACVQADPSTAPAAIERALSDFGRFDAMYHVAGGSGRKFGDGPLHDITDDGWEFTHRLNLDSLFYSNRAAVRQFLLQTGSAGAGSDGAPAGGTILNMGSVLGFSPSPKYFSTHAYASTKAAVIGLTRACAAYYAPQNIRFNVIVPALIETPMSHRAAGDETIMHFIKTKQPLDGGRIGRPEDVDAAVVFFLSDASKFCTGQVLTIDGGWSVTEGQYEKE

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
131 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
132 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
137 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
138 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
142 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
143 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
146 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
147 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
148 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
149 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
150 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
151 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
152 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
153 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
154 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
155 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
156 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
157 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
158 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
159 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
160 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
161 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
168 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
180 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
181 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
182 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
185 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.73
Nodule 0
Rhizoplane 1.7
Rhizosphere 97.32
Stem 0
Stem Tuber 0
Unclassified 0.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10000545 3300002459 Bacteria 10495
2 JGI25406J46586_10013880 3300003203 Bacteria 3441
3 rootH1_10193037 3300003316 Bacteria 2036
4 Ga0065712_10094814 3300005290 Bacteria 2240
5 Ga0065712_10132405 3300005290 Bacteria 1527
6 Ga0065712_10224066 3300005290 Bacteria 1032
7 Ga0070676_10031548 3300005328 Unclassified 3029
8 Ga0070676_10125135 3300005328 Bacteria 1619
9 Ga0070683_100025520 3300005329 Bacteria 5309
10 Ga0070683_100065286 3300005329 Bacteria 3389
11 Ga0070683_100208216 3300005329 Bacteria 1857
12 Ga0070683_100952643 3300005329 Unclassified 824
13 Ga0070690_100008092 3300005330 Bacteria 6039
14 Ga0070690_100304421 3300005330 Bacteria 1144
15 Ga0070670_100005791 3300005331 Bacteria 10443
16 Ga0070670_100031946 3300005331 Bacteria 4533
17 Ga0070670_100075228 3300005331 Unclassified 2901
18 Ga0070670_100090541 3300005331 Bacteria 2629
19 Ga0070670_100205186 3300005331 Bacteria 1713
20 Ga0070670_100315474 3300005331 Bacteria 1369
21 Ga0070670_100532573 3300005331 Bacteria 1047
22 Ga0070677_10012111 3300005333 Unclassified 2988
23 Ga0068869_100003261 3300005334 Bacteria 9915
24 Ga0068869_100007314 3300005334 Bacteria 7041
25 Ga0068869_100055927 3300005334 Unclassified 2876
26 Ga0068869_100262021 3300005334 Bacteria 1384
27 Ga0070666_10041726 3300005335 Bacteria 3067
28 Ga0070666_10110087 3300005335 Bacteria 1904
29 Ga0070680_100336233 3300005336 Unclassified 1283
30 Ga0070680_100577102 3300005336 Bacteria 965
31 Ga0070682_100043417 3300005337 Unclassified 2780
32 Ga0068868_100028396 3300005338 Unclassified 4277
33 Ga0068868_100130068 3300005338 Bacteria 2059
34 Ga0068868_100178468 3300005338 Bacteria 1761
35 Ga0070689_100028943 3300005340 Bacteria 4189
36 Ga0070689_100035542 3300005340 Bacteria 3807
37 Ga0070689_100188159 3300005340 Bacteria 1680
38 Ga0070689_100480356 3300005340 Bacteria 1061
39 Ga0070661_100008647 3300005344 Bacteria 7043
40 Ga0070661_100016448 3300005344 Bacteria 5229
41 Ga0070661_100192984 3300005344 Bacteria 1554
42 Ga0070661_100296958 3300005344 Bacteria 1257
43 Ga0070661_100321174 3300005344 Bacteria 1209
44 Ga0070668_100115267 3300005347 Bacteria 2142
45 Ga0070668_100135703 3300005347 Bacteria 1979
46 Ga0070669_100005693 3300005353 Bacteria 8987
47 Ga0070669_100088039 3300005353 Bacteria 2323
48 Ga0070669_100201319 3300005353 Bacteria 1567
49 Ga0070669_100347358 3300005353 Unclassified 1203
50 Ga0070675_100006743 3300005354 Bacteria 8830
51 Ga0070675_100020023 3300005354 Bacteria 5339
52 Ga0070675_100039784 3300005354 Bacteria 3838
53 Ga0070675_100088983 3300005354 Bacteria 2584
54 Ga0070675_100131266 3300005354 Bacteria 2135
55 Ga0070675_100151049 3300005354 Unclassified 1992
56 Ga0070671_100010173 3300005355 Bacteria 7550
57 Ga0070671_100039614 3300005355 Bacteria 3911
58 Ga0070671_100089463 3300005355 Bacteria 2577
59 Ga0070671_100165592 3300005355 Bacteria 1869
60 Ga0070671_100204076 3300005355 Bacteria 1676
61 Ga0070671_100331167 3300005355 Bacteria 1298
62 Ga0070671_100352667 3300005355 Bacteria 1256
63 Ga0070674_100003350 3300005356 Bacteria 8973
64 Ga0070674_100008328 3300005356 Bacteria 6170
65 Ga0070673_100025663 3300005364 Bacteria 4341
66 Ga0070673_100027513 3300005364 Bacteria 4216
67 Ga0070673_100118274 3300005364 Bacteria 2206
68 Ga0070673_100203615 3300005364 Bacteria 1705
69 Ga0070688_100237800 3300005365 Bacteria 1291
70 Ga0070659_100241575 3300005366 Bacteria 1495
71 Ga0070659_100419179 3300005366 Bacteria 1132
72 Ga0070667_100098978 3300005367 Bacteria 2517
73 Ga0070667_100208219 3300005367 Bacteria 1737
74 Ga0070700_100158829 3300005441 Unclassified 1554
75 Ga0070663_100393421 3300005455 Bacteria 1131
76 Ga0070662_100069534 3300005457 Bacteria 2591
77 Ga0070662_100076478 3300005457 Bacteria 2482
78 Ga0070662_100174237 3300005457 Bacteria 1691
79 Ga0070681_10160645 3300005458 Bacteria 2171
80 Ga0068867_100037896 3300005459 Bacteria 3506
81 Ga0068867_100039986 3300005459 Unclassified 3420
82 Ga0068867_100108129 3300005459 Bacteria 2132
83 Ga0070685_10047189 3300005466 Bacteria 2476
84 Ga0070698_100010827 3300005471 Bacteria 9706
