F437418

General Info

Members Datasets Scaffolds Average Seq Length
410 329 315 152

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8016622563|8016625542
Length 179
Sequence LTEGGTKAIPASFSRKNEAAASRSSHASHRPVGRNDRCFNSHALPRRRRRDGGQRARQANRKSVLAFYEKGLNQKDADAALAYVGDRYVQHNPNAADGPDGFRKFIGFPREKFPNSHSDIKRSFVDGDYVILHVHAVREPGTRGNAIVDIFKLENGKIVEHWDVVQAIPETPANSNTMF

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
4 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
5 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
6 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
7 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
8 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
9 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
10 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
11 2643221672 Variovorax sp. Root434 Isolate Unclassified
12 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
13 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
14 2818991446 Variovorax sp. 1180 Isolate Unclassified
15 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
16 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
17 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
18 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
19 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
20 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
21 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
22 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
23 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
24 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
25 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
26 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
27 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
28 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
29 2885198086 Variovorax sp. 679 Isolate Unclassified
30 2885211737 Variovorax sp. 553 Isolate Unclassified
31 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
32 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
33 2899924645 Variovorax sp. 369 Isolate Unclassified
34 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
35 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
36 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
37 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
38 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
39 2922368715
40 2922425934
41 2928037797 Variovorax sp. 1126 Isolate Unclassified
42 2928044640 Variovorax sp. 1128 Isolate Unclassified
43 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
44 2928070936 Variovorax gossypii 1167 Isolate Unclassified
45 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
46 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
47 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
48 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
49 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
50 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
51 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
52 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
53 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
54 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
55 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
56 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
57 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
58 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
59 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
60 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
61 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
62 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
63 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
64 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
65 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
66 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
67 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
68 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
69 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
70 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
71 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
72 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
73 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
74 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
75 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
76 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
77 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
78 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
79 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
80 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
81 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
82 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
84 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
85 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
86 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
87 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
88 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
89 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
90 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
91 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
92 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
93 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
94 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
95 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
96 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
97 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
98 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
99 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
100 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
101 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
102 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
103 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
104 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
105 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
106 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
107 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
108 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
109 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
110 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
111 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
112 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
113 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
114 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
115 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
116 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
117 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
118 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
119 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
120 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
121 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
122 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
123 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
125 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
126 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
127 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
128 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
129 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
130 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
131 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
132 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
133 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
134 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
135 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
136 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
137 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
138 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
139 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
140 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
145 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
170 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
171 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
172 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
175 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
176 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
177 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
178 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
179 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
180 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
181 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
185 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
186 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
187 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
188 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
189 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
190 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
191 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
192 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
193 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
194 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
195 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
196 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
197 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
198 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
199 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
200 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
201 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
202 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
203 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
204 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
205 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
206 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
207 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
208 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
209 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
210 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
211 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
212 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
213 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
214 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
215 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
216 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
217 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
218 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
219 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
220 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
221 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
222 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
223 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
224 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
225 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
226 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
227 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
228 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
229 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
230 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
231 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
232 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
233 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
234 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
235 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
236 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
237 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
238 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
239 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
240 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
241 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
242 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
243 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
244 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
245 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
246 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
247 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
248 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
249 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
250 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
251 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
252 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
253 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
254 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
255 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
256 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
257 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
258 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
259 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
260 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
261 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
262 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
263 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
264 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
265 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
266 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
267 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
268 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
269 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
270 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
271 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
272 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
273 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
274 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
275 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
276 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
277 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
278 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
279 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
280 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
281 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
282 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
283 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
284 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
285 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
286 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
287 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
288 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
289 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
290 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
291 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
292 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
293 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
294 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
295 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
296 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
297 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
298 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
299 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
300 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
301 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
302 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
303 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
304 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
305 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
306 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
307 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
308 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
309 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
310 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
311 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
312 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
313 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
314 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
315 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
316 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
317 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
318 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
319 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
320 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
321 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
322 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
323 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
324 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
325 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
326 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
327 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
328 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
329 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.21
Metatranscriptomes 0
Isolates 22.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.02
Nodule 16.59
Rhizoplane 6.34
Rhizosphere 46.34
Stem 0
Stem Tuber 0
Unclassified 11.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1016830 3300002773 Bacteria 1397