85 Ga0070679_100113515 3300005530 Bacteria 2694
86 Ga0070684_100358155 3300005535 Bacteria 1342
87 Ga0070684_100790880 3300005535 Bacteria 887
88 Ga0068853_100011448 3300005539 Bacteria 7209
89 Ga0068853_100021954 3300005539 Bacteria 5325
90 Ga0070672_100029510 3300005543 Bacteria 4114
91 Ga0070672_100312213 3300005543 Bacteria 1335
92 Ga0070665_100042749 3300005548 Bacteria 4555
93 Ga0070665_100358808 3300005548 Bacteria 1463
94 Ga0070665_100627940 3300005548 Unclassified 1087
95 Ga0068855_100001155 3300005563 Bacteria 32713
96 Ga0068855_100384020 3300005563 Bacteria 1541
97 Ga0070664_100015051 3300005564 Bacteria 6315
98 Ga0070664_100044733 3300005564 Bacteria 3738
99 Ga0070664_100064599 3300005564 Unclassified 3122
100 Ga0070664_100166616 3300005564 Bacteria 1952
101 Ga0070664_100178890 3300005564 Bacteria 1884
102 Ga0070664_100186758 3300005564 Bacteria 1845
103 Ga0070664_100290911 3300005564 Bacteria 1475
104 Ga0070664_100341379 3300005564 Bacteria 1360
105 Ga0070664_100369877 3300005564 Bacteria 1307
106 Ga0068854_100133577 3300005578 Bacteria 1897
107 Ga0068854_100253179 3300005578 Bacteria 1407
108 Ga0068856_100022552 3300005614 Bacteria 6121
109 Ga0068856_100069500 3300005614 Bacteria 3482
110 Ga0070702_100058516 3300005615 Bacteria 2233
111 Ga0068852_100066451 3300005616 Bacteria 3149
112 Ga0068852_100121652 3300005616 Bacteria 2391
113 Ga0068852_100385274 3300005616 Bacteria 1376
114 Ga0068852_100636193 3300005616 Unclassified 1073
115 Ga0068852_100671860 3300005616 Bacteria 1045
116 Ga0068859_100018765 3300005617 Bacteria 6951
117 Ga0068859_100199846 3300005617 Bacteria 2084
118 Ga0068859_100254574 3300005617 Bacteria 1846
119 Ga0068859_100293060 3300005617 Bacteria 1720
120 Ga0068864_100008815 3300005618 Bacteria 8315
121 Ga0068864_100071287 3300005618 Bacteria 3025
122 Ga0068864_100151843 3300005618 Bacteria 2099
123 Ga0068864_100170207 3300005618 Bacteria 1986
124 Ga0068866_10027729 3300005718 Bacteria 2691
125 Ga0068866_10136093 3300005718 Bacteria 1404
126 Ga0068861_100002756 3300005719 Bacteria 11524
127 Ga0068861_100038136 3300005719 Bacteria 3576
128 Ga0068861_100091326 3300005719 Unclassified 2404
129 Ga0068861_100627460 3300005719 Bacteria 990
130 Ga0068870_10011389 3300005840 Bacteria 4123
131 Ga0068863_100133857 3300005841 Bacteria 2368
132 Ga0068863_100287792 3300005841 Bacteria 1593
133 Ga0068858_100123257 3300005842 Bacteria 2425
134 Ga0068858_100125207 3300005842 Bacteria 2405
135 Ga0068860_100060192 3300005843 Bacteria 3609
136 Ga0068860_100581633 3300005843 Bacteria 1124
137 Ga0068860_100742465 3300005843 Unclassified 993
138 Ga0068862_100222110 3300005844 Bacteria 1711
139 Ga0081455_10438608 3300005937 Unclassified 895
140 Ga0081539_10006177 3300005985 Bacteria 11653
141 Ga0081539_10129673 3300005985 Bacteria 1240
142 Ga0097621_100002592 3300006237 Bacteria 12387
143 Ga0097621_100068043 3300006237 Bacteria 2936
144 Ga0097621_100105235 3300006237 Bacteria 2379
145 Ga0097621_100356830 3300006237 Bacteria 1301
146 Ga0097621_100594552 3300006237 Bacteria 1011
147 Ga0068871_100000063 3300006358 Bacteria 58377
148 Ga0068871_100099704 3300006358 Unclassified 2432
149 Ga0068871_100112706 3300006358 Unclassified 2289
150 Ga0068871_100435507 3300006358 Bacteria 1173
151 Ga0075430_100009491 3300006846 Bacteria 8224
152 Ga0075431_100004321 3300006847 Bacteria 13925
153 Ga0075431_100043296 3300006847 Unclassified 4646
154 Ga0075434_100688240 3300006871 Bacteria 1040
155 Ga0075434_100958691 3300006871 Bacteria 870
156 Ga0075429_100052624 3300006880 Bacteria 3543
157 Ga0075429_100057893 3300006880 Unclassified 3375
158 Ga0075429_100544934 3300006880 Bacteria 1017
159 Ga0075429_100549250 3300006880 Bacteria 1012
160 Ga0068865_100173437 3300006881 Bacteria 1655
161 Ga0068865_100419485 3300006881 Bacteria 1100
162 Ga0097620_100018765 3300006931 Bacteria 6951
163 Ga0097620_100199833 3300006931 Bacteria 2084
164 Ga0097620_100254589 3300006931 Bacteria 1846
165 Ga0097620_100293041 3300006931 Bacteria 1720
166 Ga0105240_10000183 3300009093 Bacteria 127268
167 Ga0111539_10091678 3300009094 Bacteria 3570
168 Ga0111539_10125102 3300009094 Bacteria 3013
169 Ga0111539_10128766 3300009094 Bacteria 2965
170 Ga0111539_10174747 3300009094 Bacteria 2509
171 Ga0111539_10463629 3300009094 Bacteria 1475
172 Ga0105247_10225754 3300009101 Bacteria 1270
173 Ga0114129_10208684 3300009147 Unclassified 2642
174 Ga0114129_10235198 3300009147 Bacteria 2466
175 Ga0105241_10012631 3300009174 Bacteria 6198
176 Ga0105242_10084996 3300009176 Bacteria 2653
177 Ga0105242_10519573 3300009176 Bacteria 1136
178 Ga0105248_10188047 3300009177 Bacteria 2327
179 Ga0105249_10097334 3300009553 Bacteria 2762
180 Ga0105249_10208111 3300009553 Bacteria 1918
181 Ga0105249_10532104 3300009553 Bacteria 1224
182 Ga0105239_10077813 3300010375 Bacteria 3650
183 Ga0105239_10115590 3300010375 Bacteria 2976
184 Ga0105246_10015270 3300011119 Bacteria 4846
185 Ga0105246_10217366 3300011119 Bacteria 1496
186 Ga0157373_10034482 3300013100 Bacteria 3634
187 Ga0157373_10197309 3300013100 Unclassified 1419
188 Ga0157369_10057467 3300013105 Bacteria 4197
189 Ga0157369_10094275 3300013105 Bacteria 3195
190 Ga0157374_10015030 3300013296 Bacteria 6786
191 Ga0157374_10088079 3300013296 Bacteria 2956
192 Ga0157374_10112908 3300013296 Bacteria 2615
193 Ga0157374_10118939 3300013296 Bacteria 2548
194 Ga0157374_10149572 3300013296 Bacteria 2269
195 Ga0157374_10209600 3300013296 Bacteria 1910
196 Ga0157378_10001884 3300013297 Bacteria 18820
197 Ga0157378_10080900 3300013297 Bacteria 2936
198 Ga0157378_10365815 3300013297 Bacteria 1412
199 Ga0157378_10749221 3300013297 Bacteria 999
200 Ga0163162_10000233 3300013306 Bacteria 50817
201 Ga0163162_10001661 3300013306 Bacteria 20854
202 Ga0163162_10001973 3300013306 Bacteria 19284
203 Ga0163162_10006555 3300013306 Bacteria 11277
204 Ga0163162_10084575 3300013306 Bacteria 3248
205 Ga0163162_10142817 3300013306 Bacteria 2508
206 Ga0163162_10547259 3300013306 Unclassified 1286
207 Ga0157372_10083123 3300013307 Bacteria 3627