2 JGI25151J46595_10047293 3300003187 Bacteria 1498
3 JGI25406J46586_10029270 3300003203 Bacteria 2087
4 JGI25153J46596_10042082 3300003215 Bacteria 1397
5 JGI25160J50197_1002236 3300003354 Bacteria 9086
6 JGI25404J52841_10027345 3300003659 Bacteria 1227
7 Ga0055537_1012516 3300003773 Bacteria 1649
8 Ga0055524_1034376 3300003775 Bacteria 1403
9 Ga0055528_1031108 3300003790 Bacteria 1397
10 Ga0055530_10020559 3300003791 Bacteria 1969
11 Ga0055540_1001842 3300003792 Bacteria 11954
12 Ga0055531_10002636 3300003794 Bacteria 11867
13 Ga0070658_10029138 3300005327 Bacteria 4434
14 Ga0070660_100864732 3300005339 Bacteria 762
15 Ga0070692_10475602 3300005345 Bacteria 805
16 Ga0070663_100028451 3300005455 Bacteria 3805
17 Ga0070678_101797091 3300005456 Bacteria 578
18 Ga0070662_100042564 3300005457 Bacteria 3244
19 Ga0070684_100151522 3300005535 Bacteria 2101
20 Ga0068853_100122977 3300005539 Bacteria 2317
21 Ga0070693_100190351 3300005547 Bacteria 1326
22 Ga0070664_101239163 3300005564 Bacteria 704
23 Ga0070664_102030262 3300005564 Bacteria 546
24 Ga0068852_100766351 3300005616 Bacteria 978
25 Ga0068852_101414435 3300005616 Bacteria 718
26 Ga0068864_101057040 3300005618 Bacteria 807
27 Ga0068858_101128333 3300005842 Bacteria 770
28 Ga0068862_100080734 3300005844 Bacteria 2821
29 Ga0081540_1099609 3300005983 Bacteria 1255
30 Ga0081539_10001258 3300005985 Bacteria 44901
31 Ga0081539_10136445 3300005985 Bacteria 1198
32 Ga0070717_10909881 3300006028 Bacteria 801
33 Ga0075365_10012847 3300006038 Bacteria 4989
34 Ga0075365_10080372 3300006038 Bacteria 2207
35 Ga0075365_10150462 3300006038 Bacteria 1619
36 Ga0075365_10253327 3300006038 Bacteria 1237
37 Ga0075368_10052379 3300006042 Bacteria 1624
38 Ga0075368_10059845 3300006042 Bacteria 1524
39 Ga0075368_10214317 3300006042 Bacteria 817
40 Ga0075363_100003003 3300006048 Bacteria 7055
41 Ga0075363_100474596 3300006048 Bacteria 741
42 Ga0075364_10019699 3300006051 Bacteria 4237
43 Ga0075364_10125101 3300006051 Bacteria 1723
44 Ga0075364_10481876 3300006051 Bacteria 848
45 Ga0070716_100520448 3300006173 Bacteria 881
46 Ga0070712_100341704 3300006175 Unclassified 1222
47 Ga0075367_10012542 3300006178 Bacteria 4525
48 Ga0075367_10086073 3300006178 Bacteria 1907
49 Ga0075366_10033156 3300006195 Bacteria 3042
50 Ga0075370_10154195 3300006353 Bacteria 1347
51 Ga0068871_100481100 3300006358 Bacteria 1117
52 Ga0099825_1035835 3300006941 Bacteria 1745
53 Ga0099823_1080467 3300006944 Bacteria 1267
54 Ga0105240_11417387 3300009093 Bacteria 730
55 Ga0105245_10371079 3300009098 Bacteria 1423
56 Ga0105245_10832277 3300009098 Bacteria 962
57 Ga0114129_12067895 3300009147 Bacteria 687
58 Ga0105241_11318393 3300009174 Bacteria 688
59 Ga0105248_12209090 3300009177 Bacteria 626
60 Ga0105237_10184375 3300009545 Bacteria 2087
61 Ga0105249_10223851 3300009553 Bacteria 1852
62 Ga0105239_10431532 3300010375 Bacteria 1494
63 Ga0105239_11998513 3300010375 Bacteria 673
64 Ga0105246_10254327 3300011119 Bacteria 1396
65 Ga0157347_1000671 3300012502 Bacteria 2346
66 Ga0157373_10453515 3300013100 Bacteria 923
67 Ga0157371_10938126 3300013102 Bacteria 658
68 Ga0157374_10121334 3300013296 Bacteria 2523
69 Ga0157374_10608909 3300013296 Bacteria 1103
70 Ga0163162_10253150 3300013306 Bacteria 1893
71 Ga0163162_10707604 3300013306 Bacteria 1129
72 Ga0157372_11802906 3300013307 Bacteria 704
73 Ga0157380_12464690 3300014326 Bacteria 586
74 Ga0157376_10580699 3300014969 Bacteria 1113
75 Ga0182006_1009529 3300015261 Bacteria 4349
76 Ga0213876_10002958 3300021384 Bacteria 9843
77 Ga0209677_111785 3300025253 Bacteria 1340
78 Ga0209676_1000403 3300025292 Bacteria 78171
79 Ga0209050_1001095 3300025298 Bacteria 32903
80 Ga0209256_1014792 3300025299 Bacteria 2776
81 Ga0207426_1000270 3300025302 Bacteria 108404
82 Ga0209051_1000423 3300025303 Bacteria 58174
83 Ga0209257_1000215 3300025304 Bacteria 136521
84 Ga0209257_1017310 3300025304 Bacteria 2850
85 Ga0207688_10044077 3300025901 Bacteria 2486
86 Ga0207647_10002300 3300025904 Bacteria 14553
87 Ga0207705_10052653 3300025909 Bacteria 2931
88 Ga0207695_11634497 3300025913 Bacteria 525
89 Ga0207671_10083608 3300025914 Bacteria 2397
90 Ga0207693_10071047 3300025915 Bacteria 2724
91 Ga0207657_10026159 3300025919 Bacteria 5368
92 Ga0207694_10621971 3300025924 Bacteria 909
93 Ga0207687_10082855 3300025927 Bacteria 2321
94 Ga0207644_10015919 3300025931 Bacteria 5057
95 Ga0207690_10441916 3300025932 Bacteria 1044
96 Ga0207706_10075127 3300025933 Bacteria 2972
97 Ga0207665_10323340 3300025939 Bacteria 1158
98 Ga0207689_10122070 3300025942 Bacteria 2142
99 Ga0207661_10980069 3300025944 Bacteria 779
100 Ga0207639_10226109 3300026041 Bacteria 1619
101 Ga0207678_10040249 3300026067 Bacteria 4055
102 Ga0207702_10260557 3300026078 Bacteria 1632
103 Ga0207641_11357043 3300026088 Bacteria 712
104 Ga0207676_10963436 3300026095 Bacteria 839
105 Ga0207675_100225890 3300026118 Bacteria 1805
106 Ga0207698_10416734 3300026142 Bacteria 1288
107 Ga0209389_1000001 3300027296 Bacteria 463799
108 Ga0209489_102213 3300027361 Bacteria 39761
109 Ga0209700_100007 3300027363 Bacteria 454608
110 Ga0209813_10050441 3300027866 Bacteria 1299
111 Ga0268264_11605760 3300028381 Bacteria 661
112 Ga0265322_10151648 3300028654 Bacteria 663
113 Ga0307515_10100922 3300028794 Bacteria 3489
114 Ga0307515_10234851 3300028794 Bacteria 1617
115 Ga0307512_10102748 3300030522 Bacteria 1926
116 Ga0265330_10101718 3300031235 Bacteria 1230
117 Ga0265325_10009288 3300031241 Bacteria 5748
118 Ga0307513_10043244 3300031456 Bacteria 4951
119 Ga0307513_10373388 3300031456 Bacteria 1167
120 Ga0307513_10628315 3300031456 Bacteria 782
121 Ga0307508_10252908 3300031616 Bacteria 1358
122 Ga0307516_10239807 3300031730 Bacteria 1512
123 Ga0307406_10765685 3300031901 Bacteria 812
124 Ga0373923_0021605 3300035111 Bacteria 2514
125 Ga0373936_0043130 3300035113 Bacteria 1812
126 Ga0373945_0290222 3300035116 Bacteria 699
127 Ga0373945_0309672 3300035116 Bacteria 678
128 Ga0373954_0002816 3300035118 Bacteria 7317
129 Ga0373956_0151026 3300035119 Bacteria 1093
130 Ga0373943_0006394 3300035170 Bacteria 5292
131 Ga0373946_0007514 3300035171 Bacteria 3985
132 Ga0373946_0641365 3300035171 Bacteria 553
133 Ga0373955_0004618 3300035172 Bacteria 6107
134 Ga0373955_0494240 3300035172 Unclassified 747
135 Ga0373931_1014266 3300035691 Bacteria 562
136 Ga0373935_0021430 3300035692 Bacteria 3956
137 Ga0373927_0001309 3300035695 Bacteria 18825
138 Ga0373927_0059741 3300035695 Bacteria 2466
139 Ga0373933_0001806 3300035724 Bacteria 12406
140 Ga0373947_0017844 3300035725 Bacteria 4083
141 Ga0373947_0143506 3300035725 Bacteria 1533
142 Ga0373947_0652788 3300035725 Bacteria 717
143 Ga0373937_0010572 3300036401 Bacteria 8064
144 Ga0436360_0671267 3300039438 Bacteria 934
145 Ga0436360_0711096 3300039438 Bacteria 1244
146 Ga0436361_0668667 3300039447 Bacteria 581
147 Ga0436361_0934510 3300039447 Bacteria 7266
148 Ga0451791_1680810 3300041451 Bacteria 783
149 Ga0451793_0798264 3300041452 Bacteria 535
150 Ga0451797_0238151 3300041453 Bacteria 848
151 Ga0451802_1009476 3300041460 Bacteria 989
152 Ga0495627_011437 3300046453 Bacteria 3184
153 Ga0495603_0089432 3300046455 Bacteria 1801
154 Ga0495629_0001857 3300046459 Bacteria 16523
155 Ga0495629_0311115 3300046459 Bacteria 1078
156 Ga0495651_0003136 3300046462 Bacteria 12751
157 Ga0495651_0035261 3300046462 Bacteria 3897
158 Ga0495653_0001959 3300046463 Bacteria 16210
159 Ga0495653_0242471 3300046463 Unclassified 1200
160 Ga0495650_0085087 3300046471 Bacteria 1212
161 Ga0495580_0057604 3300046472 Bacteria 2734
162 Ga0495639_0022696 3300046475 Plasmid 2754
163 Ga0495594_0272611 3300046499 Unclassified 964
164 Ga0495606_0171431 3300046507 Bacteria 1258
165 Ga0495606_0536569 3300046507 Bacteria 584
166 Ga0495608_0000379 3300046511 Bacteria 30996
167 Ga0495608_0023909 3300046511 Bacteria 4180
168 Ga0495618_0002210 3300046514 Bacteria 12702
169 Ga0495620_0052529 3300046515 Bacteria 1730
170 Ga0495628_0038816 3300046516 Bacteria 3809
171 Ga0495630_0042977 3300046517 Plasmid 3374
172 Ga0495643_0008377 3300046522 Bacteria 6554
173 Ga0495648_0465087 3300046524 Bacteria 550
174 Ga0495666_0074038 3300046526 Bacteria 1615
175 Ga0495652_0014867 3300046529 Bacteria 6977
176 Ga0495652_0025055 3300046529 Bacteria 5279
177 Ga0495665_0013924 3300046531 Bacteria 4344
178 Ga0495640_0001878 3300046533 Bacteria 16717
179 Ga0495640_0007993 3300046533 Bacteria 8313
180 Ga0495587_0002583 3300046536 Bacteria 12101
181 Ga0495597_0058959 3300046542 Bacteria 1677
182 Ga0495645_0015057 3300046543 Bacteria 5495
183 Ga0495622_0347240 3300046557 Bacteria 642
184 Ga0495667_0000595 3300046559 Bacteria 23008
185 Ga0495656_0219573 3300046615 Bacteria 950
186 Ga0495668_0097278 3300046616 Bacteria 1611
187 Ga0495668_0149106 3300046616 Bacteria 1281
188 Ga0495668_0301024 3300046616 Bacteria 879
189 Ga0495668_0381728 3300046616 Bacteria 774
190 Ga0495668_0501729 3300046616 Bacteria 669
191 Ga0495634_0045542 3300046642 Bacteria 2964
192 Ga0495634_0122405 3300046642 Bacteria 1665
193 Ga0495625_0028232 3300046660 Bacteria 4211
194 Ga0495635_0005160 3300046663 Bacteria 9092
195 Ga0495635_0623345 3300046663 Bacteria 703
196 Ga0495588_0066222 3300046674 Bacteria 1875
197 Ga0495657_0018176 3300046675 Bacteria 5093
198 Ga0495599_0010304 3300046678 Bacteria 5719
199 Ga0495623_0017817 3300046679 Bacteria 4587
200 Ga0495646_0003128 3300046680 Bacteria 10266
201 Ga0495646_0325121 3300046680 Bacteria 809
202 Ga0495613_0016675 3300046689 Bacteria 5469
203 Ga0495613_0065093 3300046689 Bacteria 2664
204 Ga0495624_0017354 3300046690 Bacteria 4834
205 Ga0495624_0022209 3300046690 Bacteria 4198
206 Ga0495670_0022247 3300046691 Bacteria 3130
207 Ga0495671_0001944 3300046692 Bacteria 13254
208 Ga0495600_0000264 3300046809 Bacteria 28757
209 Ga0495600_0093321 3300046809 Bacteria 1963
210 Ga0495600_0128260 3300046809 Bacteria 1649
211 Ga0495581_0023836 3300047315 Bacteria 3546
212 Ga0495581_0083281 3300047315 Bacteria 1853
213 Ga0495604_0000130 3300047317 Bacteria 63418
214 Ga0495604_0033572 3300047317 Bacteria 4061
215 Ga0495674_0000822 3300047319 Bacteria 29638
216 Ga0495674_0170460 3300047319 Bacteria 1817
217 Ga0495676_0051873 3300047321 Bacteria 3278
218 Ga0495676_0068635 3300047321 Bacteria 2738
219 Ga0495680_0002073 3300047322 Bacteria 20877
220 Ga0495680_0094150 3300047322 Bacteria 2242
221 Ga0495683_0063877 3300047323 Bacteria 1819
222 Ga0495687_048674 3300047443 Bacteria 1817
223 Ga0495687_224167 3300047443 Bacteria 579
224 Ga0495675_0007914 3300047444 Bacteria 6567
225 Ga0495684_0071491 3300047471 Bacteria 2636
226 Ga0495593_0041011 3300047673 Bacteria 2490
227 Ga0495602_0000910 3300048088 Bacteria 28607
228 Ga0495602_0053918 3300048088 Bacteria 3556
229 Ga0495614_0007563 3300048089 Bacteria 4835
230 Ga0495614_0177980 3300048089 Bacteria 956
231 Ga0496101_0078813 3300048904 Bacteria 2431
232 Ga0496101_0381781 3300048904 Bacteria 1108
233 Ga0496102_0640954 3300048905 Bacteria 986
234 Ga0496102_1670993 3300048905 Bacteria 555
235 Ga0496104_0006417 3300048907 Bacteria 10344
236 Ga0496104_0732545 3300048907 Bacteria 896
237 Ga0496105_0005595 3300048908 Bacteria 9552
238 Ga0496106_0446855 3300048909 Bacteria 1039
239 Ga0496106_0930713 3300048909 Bacteria 685
240 Ga0496108_0330953 3300048911 Bacteria 1328
241 Ga0496109_1578387 3300048912 Bacteria 591
242 Ga0496110_0226402 3300048913 Bacteria 1700
243 Ga0496110_0431725 3300048913 Bacteria 1201
244 Ga0496111_0143025 3300048914 Bacteria 1773
245 Ga0496112_0015095 3300048915 Bacteria 7195
246 Ga0496113_0109990 3300048916 Bacteria 2144
247 Ga0496113_0161156 3300048916 Bacteria 1773
248 Ga0496113_0163154 3300048916 Bacteria 1762