208 Ga0157372_10605855 3300013307 Bacteria 1277
209 Ga0157375_10010527 3300013308 Bacteria 8141
210 Ga0157375_10101300 3300013308 Unclassified 2963
211 Ga0157375_10123457 3300013308 Bacteria 2702
212 Ga0157375_10239527 3300013308 Bacteria 1974
213 Ga0163163_10003381 3300014325 Bacteria 13544
214 Ga0163163_10026797 3300014325 Bacteria 5513
215 Ga0163163_10096368 3300014325 Bacteria 2978
216 Ga0163163_10129571 3300014325 Unclassified 2563
217 Ga0163163_10144543 3300014325 Bacteria 2421
218 Ga0157380_10019885 3300014326 Bacteria 5010
219 Ga0157380_10065035 3300014326 Bacteria 2929
220 Ga0157377_10023189 3300014745 Unclassified 3287
221 Ga0157377_10042819 3300014745 Bacteria 2517
222 Ga0157377_10146850 3300014745 Bacteria 1454
223 Ga0157377_10192918 3300014745 Bacteria 1288
224 Ga0157379_10007937 3300014968 Bacteria 9203
225 Ga0157379_10045361 3300014968 Bacteria 3923
226 Ga0157379_10058399 3300014968 Bacteria 3449
227 Ga0157379_10449632 3300014968 Bacteria 1189
228 Ga0157379_10540654 3300014968 Bacteria 1083
229 Ga0157376_10000481 3300014969 Bacteria 25767
230 Ga0157376_10062491 3300014969 Unclassified 3134
231 Ga0163161_10001665 3300017792 Bacteria 16315
232 Ga0163161_10007646 3300017792 Bacteria 7475
233 Ga0163161_10060753 3300017792 Bacteria 2751
234 Ga0209050_1000777 3300025298 Bacteria 45639
235 Ga0207697_10061275 3300025315 Bacteria 1565
236 Ga0207682_10007074 3300025893 Bacteria 4496
237 Ga0207688_10097326 3300025901 Bacteria 1695
238 Ga0207680_10015631 3300025903 Bacteria 3966
239 Ga0207647_10014581 3300025904 Bacteria 5415
240 Ga0207645_10002906 3300025907 Bacteria 13236
241 Ga0207645_10076965 3300025907 Bacteria 2137
242 Ga0207645_10095037 3300025907 Bacteria 1919
243 Ga0207645_10176866 3300025907 Bacteria 1400
244 Ga0207645_10309286 3300025907 Bacteria 1053
245 Ga0207707_10126528 3300025912 Bacteria 2235
246 Ga0207695_10000279 3300025913 Bacteria 127268
247 Ga0207657_10003713 3300025919 Bacteria 16219
248 Ga0207649_10074178 3300025920 Bacteria 2183
249 Ga0207649_10250388 3300025920 Bacteria 1276
250 Ga0207681_10140243 3300025923 Bacteria 1799
251 Ga0207650_10021541 3300025925 Bacteria 4554
252 Ga0207650_10050211 3300025925 Unclassified 3084
253 Ga0207650_10172049 3300025925 Bacteria 1722
254 Ga0207650_10191542 3300025925 Unclassified 1634
255 Ga0207650_10265222 3300025925 Bacteria 1394
256 Ga0207659_10035319 3300025926 Unclassified 3454
257 Ga0207659_10050910 3300025926 Bacteria 2944
258 Ga0207659_10067474 3300025926 Unclassified 2598
259 Ga0207659_10125425 3300025926 Unclassified 1974
260 Ga0207644_10085077 3300025931 Bacteria 2345
261 Ga0207644_10272243 3300025931 Bacteria 1357
262 Ga0207644_10323737 3300025931 Bacteria 1247
263 Ga0207690_10418831 3300025932 Bacteria 1071
264 Ga0207706_10014650 3300025933 Bacteria 7101
265 Ga0207706_10031447 3300025933 Bacteria 4728
266 Ga0207706_10031921 3300025933 Bacteria 4692
267 Ga0207706_10086128 3300025933 Bacteria 2762
268 Ga0207670_10023065 3300025936 Bacteria 3867
269 Ga0207670_10094106 3300025936 Bacteria 2125
270 Ga0207670_10308962 3300025936 Bacteria 1240
271 Ga0207669_10079710 3300025937 Bacteria 2091
272 Ga0207704_10002971 3300025938 Bacteria 7662
273 Ga0207704_10135797 3300025938 Bacteria 1711
274 Ga0207691_10002263 3300025940 Bacteria 18853
275 Ga0207691_10040499 3300025940 Bacteria 4303
276 Ga0207691_10162528 3300025940 Bacteria 1958
277 Ga0207691_10552392 3300025940 Bacteria 976
278 Ga0207689_10001853 3300025942 Bacteria 20012
279 Ga0207689_10023509 3300025942 Bacteria 5172
280 Ga0207689_10023588 3300025942 Bacteria 5160
281 Ga0207689_10042152 3300025942 Unclassified 3777
282 Ga0207689_10255452 3300025942 Bacteria 1450
283 Ga0207689_10610276 3300025942 Unclassified 918
284 Ga0207661_10044158 3300025944 Bacteria 3521
285 Ga0207661_10105795 3300025944 Unclassified 2371
286 Ga0207661_10131163 3300025944 Bacteria 2147
287 Ga0207679_10021439 3300025945 Bacteria 4381
288 Ga0207679_10132974 3300025945 Bacteria 1999
289 Ga0207679_10172095 3300025945 Bacteria 1784
290 Ga0207679_10490029 3300025945 Bacteria 1095
291 Ga0207679_10594682 3300025945 Bacteria 996
292 Ga0207667_10000197 3300025949 Bacteria 87987
293 Ga0207667_10183534 3300025949 Bacteria 2148
294 Ga0207651_10043042 3300025960 Bacteria 3011
295 Ga0207651_10186366 3300025960 Bacteria 1651
296 Ga0207651_10395603 3300025960 Unclassified 1174
297 Ga0207651_10713299 3300025960 Bacteria 884
298 Ga0207712_10005672 3300025961 Bacteria 7877
299 Ga0207668_10185883 3300025972 Bacteria 1643
300 Ga0207658_10250679 3300025986 Bacteria 1504
301 Ga0207677_10028701 3300026023 Unclassified 3524
302 Ga0207677_10094745 3300026023 Bacteria 2180
303 Ga0207703_10012181 3300026035 Bacteria 6704
304 Ga0207703_10140720 3300026035 Bacteria 2094
305 Ga0207703_10233492 3300026035 Bacteria 1650
306 Ga0207639_10234414 3300026041 Bacteria 1593
307 Ga0207639_10251086 3300026041 Bacteria 1542
308 Ga0207639_10652307 3300026041 Bacteria 974
309 Ga0207678_10018265 3300026067 Bacteria 6158
310 Ga0207708_10199405 3300026075 Unclassified 1596
311 Ga0207702_10042136 3300026078 Unclassified 3829
312 Ga0207702_10372968 3300026078 Bacteria 1370
313 Ga0207641_10228421 3300026088 Unclassified 1729
314 Ga0207641_10413004 3300026088 Unclassified 1298
315 Ga0207648_10015045 3300026089 Bacteria 7125
316 Ga0207648_10042490 3300026089 Bacteria 3990
317 Ga0207648_10133652 3300026089 Bacteria 2184
318 Ga0207648_10263788 3300026089 Bacteria 1537
319 Ga0207676_10030980 3300026095 Unclassified 4019
320 Ga0207676_10139125 3300026095 Bacteria 2076
321 Ga0207676_10141862 3300026095 Bacteria 2058
322 Ga0207674_10029138 3300026116 Bacteria 5817
323 Ga0207674_10043695 3300026116 Bacteria 4619
324 Ga0207674_10099200 3300026116 Bacteria 2895
325 Ga0207674_10162540 3300026116 Bacteria 2187
326 Ga0207675_100005762 3300026118 Bacteria 11850
327 Ga0207675_100377676 3300026118 Bacteria 1393
328 Ga0207683_10002457 3300026121 Bacteria 16153
329 Ga0207683_10010588 3300026121 Bacteria 7865
330 Ga0207698_10081710 3300026142 Bacteria 2609
331 Ga0207698_10103714 3300026142 Bacteria 2364
332 Ga0207698_10113957 3300026142 Bacteria 2273
333 Ga0207698_10198295 3300026142 Bacteria 1795
334 Ga0207698_10311399 3300026142 Bacteria 1470
335 Ga0207698_10379071 3300026142 Bacteria 1345
336 Ga0207698_10643434 3300026142 Bacteria 1050
337 Ga0268265_10099877 3300028380 Bacteria 2341
338 Ga0268264_10011444 3300028381 Bacteria 7326
339 Ga0268264_10219814 3300028381 Bacteria 1748
340 Ga0265334_10022591 3300028573 Bacteria 2562
341 Ga0265338_10012756 3300028800 Bacteria 9560
342 Ga0265327_10000054 3300031251 Bacteria 250337
343 Ga0307414_10350932 3300032004 Unclassified 1266
344 Ga0307411_10209150 3300032005 Bacteria 1505
345 Ga0373936_0156219 3300035113 Unclassified 991
346 Ga0373955_0046118 3300035172 Unclassified 2355
347 Ga0373931_0177357 3300035691 Bacteria 1260
348 Ga0373935_0105710 3300035692 Unclassified 1862
349 Ga0373947_0136709 3300035725 Unclassified 1569
350 Ga0373937_0007495 3300036401 Bacteria 9445
351 Ga0451807_1480760 3300041486 Bacteria 965
352 Ga0451577_0001477 3300042876 Bacteria 31183
353 Ga0451577_0090637 3300042876 Bacteria 2729
354 Ga0453684_0076162 3300044712 Bacteria 4213
355 Ga0453684_0408633 3300044712 Bacteria 1519
356 Ga0451576_0173116 3300045051 Bacteria 2253
357 Ga0495592_0099199 3300046454 Unclassified 2078
358 Ga0495650_0030022 3300046471 Bacteria 2469
359 Ga0495608_0018629 3300046511 Bacteria 4786
360 Ga0495618_0164259 3300046514 Bacteria 1414
361 Ga0495628_0022996 3300046516 Bacteria 5117
362 Ga0495630_0027416 3300046517 Bacteria 4226
363 Ga0495630_0108002 3300046517 Bacteria 2108
364 Ga0495640_0149101 3300046533 Bacteria 1504
365 Ga0495586_0008797 3300046535 Bacteria 5377
366 Ga0495587_0019947 3300046536 Bacteria 4143
367 Ga0495634_0022557 3300046642 Bacteria 4435
368 Ga0495634_0051934 3300046642 Bacteria 2750
369 Ga0495625_0199619 3300046660 Bacteria 1321
370 Ga0495635_0093925 3300046663 Bacteria 2051
371 Ga0495657_0128706 3300046675 Bacteria 1588
372 Ga0495658_0045516 3300046683 Bacteria 2463
373 Ga0495613_0108569 3300046689 Bacteria 2001
374 Ga0495680_0169949 3300047322 Bacteria 1579
375 Ga0495684_0068560 3300047471 Bacteria 2697
376 Ga0495684_0077529 3300047471 Bacteria 2523
377 Ga0496101_0023252 3300048904 Bacteria 4280
378 Ga0496102_0170656 3300048905 Bacteria 2048
379 Ga0496104_0418702 3300048907 Bacteria 1252
380 Ga0496106_0340774 3300048909 Unclassified 1204
381 Ga0496110_0123798 3300048913 Bacteria 2331
382 Ga0496111_0265328 3300048914 Unclassified 1274
383 Ga0501033_0075425 3300049570 Bacteria 2475
384 Ga0501034_0036145 3300049571 Bacteria 5005
385 Ga0501034_0051623 3300049571 Bacteria 4146
386 Ga0501034_0077441 3300049571 Bacteria 3331
387 Ga0501034_0126883 3300049571 Bacteria 2536
388 Ga0501036_0210657 3300049572 Bacteria 1633
389 Ga0501037_0015340 3300049573 Bacteria 5637
390 Ga0501038_0074309 3300049574 Bacteria 2876
391 Ga0501039_0153766 3300049575 Bacteria 1807
392 Ga0501043_0026630 3300049579 Unclassified 4537
393 Ga0501043_0057489 3300049579 Bacteria 3054
394 Ga0501047_0057139 3300049581 Unclassified 3774
395 Ga0501047_0103438 3300049581 Bacteria 2728
396 Ga0501047_0402395 3300049581 Bacteria 1202
397 Ga0501080_0265871 3300049742 Bacteria 1562
398 Ga0501035_0046797 3300049822 Unclassified 3890
399 Ga0501044_0046431 3300049823 Bacteria 4496
400 Ga0501044_0181295 3300049823 Unclassified 2072
401 nmdc:mga05p37_189102_c1 3300050507 Unclassified 2501
402 nmdc:mga09592_36429_c1 3300050508 Bacteria 4121
403 nmdc:mga09592_47759_c1 3300050508 Unclassified 3608
404 nmdc:mga0qj67_160386_c1 3300050509 Bacteria 1826
405 nmdc:mga06r32_138115_c1 3300050510 Unclassified 2412
406 nmdc:mga06r32_172120_c1 3300050510 Bacteria 2149
407 nmdc:mga08y16_118041_c1 3300050511 Bacteria 2761
408 nmdc:mga08y16_167817_c1 3300050511 Bacteria 2280
409 nmdc:mga08y16_214908_c1 3300050511 Unclassified 1991
410 Ga0500568_0014851 3300053139 Bacteria 3502
411 Ga0500616_0006409 3300053153 Bacteria 7714

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041486 Ga0451807_1480760 Ga0451807_1480760_164_898 198
2 3300005331 Ga0070670_100031946 Ga0070670_1000319462 207
3 3300025925 Ga0207650_10172049 Ga0207650_101720492 207
4 3300005329 Ga0070683_100952643 Ga0070683_1009526431 221
5 3300005616 Ga0068852_100636193 Ga0068852_1006361931 221
6 3300025936 Ga0207670_10094106 Ga0207670_100941062 221
7 3300026078 Ga0207702_10372968 Ga0207702_103729682 221
8 3300049574 Ga0501038_0074309 Ga0501038_0074309_721_1512 226
9 3300049823 Ga0501044_0046431 Ga0501044_0046431_2874_3665 226
10 3300005354 Ga0070675_100020023 Ga0070675_1000200234 229
11 3300025926 Ga0207659_10067474 Ga0207659_100674743 229
12 3300005331 Ga0070670_100315474 Ga0070670_1003154742 230
13 3300025925 Ga0207650_10265222 Ga0207650_102652222 230
14 3300005441 Ga0070700_100158829 Ga0070700_1001588291 231
15 3300005937 Ga0081455_10438608 Ga0081455_104386082 231
16 3300009094 Ga0111539_10128766 Ga0111539_101287663 231
17 3300026075 Ga0207708_10199405 Ga0207708_101994052 231
18 3300028573 Ga0265334_10022591 Ga0265334_100225912 231
19 3300028800 Ga0265338_10012756 Ga0265338_100127565 231
20 3300050511 nmdc:mga08y16_118041_c1 nmdc:mga08y16_118041_c1_62_853 231
21 3300005328 Ga0070676_10125135 Ga0070676_101251351 232
22 3300005333 Ga0070677_10012111 Ga0070677_100121112 232
23 3300005354 Ga0070675_100006743 Ga0070675_1000067431 232
24 3300025907 Ga0207645_10095037 Ga0207645_100950371 232
25 3300025926 Ga0207659_10035319 Ga0207659_100353191 232
26 3300005985 Ga0081539_10129673 Ga0081539_101296732 234
27 3300042876 Ga0451577_0090637 Ga0451577_0090637_1475_2248 234
28 3300005618 Ga0068864_100071287 Ga0068864_1000712873 235
29 3300003316 rootH1_10193037 rootH1_101930372 236
30 3300005328 Ga0070676_10031548 Ga0070676_100315482 236
31 3300005331 Ga0070670_100075228 Ga0070670_1000752282 236
32 3300005334 Ga0068869_100007314 Ga0068869_1000073145 236
33 3300005353 Ga0070669_100005693 Ga0070669_1000056937 236
34 3300005355 Ga0070671_100352667 Ga0070671_1003526672 236
35 3300005356 Ga0070674_100008328 Ga0070674_1000083284 236
36 3300005364 Ga0070673_100025663 Ga0070673_1000256635 236