249 Ga0496115_0022747 3300048918 Bacteria 4859
250 Ga0496117_0118927 3300048920 Bacteria 1628
251 Ga0496118_0018486 3300048921 Bacteria 6287
252 Ga0496118_0023404 3300048921 Bacteria 5366
253 Ga0496119_0033124 3300048922 Bacteria 3432
254 Ga0496119_0438234 3300048922 Bacteria 617
255 Ga0496121_0055837 3300048924 Bacteria 3286
256 Ga0496121_0121479 3300048924 Bacteria 1972
257 Ga0496121_0413152 3300048924 Bacteria 880
258 Ga0496122_0081500 3300048925 Bacteria 2252
259 Ga0496122_0248569 3300048925 Bacteria 997
260 Ga0496123_0159230 3300048926 Bacteria 1206
261 Ga0496123_0184419 3300048926 Bacteria 1086
262 Ga0496124_0045249 3300048927 Bacteria 3774
263 Ga0496124_0143895 3300048927 Bacteria 1878
264 Ga0496125_0085307 3300048928 Bacteria 2393
265 Ga0496126_0138298 3300048929 Bacteria 2098
266 nmdc:mga03683_37839_c1 3300050489 Bacteria 1968
267 nmdc:mga03683_701038_c1 3300050489 Bacteria 501
268 nmdc:mga03n38_681457_c1 3300050490 Bacteria 591
269 nmdc:mga00v17_488314_c1 3300050491 Bacteria 799
270 nmdc:mga00v17_99839_c1 3300050491 Bacteria 1831
271 nmdc:mga0yw44_123968_c1 3300050492 Bacteria 1667
272 nmdc:mga0yw44_385395_c1 3300050492 Bacteria 947
273 nmdc:mga0k408_338130_c1 3300050493 Bacteria 898
274 nmdc:mga0k408_45179_c1 3300050493 Bacteria 2541
275 nmdc:mga06z11_504376_c1 3300050494 Bacteria 733
276 nmdc:mga06z11_67208_c1 3300050494 Bacteria 1886
277 nmdc:mga04h51_449913_c1 3300050495 Bacteria 545
278 nmdc:mga07m45_251081_c1 3300050496 Bacteria 1029
279 nmdc:mga0sz30_48771_c1 3300050516 Bacteria 1793
280 nmdc:mga0sz30_95996_c1 3300050516 Bacteria 1293
281 Ga0495601_0003316 3300053077 Bacteria 9209
282 Ga0495612_0003872 3300053078 Bacteria 6206
283 Ga0500610_0029879 3300053079 Bacteria 2756
284 Ga0500635_0020322 3300053080 Bacteria 2033
285 Ga0495595_0000137 3300053084 Bacteria 30537
286 Ga0495595_0104880 3300053084 Bacteria 1367
287 Ga0495619_0001061 3300053085 Bacteria 18026
288 Ga0495619_0017340 3300053085 Bacteria 4560
289 Ga0495619_0375545 3300053085 Bacteria 982
290 Ga0495619_1147714 3300053085 Bacteria 516
291 Ga0500578_0476728 3300053086 Bacteria 706
292 Ga0500646_0167165 3300053090 Bacteria 738
293 Ga0500647_0009808 3300053091 Bacteria 4215
294 Ga0500651_0062374 3300053093 Bacteria 2327
295 Ga0500556_0004962 3300053104 Bacteria 3765
296 Ga0500557_000003 3300053105 Bacteria 228429
297 Ga0500562_079066 3300053108 Bacteria 889
298 Ga0500562_107348 3300053108 Bacteria 760
299 Ga0500569_094045 3300053109 Bacteria 975
300 Ga0500593_034845 3300053117 Bacteria 2253
301 Ga0500607_009331 3300053121 Bacteria 5908
302 Ga0500626_149193 3300053128 Bacteria 973
303 Ga0500658_0164006 3300053134 Bacteria 1007
304 Ga0500658_0217840 3300053134 Bacteria 875
305 Ga0500559_0133847 3300053136 Bacteria 1158
306 Ga0500564_085838 3300053138 Bacteria 1406
307 Ga0500568_0106379 3300053139 Bacteria 1051
308 Ga0500577_0033509 3300053142 Bacteria 1816
309 Ga0500588_0010843 3300053146 Bacteria 2215
310 Ga0500590_039312 3300053148 Bacteria 2439
311 Ga0500627_0000293 3300053158 Bacteria 13978
312 Ga0500634_0041197 3300053161 Bacteria 2508
313 Ga0500636_0000166 3300053177 Bacteria 34574
314 Ga0500625_003024 3300053729 Bacteria 6512
315 Ga0500552_022486 3300053733 Bacteria 911

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003203 JGI25406J46586_10029270 JGI25406J46586_100292702 143
2 3300005985 Ga0081539_10001258 Ga0081539_1000125811 143
3 3300047322 Ga0495680_0094150 Ga0495680_0094150_1713_2147 143
4 3300053084 Ga0495595_0104880 Ga0495595_0104880_822_1256 143
5 3300005535 Ga0070684_100151522 Ga0070684_1001515222 144
6 3300005616 Ga0068852_100766351 Ga0068852_1007663512 144
7 3300006038 Ga0075365_10012847 Ga0075365_100128474 144
8 3300006042 Ga0075368_10214317 Ga0075368_102143171 144
9 3300006178 Ga0075367_10012542 Ga0075367_100125422 144
10 3300006195 Ga0075366_10033156 Ga0075366_100331563 144
11 3300035695 Ga0373927_0059741 Ga0373927_0059741_1987_2421 144
12 3300050489 nmdc:mga03683_37839_c1 nmdc:mga03683_37839_c1_1091_1525 144
13 3300050490 nmdc:mga03n38_681457_c1 nmdc:mga03n38_681457_c1_64_498 144
14 3300050493 nmdc:mga0k408_338130_c1 nmdc:mga0k408_338130_c1_146_580 144
15 3300050494 nmdc:mga06z11_504376_c1 nmdc:mga06z11_504376_c1_134_568 144
16 3300046616 Ga0495668_0501729 Ga0495668_0501729_17_466 145
17 3300046663 Ga0495635_0623345 Ga0495635_0623345_73_510 145
18 3300047443 Ga0495687_224167 Ga0495687_224167_123_560 145
19 3300048924 Ga0496121_0413152 Ga0496121_0413152_195_656 145
20 3300050489 nmdc:mga03683_701038_c1 nmdc:mga03683_701038_c1_26_463 145
21 3300050492 nmdc:mga0yw44_385395_c1 nmdc:mga0yw44_385395_c1_485_922 145
22 3300050495 nmdc:mga04h51_449913_c1 nmdc:mga04h51_449913_c1_20_457 145
23 3300053085 Ga0495619_1147714 Ga0495619_1147714_29_466 145
24 3300053091 Ga0500647_0009808 Ga0500647_0009808_487_924 145
25 3300053104 Ga0500556_0004962 Ga0500556_0004962_74_511 145
26 3300053105 Ga0500557_000003 Ga0500557_000003_105010_105447 145
27 3300053108 Ga0500562_079066 Ga0500562_079066_73_510 145
28 3300053729 Ga0500625_003024 Ga0500625_003024_2455_2892 145
29 3300009098 Ga0105245_10832277 Ga0105245_108322771 146
30 3300025253 Ga0209677_111785 Ga0209677_1117852 146
31 3300025914 Ga0207671_10083608 Ga0207671_100836082 146
32 3300006028 Ga0070717_10909881 Ga0070717_109098812 147
33 3300009147 Ga0114129_12067895 Ga0114129_120678951 147
34 3300014326 Ga0157380_12464690 Ga0157380_124646901 147
35 3300035111 Ga0373923_0021605 Ga0373923_0021605_1321_1764 147
36 3300035116 Ga0373945_0290222 Ga0373945_0290222_237_680 147
37 3300035118 Ga0373954_0002816 Ga0373954_0002816_1540_1983 147
38 3300035119 Ga0373956_0151026 Ga0373956_0151026_549_992 147
39 3300035171 Ga0373946_0641365 Ga0373946_0641365_40_483 147
40 3300035172 Ga0373955_0004618 Ga0373955_0004618_2729_3172 147
41 3300035724 Ga0373933_0001806 Ga0373933_0001806_10592_11035 147
42 3300035725 Ga0373947_0143506 Ga0373947_0143506_850_1293 147
43 3300036401 Ga0373937_0010572 Ga0373937_0010572_959_1402 147
44 3300046462 Ga0495651_0003136 Ga0495651_0003136_2088_2531 147
45 3300046463 Ga0495653_0001959 Ga0495653_0001959_14260_14703 147
46 3300046511 Ga0495608_0000379 Ga0495608_0000379_6232_6675 147
47 3300046514 Ga0495618_0002210 Ga0495618_0002210_9699_10142 147
48 3300046516 Ga0495628_0038816 Ga0495628_0038816_729_1172 147
49 3300046529 Ga0495652_0014867 Ga0495652_0014867_4082_4525 147
50 3300046533 Ga0495640_0001878 Ga0495640_0001878_12216_12659 147
51 3300046536 Ga0495587_0002583 Ga0495587_0002583_1145_1588 147
52 3300046543 Ga0495645_0015057 Ga0495645_0015057_2034_2477 147
53 3300046559 Ga0495667_0000595 Ga0495667_0000595_5945_6388 147
54 3300046642 Ga0495634_0045542 Ga0495634_0045542_1038_1481 147
55 3300046678 Ga0495599_0010304 Ga0495599_0010304_636_1079 147
56 3300046679 Ga0495623_0017817 Ga0495623_0017817_789_1232 147
57 3300046680 Ga0495646_0003128 Ga0495646_0003128_8532_8975 147
58 3300046809 Ga0495600_0000264 Ga0495600_0000264_20209_20652 147
59 3300047315 Ga0495581_0083281 Ga0495581_0083281_1115_1558 147
60 3300047317 Ga0495604_0000130 Ga0495604_0000130_46545_46988 147
61 3300047319 Ga0495674_0000822 Ga0495674_0000822_87_530 147
62 3300047322 Ga0495680_0002073 Ga0495680_0002073_13344_13787 147
63 3300047444 Ga0495675_0007914 Ga0495675_0007914_4835_5278 147
64 3300047471 Ga0495684_0071491 Ga0495684_0071491_956_1399 147
65 3300048088 Ga0495602_0000910 Ga0495602_0000910_17809_18252 147
66 3300048089 Ga0495614_0177980 Ga0495614_0177980_98_541 147
67 3300048907 Ga0496104_0732545 Ga0496104_0732545_10_453 147
68 3300048912 Ga0496109_1578387 Ga0496109_1578387_67_510 147
69 3300053077 Ga0495601_0003316 Ga0495601_0003316_3166_3609 147
70 3300053078 Ga0495612_0003872 Ga0495612_0003872_4232_4675 147
71 3300053084 Ga0495595_0000137 Ga0495595_0000137_7090_7533 147
72 3300053085 Ga0495619_0001061 Ga0495619_0001061_14947_15390 147
73 3300009093 Ga0105240_11417387 Ga0105240_114173871 148
74 3300010375 Ga0105239_10431532 Ga0105239_104315322 148
75 3300028654 Ga0265322_10151648 Ga0265322_101516481 148
76 3300031235 Ga0265330_10101718 Ga0265330_101017182 148
77 3300031241 Ga0265325_10009288 Ga0265325_100092882 148
78 3300046507 Ga0495606_0536569 Ga0495606_0536569_100_549 148
79 3300048909 Ga0496106_0930713 Ga0496106_0930713_97_561 148
80 iso_pu_bacteria 2528768022 2528848912 148
81 iso_pu_bacteria 2885374607 2885376581 148
82 iso_pu_bacteria 2903748898 2903757682 148
83 iso_pu_bacteria 2908739725 2908741608 148
84 iso_pu_bacteria 2922425934 2922431530 148
85 iso_pu_bacteria 2929160207 2929160485 148
86 iso_pu_bacteria 8006933436 8006939386 148
87 iso_pu_bacteria 8006973647 8006979041 148
88 3300006175 Ga0070712_100341704 Ga0070712_1003417042 149
89 3300009177 Ga0105248_12209090 Ga0105248_122090901 149
90 3300013306 Ga0163162_10707604 Ga0163162_107076042 149
91 3300025915 Ga0207693_10071047 Ga0207693_100710473 149
92 3300026118 Ga0207675_100225890 Ga0207675_1002258902 149
93 3300031456 Ga0307513_10043244 Ga0307513_100432445 149
94 3300039438 Ga0436360_0671267 Ga0436360_0671267_453_905 149
95 3300048905 Ga0496102_0640954 Ga0496102_0640954_71_520 149
96 3300048911 Ga0496108_0330953 Ga0496108_0330953_382_831 149
97 3300048913 Ga0496110_0226402 Ga0496110_0226402_904_1353 149
98 3300048916 Ga0496113_0109990 Ga0496113_0109990_372_821 149
99 iso_pu_bacteria 2728368998 2728749966 149
100 iso_pu_bacteria 2879083081 2879086689 149
101 iso_pu_bacteria 2906626472 2906627661 149
102 iso_pu_bacteria 2908775508 2908781240 149
103 iso_pu_bacteria 3005474847 3005481324 149
104 3300021384 Ga0213876_10002958 Ga0213876_100029588 150
105 iso_pu_bacteria 2507262055 2507507595 150
106 iso_pu_bacteria 2508501009 2508541714 150
107 iso_pu_bacteria 2511231028 2511397092 150
108 iso_pu_bacteria 2515154112 2515626141 150
109 iso_pu_bacteria 2524023205 2524436212 150
110 iso_pu_bacteria 2744054633 2745080832 150
111 iso_pu_bacteria 2824661429 2824666195 150
112 iso_pu_bacteria 2847930680 2847937388 150
113 iso_pu_bacteria 2874590934 2874598711 150
114 iso_pu_bacteria 2874628541 2874634939 150
115 iso_pu_bacteria 2874645413 2874652166 150
116 iso_pu_bacteria 2876761206 2876768155 150
117 iso_pu_bacteria 2876771140 2876778750 150
118 iso_pu_bacteria 2876818435 2876824355 150
119 iso_pu_bacteria 2879074833 2879082543 150
120 iso_pu_bacteria 2879099564 2879107778 150
121 iso_pu_bacteria 2879127579 2879131460 150
122 iso_pu_bacteria 2879142872 2879147906 150
123 iso_pu_bacteria 2888378607 2888385519 150
124 iso_pu_bacteria 2904541872 2904543251 150
125 iso_pu_bacteria 2908775508 2908775683 150
126 iso_pu_bacteria 2922368715 2922372337 150
127 iso_pu_bacteria 2932784394 2932785049 150
128 iso_pu_bacteria 2932809354 2932810077 150
129 iso_pu_bacteria 2932818245 2932821651 150
130 iso_pu_bacteria 2932828146 2932828885 150
131 iso_pu_bacteria 2935616580 2935619695 150
132 iso_pu_bacteria 2935638405 2935638675 150
133 iso_pu_bacteria 2935665750 2935666473 150
134 iso_pu_bacteria 2935675223 2935676484 150
135 iso_pu_bacteria 2935684952 2935691000 150
136 iso_pu_bacteria 2935694250 2935694566 150
137 iso_pu_bacteria 2935703347 2935703681 150
138 iso_pu_bacteria 2935713505 2935718381 150
139 iso_pu_bacteria 2935722832 2935727639 150
140 iso_pu_bacteria 2935732158 2935736342 150
141 iso_pu_bacteria 2935741537 2935745722 150
142 iso_pu_bacteria 2935750917 2935756103 150
143 iso_pu_bacteria 2935760218 2935760637 150
144 iso_pu_bacteria 2935801545 2935801819 150
145 iso_pu_bacteria 2935810662 2935814766 150
146 iso_pu_bacteria 2935827899 2935828169 150
147 iso_pu_bacteria 2935837841 2935842374 150
148 iso_pu_bacteria 2935855204 2935857990 150
149 iso_pu_bacteria 2935864058 2935867894 150