37 3300005457 Ga0070662_100076478 Ga0070662_1000764782 236
38 3300005539 Ga0068853_100021954 Ga0068853_1000219543 236
39 3300005543 Ga0070672_100029510 Ga0070672_1000295101 236
40 3300005563 Ga0068855_100001155 Ga0068855_10000115524 236
41 3300005564 Ga0070664_100290911 Ga0070664_1002909112 236
42 3300005616 Ga0068852_100121652 Ga0068852_1001216522 236
43 3300005617 Ga0068859_100018765 Ga0068859_1000187655 236
44 3300005718 Ga0068866_10027729 Ga0068866_100277292 236
45 3300005840 Ga0068870_10011389 Ga0068870_100113892 236
46 3300005842 Ga0068858_100123257 Ga0068858_1001232572 236
47 3300006358 Ga0068871_100099704 Ga0068871_1000997042 236
48 3300006931 Ga0097620_100018765 Ga0097620_1000187655 236
49 3300011119 Ga0105246_10015270 Ga0105246_100152704 236
50 3300013306 Ga0163162_10142817 Ga0163162_101428172 236
51 3300014326 Ga0157380_10019885 Ga0157380_100198854 236
52 3300014968 Ga0157379_10449632 Ga0157379_104496322 236
53 3300025903 Ga0207680_10015631 Ga0207680_100156314 236
54 3300025907 Ga0207645_10002906 Ga0207645_100029063 236
55 3300025925 Ga0207650_10050211 Ga0207650_100502112 236
56 3300025933 Ga0207706_10031921 Ga0207706_100319213 236
57 3300025937 Ga0207669_10079710 Ga0207669_100797102 236
58 3300025938 Ga0207704_10002971 Ga0207704_100029715 236
59 3300025940 Ga0207691_10040499 Ga0207691_100404993 236
60 3300025942 Ga0207689_10023509 Ga0207689_100235094 236
61 3300025949 Ga0207667_10000197 Ga0207667_1000019724 236
62 3300025960 Ga0207651_10043042 Ga0207651_100430422 236
63 3300026089 Ga0207648_10015045 Ga0207648_100150455 236
64 3300026116 Ga0207674_10043695 Ga0207674_100436955 236
65 3300026121 Ga0207683_10002457 Ga0207683_100024576 236
66 3300026142 Ga0207698_10113957 Ga0207698_101139572 236
67 3300026142 Ga0207698_10379071 Ga0207698_103790711 236
68 3300005548 Ga0070665_100627940 Ga0070665_1006279401 237
69 3300009093 Ga0105240_10000183 Ga0105240_1000018361 237
70 3300010375 Ga0105239_10077813 Ga0105239_100778132 237
71 3300025913 Ga0207695_10000279 Ga0207695_1000027935 237
72 3300042876 Ga0451577_0001477 Ga0451577_0001477_24381_25169 237
73 3300005617 Ga0068859_100293060 Ga0068859_1002930602 238
74 3300005718 Ga0068866_10136093 Ga0068866_101360932 238
75 3300005843 Ga0068860_100060192 Ga0068860_1000601923 238
76 3300005843 Ga0068860_100581633 Ga0068860_1005816332 238
77 3300006846 Ga0075430_100009491 Ga0075430_1000094916 238
78 3300006847 Ga0075431_100004321 Ga0075431_1000043216 238
79 3300006847 Ga0075431_100043296 Ga0075431_1000432963 238
80 3300006880 Ga0075429_100052624 Ga0075429_1000526243 238
81 3300006880 Ga0075429_100057893 Ga0075429_1000578932 238
82 3300006931 Ga0097620_100293041 Ga0097620_1002930412 238
83 3300009094 Ga0111539_10463629 Ga0111539_104636292 238
84 3300009147 Ga0114129_10208684 Ga0114129_102086842 238
85 3300009553 Ga0105249_10532104 Ga0105249_105321042 238
86 3300014325 Ga0163163_10144543 Ga0163163_101445432 238
87 3300026095 Ga0207676_10139125 Ga0207676_101391252 238
88 3300026121 Ga0207683_10010588 Ga0207683_100105882 238
89 3300028381 Ga0268264_10011444 Ga0268264_100114441 238
90 3300031251 Ga0265327_10000054 Ga0265327_1000005486 238
91 3300050507 nmdc:mga05p37_189102_c1 nmdc:mga05p37_189102_c1_624_1415 238
92 3300050508 nmdc:mga09592_36429_c1 nmdc:mga09592_36429_c1_3071_3859 238
93 3300050508 nmdc:mga09592_47759_c1 nmdc:mga09592_47759_c1_1908_2699 238
94 3300050510 nmdc:mga06r32_138115_c1 nmdc:mga06r32_138115_c1_926_1717 238
95 3300050511 nmdc:mga08y16_214908_c1 nmdc:mga08y16_214908_c1_993_1784 238
96 3300003203 JGI25406J46586_10013880 JGI25406J46586_100138803 239
97 3300005290 Ga0065712_10094814 Ga0065712_100948142 239
98 3300005290 Ga0065712_10132405 Ga0065712_101324052 239
99 3300005290 Ga0065712_10224066 Ga0065712_102240661 239
100 3300005329 Ga0070683_100208216 Ga0070683_1002082161 239
101 3300005330 Ga0070690_100008092 Ga0070690_1000080923 239
102 3300005331 Ga0070670_100532573 Ga0070670_1005325731 239
103 3300005336 Ga0070680_100336233 Ga0070680_1003362331 239
104 3300005336 Ga0070680_100577102 Ga0070680_1005771021 239
105 3300005337 Ga0070682_100043417 Ga0070682_1000434172 239
106 3300005338 Ga0068868_100028396 Ga0068868_1000283962 239
107 3300005338 Ga0068868_100178468 Ga0068868_1001784682 239
108 3300005340 Ga0070689_100035542 Ga0070689_1000355422 239
109 3300005344 Ga0070661_100192984 Ga0070661_1001929841 239
110 3300005353 Ga0070669_100201319 Ga0070669_1002013192 239
111 3300005354 Ga0070675_100039784 Ga0070675_1000397844 239
112 3300005354 Ga0070675_100131266 Ga0070675_1001312661 239
113 3300005355 Ga0070671_100165592 Ga0070671_1001655922 239
114 3300005355 Ga0070671_100204076 Ga0070671_1002040761 239
115 3300005364 Ga0070673_100027513 Ga0070673_1000275134 239
116 3300005364 Ga0070673_100118274 Ga0070673_1001182742 239
117 3300005455 Ga0070663_100393421 Ga0070663_1003934212 239
118 3300005457 Ga0070662_100174237 Ga0070662_1001742372 239
119 3300005458 Ga0070681_10160645 Ga0070681_101606452 239
120 3300005459 Ga0068867_100037896 Ga0068867_1000378963 239
121 3300005471 Ga0070698_100010827 Ga0070698_1000108271 239
122 3300005530 Ga0070679_100113515 Ga0070679_1001135153 239
123 3300005539 Ga0068853_100011448 Ga0068853_1000114487 239
124 3300005548 Ga0070665_100358808 Ga0070665_1003588082 239
125 3300005563 Ga0068855_100384020 Ga0068855_1003840201 239
126 3300005564 Ga0070664_100015051 Ga0070664_1000150516 239
127 3300005564 Ga0070664_100369877 Ga0070664_1003698772 239
128 3300005578 Ga0068854_100253179 Ga0068854_1002531792 239
129 3300005614 Ga0068856_100022552 Ga0068856_1000225522 239
130 3300005614 Ga0068856_100069500 Ga0068856_1000695004 239
131 3300005615 Ga0070702_100058516 Ga0070702_1000585162 239
132 3300005616 Ga0068852_100385274 Ga0068852_1003852741 239
133 3300005616 Ga0068852_100671860 Ga0068852_1006718602 239
134 3300005617 Ga0068859_100199846 Ga0068859_1001998462 239
135 3300005719 Ga0068861_100038136 Ga0068861_1000381362 239
136 3300005844 Ga0068862_100222110 Ga0068862_1002221102 239
137 3300005985 Ga0081539_10006177 Ga0081539_100061774 239
138 3300006237 Ga0097621_100068043 Ga0097621_1000680433 239
139 3300006237 Ga0097621_100356830 Ga0097621_1003568302 239
140 3300006358 Ga0068871_100112706 Ga0068871_1001127062 239
141 3300006871 Ga0075434_100958691 Ga0075434_1009586911 239
142 3300006880 Ga0075429_100544934 Ga0075429_1005449342 239
143 3300006880 Ga0075429_100549250 Ga0075429_1005492502 239
144 3300006881 Ga0068865_100173437 Ga0068865_1001734372 239
145 3300006881 Ga0068865_100419485 Ga0068865_1004194852 239
146 3300006931 Ga0097620_100199833 Ga0097620_1001998332 239
147 3300009094 Ga0111539_10091678 Ga0111539_100916786 239
148 3300009094 Ga0111539_10125102 Ga0111539_101251022 239
149 3300009147 Ga0114129_10235198 Ga0114129_102351982 239
150 3300009174 Ga0105241_10012631 Ga0105241_100126317 239
151 3300009176 Ga0105242_10084996 Ga0105242_100849963 239
152 3300009176 Ga0105242_10519573 Ga0105242_105195732 239
153 3300009553 Ga0105249_10097334 Ga0105249_100973343 239
154 3300009553 Ga0105249_10208111 Ga0105249_102081112 239
155 3300013100 Ga0157373_10034482 Ga0157373_100344823 239
156 3300013100 Ga0157373_10197309 Ga0157373_101973092 239
157 3300013105 Ga0157369_10057467 Ga0157369_100574672 239
158 3300013105 Ga0157369_10094275 Ga0157369_100942753 239
159 3300013296 Ga0157374_10015030 Ga0157374_100150304 239
160 3300013296 Ga0157374_10088079 Ga0157374_100880794 239
161 3300013296 Ga0157374_10118939 Ga0157374_101189392 239
162 3300013297 Ga0157378_10080900 Ga0157378_100809002 239
163 3300013306 Ga0163162_10000233 Ga0163162_1000023322 239
164 3300013306 Ga0163162_10084575 Ga0163162_100845752 239
165 3300013307 Ga0157372_10083123 Ga0157372_100831234 239
166 3300013307 Ga0157372_10605855 Ga0157372_106058552 239
167 3300014325 Ga0163163_10096368 Ga0163163_100963682 239
168 3300014325 Ga0163163_10129571 Ga0163163_101295712 239
169 3300014326 Ga0157380_10065035 Ga0157380_100650353 239
170 3300014745 Ga0157377_10146850 Ga0157377_101468502 239
171 3300014745 Ga0157377_10192918 Ga0157377_101929182 239
172 3300014968 Ga0157379_10058399 Ga0157379_100583994 239
173 3300014969 Ga0157376_10062491 Ga0157376_100624913 239
174 3300017792 Ga0163161_10007646 Ga0163161_100076464 239
175 3300025298 Ga0209050_1000777 Ga0209050_100077713 239
176 3300025907 Ga0207645_10176866 Ga0207645_101768662 239
177 3300025912 Ga0207707_10126528 Ga0207707_101265282 239
178 3300025919 Ga0207657_10003713 Ga0207657_100037133 239
179 3300025933 Ga0207706_10086128 Ga0207706_100861282 239
180 3300025938 Ga0207704_10135797 Ga0207704_101357972 239
181 3300025942 Ga0207689_10023588 Ga0207689_100235885 239
182 3300025942 Ga0207689_10042152 Ga0207689_100421524 239
183 3300025945 Ga0207679_10490029 Ga0207679_104900291 239
184 3300025945 Ga0207679_10594682 Ga0207679_105946821 239
185 3300025949 Ga0207667_10183534 Ga0207667_101835342 239
186 3300025960 Ga0207651_10713299 Ga0207651_107132991 239
187 3300025986 Ga0207658_10250679 Ga0207658_102506792 239
188 3300026023 Ga0207677_10094745 Ga0207677_100947453 239
189 3300026035 Ga0207703_10140720 Ga0207703_101407202 239
190 3300026041 Ga0207639_10234414 Ga0207639_102344142 239
191 3300026041 Ga0207639_10251086 Ga0207639_102510862 239
192 3300026078 Ga0207702_10042136 Ga0207702_100421364 239
193 3300026089 Ga0207648_10042490 Ga0207648_100424902 239
194 3300026089 Ga0207648_10263788 Ga0207648_102637882 239
195 3300026116 Ga0207674_10099200 Ga0207674_100992002 239
196 3300026116 Ga0207674_10162540 Ga0207674_101625402 239
197 3300026142 Ga0207698_10081710 Ga0207698_100817103 239
198 3300026142 Ga0207698_10198295 Ga0207698_101982951 239
199 3300026142 Ga0207698_10643434 Ga0207698_106434342 239
200 3300028380 Ga0268265_10099877 Ga0268265_100998772 239
201 3300032004 Ga0307414_10350932 Ga0307414_103509322 239
202 3300035691 Ga0373931_0177357 Ga0373931_0177357_73_861 239
203 3300049570 Ga0501033_0075425 Ga0501033_0075425_1310_2101 239
204 3300049571 Ga0501034_0036145 Ga0501034_0036145_1007_1804 239
205 3300049571 Ga0501034_0077441 Ga0501034_0077441_1412_2203 239
206 3300049572 Ga0501036_0210657 Ga0501036_0210657_483_1274 239
207 3300049573 Ga0501037_0015340 Ga0501037_0015340_4355_5146 239
208 3300049575 Ga0501039_0153766 Ga0501039_0153766_76_867 239
209 3300049579 Ga0501043_0026630 Ga0501043_0026630_2603_3394 239
210 3300049579 Ga0501043_0057489 Ga0501043_0057489_1469_2260 239
211 3300049581 Ga0501047_0103438 Ga0501047_0103438_1918_2709 239
212 3300049742 Ga0501080_0265871 Ga0501080_0265871_72_860 239
213 3300049822 Ga0501035_0046797 Ga0501035_0046797_2951_3742 239
214 3300050511 nmdc:mga08y16_167817_c1 nmdc:mga08y16_167817_c1_155_943 239
215 3300005329 Ga0070683_100025520 Ga0070683_1000255201 240
216 3300005331 Ga0070670_100205186 Ga0070670_1002051862 240
217 3300005334 Ga0068869_100262021 Ga0068869_1002620211 240
218 3300005344 Ga0070661_100321174 Ga0070661_1003211742 240
219 3300005347 Ga0070668_100115267 Ga0070668_1001152672 240
220 3300005353 Ga0070669_100347358 Ga0070669_1003473582 240
221 3300005355 Ga0070671_100039614 Ga0070671_1000396144 240
222 3300005366 Ga0070659_100419179 Ga0070659_1004191792 240
223 3300005535 Ga0070684_100358155 Ga0070684_1003581552 240
224 3300005564 Ga0070664_100186758 Ga0070664_1001867581 240
225 3300005719 Ga0068861_100002756 Ga0068861_1000027565 240
226 3300005843 Ga0068860_100742465 Ga0068860_1007424651 240
227 3300006871 Ga0075434_100688240 Ga0075434_1006882402 240
228 3300013296 Ga0157374_10209600 Ga0157374_102096002 240
229 3300013306 Ga0163162_10547259 Ga0163162_105472591 240
230 3300013308 Ga0157375_10123457 Ga0157375_101234573 240
231 3300025920 Ga0207649_10250388 Ga0207649_102503882 240
232 3300025931 Ga0207644_10323737 Ga0207644_103237372 240
233 3300025932 Ga0207690_10418831 Ga0207690_104188312 240
234 3300025942 Ga0207689_10610276 Ga0207689_106102761 240
235 3300025944 Ga0207661_10044158 Ga0207661_100441584 240
236 3300025945 Ga0207679_10172095 Ga0207679_101720951 240
237 3300025972 Ga0207668_10185883 Ga0207668_101858832 240
238 3300026118 Ga0207675_100005762 Ga0207675_1000057627 240
239 3300032005 Ga0307411_10209150 Ga0307411_102091502 240
240 3300044712 Ga0453684_0076162 Ga0453684_0076162_2850_3644 240
241 3300046660 Ga0495625_0199619 Ga0495625_0199619_35_832 240
242 3300005329 Ga0070683_100065286 Ga0070683_1000652862 241
243 3300005330 Ga0070690_100304421 Ga0070690_1003044211 241
244 3300005331 Ga0070670_100090541 Ga0070670_1000905413 241
245 3300005334 Ga0068869_100003261 Ga0068869_10000326111 241
246 3300005334 Ga0068869_100055927 Ga0068869_1000559272 241
247 3300005335 Ga0070666_10041726 Ga0070666_100417262 241
248 3300005335 Ga0070666_10110087 Ga0070666_101100872 241
249 3300005338 Ga0068868_100130068 Ga0068868_1001300682 241
250 3300005340 Ga0070689_100028943 Ga0070689_1000289433 241
251 3300005340 Ga0070689_100188159 Ga0070689_1001881592 241
252 3300005340 Ga0070689_100480356 Ga0070689_1004803562 241
253 3300005344 Ga0070661_100008647 Ga0070661_1000086479 241
254 3300005344 Ga0070661_100296958 Ga0070661_1002969582 241
255 3300005353 Ga0070669_100088039 Ga0070669_1000880393 241
256 3300005354 Ga0070675_100088983 Ga0070675_1000889833 241
257 3300005355 Ga0070671_100010173 Ga0070671_1000101735 241
258 3300005355 Ga0070671_100089463 Ga0070671_1000894632 241
259 3300005355 Ga0070671_100331167 Ga0070671_1003311671 241
260 3300005356 Ga0070674_100003350 Ga0070674_1000033503 241
261 3300005364 Ga0070673_100203615 Ga0070673_1002036152 241
262 3300005365 Ga0070688_100237800 Ga0070688_1002378001 241
263 3300005366 Ga0070659_100241575 Ga0070659_1002415752 241
264 3300005367 Ga0070667_100098978 Ga0070667_1000989782 241
265 3300005367 Ga0070667_100208219 Ga0070667_1002082192 241
266 3300005457 Ga0070662_100069534 Ga0070662_1000695341 241
267 3300005459 Ga0068867_100039986 Ga0068867_1000399862 241
268 3300005466 Ga0070685_10047189 Ga0070685_100471892 241
269 3300005535 Ga0070684_100790880 Ga0070684_1007908801 241
270 3300005543 Ga0070672_100312213 Ga0070672_1003122132 241
271 3300005548 Ga0070665_100042749 Ga0070665_1000427492 241
272 3300005564 Ga0070664_100044733 Ga0070664_1000447334 241
273 3300005564 Ga0070664_100064599 Ga0070664_1000645993 241
274 3300005564 Ga0070664_100166616 Ga0070664_1001666162 241
275 3300005564 Ga0070664_100178890 Ga0070664_1001788902 241
276 3300005578 Ga0068854_100133577 Ga0068854_1001335772 241
277 3300005616 Ga0068852_100066451 Ga0068852_1000664513 241
278 3300005617 Ga0068859_100254574 Ga0068859_1002545742 241
279 3300005618 Ga0068864_100008815 Ga0068864_1000088152 241
280 3300005618 Ga0068864_100151843 Ga0068864_1001518432 241
281 3300005618 Ga0068864_100170207 Ga0068864_1001702071 241
282 3300005719 Ga0068861_100627460 Ga0068861_1006274601 241
283 3300005841 Ga0068863_100133857 Ga0068863_1001338572 241
284 3300005841 Ga0068863_100287792 Ga0068863_1002877922 241
285 3300005842 Ga0068858_100125207 Ga0068858_1001252073 241
286 3300006237 Ga0097621_100002592 Ga0097621_1000025924 241
287 3300006237 Ga0097621_100105235 Ga0097621_1001052352 241
288 3300006237 Ga0097621_100594552 Ga0097621_1005945521 241
289 3300006358 Ga0068871_100000063 Ga0068871_10000006349 241
290 3300006358 Ga0068871_100435507 Ga0068871_1004355071 241
291 3300006931 Ga0097620_100254589 Ga0097620_1002545892 241
292 3300009101 Ga0105247_10225754 Ga0105247_102257542 241
293 3300009177 Ga0105248_10188047 Ga0105248_101880472 241
294 3300010375 Ga0105239_10115590 Ga0105239_101155902 241
295 3300011119 Ga0105246_10217366 Ga0105246_102173661 241
296 3300013296 Ga0157374_10112908 Ga0157374_101129083 241
297 3300013296 Ga0157374_10149572 Ga0157374_101495722 241
298 3300013297 Ga0157378_10001884 Ga0157378_100018846 241
299 3300013297 Ga0157378_10365815 Ga0157378_103658152 241
300 3300013297 Ga0157378_10749221 Ga0157378_107492211 241
301 3300013306 Ga0163162_10001661 Ga0163162_1000166113 241
302 3300013306 Ga0163162_10001973 Ga0163162_1000197311 241
303 3300013308 Ga0157375_10010527 Ga0157375_100105274 241
304 3300013308 Ga0157375_10101300 Ga0157375_101013002 241
305 3300013308 Ga0157375_10239527 Ga0157375_102395273 241
306 3300014325 Ga0163163_10003381 Ga0163163_1000338115 241
307 3300014325 Ga0163163_10026797 Ga0163163_100267976 241
308 3300014745 Ga0157377_10023189 Ga0157377_100231892 241
309 3300014745 Ga0157377_10042819 Ga0157377_100428192 241
310 3300014968 Ga0157379_10007937 Ga0157379_100079372 241
311 3300014968 Ga0157379_10540654 Ga0157379_105406541 241
312 3300014969 Ga0157376_10000481 Ga0157376_1000048118 241
313 3300017792 Ga0163161_10001665 Ga0163161_100016657 241
314 3300025315 Ga0207697_10061275 Ga0207697_100612752 241
315 3300025901 Ga0207688_10097326 Ga0207688_100973262 241
316 3300025904 Ga0207647_10014581 Ga0207647_100145813 241
317 3300025907 Ga0207645_10076965 Ga0207645_100769652 241
318 3300025907 Ga0207645_10309286 Ga0207645_103092862 241
319 3300025923 Ga0207681_10140243 Ga0207681_101402432 241
320 3300025925 Ga0207650_10191542 Ga0207650_101915422 241
321 3300025926 Ga0207659_10050910 Ga0207659_100509102 241
322 3300025931 Ga0207644_10085077 Ga0207644_100850773 241
323 3300025931 Ga0207644_10272243 Ga0207644_102722431 241
324 3300025933 Ga0207706_10014650 Ga0207706_100146505 241
325 3300025933 Ga0207706_10031447 Ga0207706_100314476 241
326 3300025936 Ga0207670_10023065 Ga0207670_100230653 241
327 3300025936 Ga0207670_10308962 Ga0207670_103089621 241
328 3300025940 Ga0207691_10162528 Ga0207691_101625282 241
329 3300025940 Ga0207691_10552392 Ga0207691_105523921 241
330 3300025942 Ga0207689_10001853 Ga0207689_1000185311 241
331 3300025942 Ga0207689_10255452 Ga0207689_102554521 241
332 3300025944 Ga0207661_10105795 Ga0207661_101057951 241
333 3300025944 Ga0207661_10131163 Ga0207661_101311632 241
334 3300025945 Ga0207679_10021439 Ga0207679_100214397 241
335 3300025945 Ga0207679_10132974 Ga0207679_101329742 241
336 3300025960 Ga0207651_10186366 Ga0207651_101863662 241
337 3300026023 Ga0207677_10028701 Ga0207677_100287012 241
338 3300026035 Ga0207703_10012181 Ga0207703_100121815 241
339 3300026035 Ga0207703_10233492 Ga0207703_102334922 241
340 3300026041 Ga0207639_10652307 Ga0207639_106523071 241
341 3300026067 Ga0207678_10018265 Ga0207678_100182654 241
342 3300026088 Ga0207641_10228421 Ga0207641_102284212 241
343 3300026088 Ga0207641_10413004 Ga0207641_104130042 241
344 3300026089 Ga0207648_10133652 Ga0207648_101336522 241
345 3300026095 Ga0207676_10030980 Ga0207676_100309803 241
346 3300026095 Ga0207676_10141862 Ga0207676_101418621 241
347 3300026116 Ga0207674_10029138 Ga0207674_100291386 241
348 3300026118 Ga0207675_100377676 Ga0207675_1003776762 241
349 3300026142 Ga0207698_10103714 Ga0207698_101037143 241
350 3300026142 Ga0207698_10311399 Ga0207698_103113991 241
351 3300028381 Ga0268264_10219814 Ga0268264_102198142 241
352 3300035113 Ga0373936_0156219 Ga0373936_0156219_21_815 241
353 3300035172 Ga0373955_0046118 Ga0373955_0046118_1410_2204 241
354 3300035692 Ga0373935_0105710 Ga0373935_0105710_734_1528 241
355 3300035725 Ga0373947_0136709 Ga0373947_0136709_663_1469 241
356 3300036401 Ga0373937_0007495 Ga0373937_0007495_746_1540 241
357 3300044712 Ga0453684_0408633 Ga0453684_0408633_29_823 241
358 3300046454 Ga0495592_0099199 Ga0495592_0099199_324_1118 241
359 3300046471 Ga0495650_0030022 Ga0495650_0030022_782_1579 241
360 3300046511 Ga0495608_0018629 Ga0495608_0018629_3319_4113 241
361 3300046514 Ga0495618_0164259 Ga0495618_0164259_276_1070 241
362 3300046516 Ga0495628_0022996 Ga0495628_0022996_1796_2590 241
363 3300046517 Ga0495630_0027416 Ga0495630_0027416_1287_2081 241
364 3300046517 Ga0495630_0108002 Ga0495630_0108002_133_930 241
365 3300046533 Ga0495640_0149101 Ga0495640_0149101_611_1405 241
366 3300046535 Ga0495586_0008797 Ga0495586_0008797_2678_3472 241
367 3300046536 Ga0495587_0019947 Ga0495587_0019947_571_1365 241
368 3300046642 Ga0495634_0022557 Ga0495634_0022557_2720_3514 241
369 3300046642 Ga0495634_0051934 Ga0495634_0051934_1446_2243 241
370 3300046663 Ga0495635_0093925 Ga0495635_0093925_1108_1902 241
371 3300046675 Ga0495657_0128706 Ga0495657_0128706_743_1537 241
372 3300046689 Ga0495613_0108569 Ga0495613_0108569_643_1440 241
373 3300047322 Ga0495680_0169949 Ga0495680_0169949_393_1190 241
374 3300047471 Ga0495684_0068560 Ga0495684_0068560_1669_2466 241
375 3300047471 Ga0495684_0077529 Ga0495684_0077529_282_1076 241
376 3300048904 Ga0496101_0023252 Ga0496101_0023252_2807_3610 241
377 3300048905 Ga0496102_0170656 Ga0496102_0170656_302_1105 241
378 3300048909 Ga0496106_0340774 Ga0496106_0340774_191_994 241
379 3300048913 Ga0496110_0123798 Ga0496110_0123798_957_1751 241
380 3300048914 Ga0496111_0265328 Ga0496111_0265328_218_1012 241
381 3300050509 nmdc:mga0qj67_160386_c1 nmdc:mga0qj67_160386_c1_30_830 241
382 3300050510 nmdc:mga06r32_172120_c1 nmdc:mga06r32_172120_c1_642_1442 241
383 3300053139 Ga0500568_0014851 Ga0500568_0014851_918_1718 241
384 3300053153 Ga0500616_0006409 Ga0500616_0006409_2023_2823 241
385 3300002459 JGI24751J29686_10000545 JGI24751J29686_100005453 242
386 3300005331 Ga0070670_100005791 Ga0070670_1000057916 242
387 3300005344 Ga0070661_100016448 Ga0070661_1000164484 242
388 3300005347 Ga0070668_100135703 Ga0070668_1001357032 242
389 3300005354 Ga0070675_100151049 Ga0070675_1001510492 242
390 3300005459 Ga0068867_100108129 Ga0068867_1001081292 242
391 3300005564 Ga0070664_100341379 Ga0070664_1003413792 242
392 3300005719 Ga0068861_100091326 Ga0068861_1000913262 242
393 3300009094 Ga0111539_10174747 Ga0111539_101747472 242
394 3300013306 Ga0163162_10006555 Ga0163162_100065554 242
395 3300014968 Ga0157379_10045361 Ga0157379_100453613 242
396 3300017792 Ga0163161_10060753 Ga0163161_100607533 242
397 3300025893 Ga0207682_10007074 Ga0207682_100070742 242
398 3300025920 Ga0207649_10074178 Ga0207649_100741782 242
399 3300025925 Ga0207650_10021541 Ga0207650_100215413 242
400 3300025926 Ga0207659_10125425 Ga0207659_101254252 242
401 3300025940 Ga0207691_10002263 Ga0207691_1000226317 242
402 3300025960 Ga0207651_10395603 Ga0207651_103956031 242
403 3300025961 Ga0207712_10005672 Ga0207712_100056725 242
404 3300045051 Ga0451576_0173116 Ga0451576_0173116_1287_2102 242
405 3300046683 Ga0495658_0045516 Ga0495658_0045516_1511_2308 242
406 3300048907 Ga0496104_0418702 Ga0496104_0418702_140_958 242
407 3300049571 Ga0501034_0051623 Ga0501034_0051623_2493_3323 242
408 3300049571 Ga0501034_0126883 Ga0501034_0126883_897_1727 242
409 3300049581 Ga0501047_0057139 Ga0501047_0057139_2326_3126 242
410 3300049581 Ga0501047_0402395 Ga0501047_0402395_63_863 242
411 3300049823 Ga0501044_0181295 Ga0501044_0181295_973_1773 242

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

60

278

0.94

PF00106

adh_short

short chain dehydrogenase

74

229

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3awd-assembly1.cif.gz_D crystal structure of gox2181 0.9205 5 233
3r1i-assembly1.cif.gz_A-2 crystal structure of a short-chain type dehydrogenase/reductase from mycobacterium marinum 0.9096 5 232
4wec-assembly1.cif.gz_A crystal structure of a short chain dehydrogenase from mycobacterium smegmatis 0.9068 2 232
4cqm-assembly1.cif.gz_I crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp 0.9019 1 230
4cqm-assembly2.cif.gz_A crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp 0.9016 2 231
ID Description Score Start End Superfamily
3awdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9223 5 233 3.40.50.720
af_P9WGQ3_5_269_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9147 4 232 3.40.50.720
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9117 5 164 3.40.50.720
4wecC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9064 4 232 3.40.50.720
af_Q0JDU3_1_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9056 57 231 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4P5YWA1-F1-model_v4 3-ketoacyl-ACP reductase 0.9847 4 238 GO:0006633
GO:0016616
GO:0048038
AF-A0A2V6P9W9-F1-model_v4 Short-chain dehydrogenase 0.9828 80 237 GO:0016616
AF-A0A651H6D3-F1-model_v4 SDR family oxidoreductase 0.9828 109 237 GO:0016491
AF-A0A350I4A3-F1-model_v4 Short-chain dehydrogenase 0.9778 95 237
AF-A0A5C6E5E2-F1-model_v4 General stress protein 39 (EC 1.-.-.-) 0.9766 4 238 GO:0016491

Feature Viewer

pLDDT pTM Quality
91.27 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map