150 iso_pu_bacteria 2935873716 2935874082 150
151 iso_pu_bacteria 2935975950 2935976451 150
152 iso_pu_bacteria 2935984226 2935987099 150
153 iso_pu_bacteria 2935992306 2935992993 150
154 iso_pu_bacteria 2936002035 2936002905 150
155 iso_pu_bacteria 2936037263 2936040591 150
156 iso_pu_bacteria 2940556831 2940561922 150
157 iso_pu_bacteria 2941538514 2941542423 150
158 iso_pu_bacteria 2945909444 2945915483 150
159 iso_pu_bacteria 3005506211 3005508372 150
160 iso_pu_bacteria 8016511872 8016520581 150
161 iso_pu_bacteria 8016583857 8016594429 150
162 iso_pu_bacteria 8017057580 8017064997 150
163 iso_pu_bacteria 8019576017 8019584375 150
164 iso_pu_bacteria 8019586578 8019592146 150
165 iso_pu_bacteria 8019597564 8019599135 150
166 iso_pu_bacteria 8019608314 8019609224 150
167 iso_pu_bacteria 8019629233 8019633234 150
168 iso_pu_bacteria 8019659431 8019661103 150
169 iso_pu_bacteria 8019668869 8019670661 150
170 iso_pu_bacteria 8019678201 8019685570 150
171 3300005985 Ga0081539_10136445 Ga0081539_101364451 151
172 3300035116 Ga0373945_0309672 Ga0373945_0309672_190_645 151
173 3300035725 Ga0373947_0652788 Ga0373947_0652788_229_684 151
174 3300046455 Ga0495603_0089432 Ga0495603_0089432_503_958 151
175 3300046615 Ga0495656_0219573 Ga0495656_0219573_483_938 151
176 3300053134 Ga0500658_0164006 Ga0500658_0164006_11_466 151
177 3300005983 Ga0081540_1099609 Ga0081540_10996091 152
178 3300006048 Ga0075363_100474596 Ga0075363_1004745961 152
179 3300035113 Ga0373936_0043130 Ga0373936_0043130_194_658 152
180 3300035170 Ga0373943_0006394 Ga0373943_0006394_1513_1977 152
181 3300035171 Ga0373946_0007514 Ga0373946_0007514_342_806 152
182 3300035172 Ga0373955_0494240 Ga0373955_0494240_176_640 152
183 3300035691 Ga0373931_1014266 Ga0373931_1014266_85_546 152
184 3300035692 Ga0373935_0021430 Ga0373935_0021430_3320_3784 152
185 3300035695 Ga0373927_0001309 Ga0373927_0001309_11266_11730 152
186 3300035725 Ga0373947_0017844 Ga0373947_0017844_2212_2676 152
187 3300046463 Ga0495653_0242471 Ga0495653_0242471_265_729 152
188 3300046472 Ga0495580_0057604 Ga0495580_0057604_1310_1774 152
189 3300046475 Ga0495639_0022696 Ga0495639_0022696_510_974 152
190 3300046499 Ga0495594_0272611 Ga0495594_0272611_441_905 152
191 3300046517 Ga0495630_0042977 Ga0495630_0042977_1503_1967 152
192 3300046526 Ga0495666_0074038 Ga0495666_0074038_101_565 152
193 3300046531 Ga0495665_0013924 Ga0495665_0013924_1315_1779 152
194 3300046689 Ga0495613_0065093 Ga0495613_0065093_859_1323 152
195 3300046690 Ga0495624_0022209 Ga0495624_0022209_2685_3149 152
196 3300046809 Ga0495600_0093321 Ga0495600_0093321_1256_1720 152
197 3300047315 Ga0495581_0023836 Ga0495581_0023836_1269_1733 152
198 3300047321 Ga0495676_0068635 Ga0495676_0068635_2016_2480 152
199 3300047673 Ga0495593_0041011 Ga0495593_0041011_691_1155 152
200 3300053085 Ga0495619_0017340 Ga0495619_0017340_1343_1807 152
201 iso_pu_bacteria 2599185214 2599622477 152
202 iso_pu_bacteria 2599185226 2599674431 152
203 iso_pu_bacteria 2599185227 2599680116 152
204 iso_pu_bacteria 2599185229 2599692132 152
205 iso_pu_bacteria 2643221672 2644396932 152
206 iso_pu_bacteria 2818991446 2819599178 152
207 iso_pu_bacteria 2831265667 2831270958 152
208 iso_pu_bacteria 2885198086 2885202223 152
209 iso_pu_bacteria 2885211737 2885215876 152
210 iso_pu_bacteria 2899924645 2899930001 152
211 iso_pu_bacteria 2928037797 2928043537 152
212 iso_pu_bacteria 2928044640 2928049833 152
213 iso_pu_bacteria 2928064002 2928069994 152
214 iso_pu_bacteria 2928070936 2928074386 152
215 3300003659 JGI25404J52841_10027345 JGI25404J52841_100273451 153
216 3300006042 Ga0075368_10052379 Ga0075368_100523792 153
217 3300006178 Ga0075367_10086073 Ga0075367_100860732 153
218 3300028794 Ga0307515_10100922 Ga0307515_101009222 153
219 3300031456 Ga0307513_10373388 Ga0307513_103733881 153
220 3300031730 Ga0307516_10239807 Ga0307516_102398072 153
221 3300039438 Ga0436360_0711096 Ga0436360_0711096_189_659 153
222 3300039447 Ga0436361_0668667 Ga0436361_0668667_45_512 153
223 3300039447 Ga0436361_0934510 Ga0436361_0934510_3282_3752 153
224 3300041451 Ga0451791_1680810 Ga0451791_1680810_49_510 153
225 3300041452 Ga0451793_0798264 Ga0451793_0798264_25_486 153
226 3300050494 nmdc:mga06z11_67208_c1 nmdc:mga06z11_67208_c1_1173_1634 153
227 3300053108 Ga0500562_107348 Ga0500562_107348_55_522 153
228 3300053128 Ga0500626_149193 Ga0500626_149193_284_745 153
229 3300003354 JGI25160J50197_1002236 JGI25160J50197_10022365 154
230 3300005327 Ga0070658_10029138 Ga0070658_100291384 154
231 3300005339 Ga0070660_100864732 Ga0070660_1008647322 154
232 3300005345 Ga0070692_10475602 Ga0070692_104756021 154
233 3300005455 Ga0070663_100028451 Ga0070663_1000284513 154
234 3300005456 Ga0070678_101797091 Ga0070678_1017970911 154
235 3300005539 Ga0068853_100122977 Ga0068853_1001229772 154
236 3300005547 Ga0070693_100190351 Ga0070693_1001903511 154
237 3300005564 Ga0070664_101239163 Ga0070664_1012391632 154
238 3300005564 Ga0070664_102030262 Ga0070664_1020302621 154
239 3300005618 Ga0068864_101057040 Ga0068864_1010570401 154
240 3300005842 Ga0068858_101128333 Ga0068858_1011283332 154
241 3300005844 Ga0068862_100080734 Ga0068862_1000807343 154
242 3300006038 Ga0075365_10080372 Ga0075365_100803722 154
243 3300006038 Ga0075365_10150462 Ga0075365_101504622 154
244 3300006038 Ga0075365_10253327 Ga0075365_102533271 154
245 3300006042 Ga0075368_10059845 Ga0075368_100598451 154
246 3300006048 Ga0075363_100003003 Ga0075363_1000030033 154
247 3300006051 Ga0075364_10019699 Ga0075364_100196993 154
248 3300006051 Ga0075364_10125101 Ga0075364_101251013 154
249 3300006051 Ga0075364_10481876 Ga0075364_104818761 154
250 3300006173 Ga0070716_100520448 Ga0070716_1005204481 154
251 3300006353 Ga0075370_10154195 Ga0075370_101541952 154
252 3300006941 Ga0099825_1035835 Ga0099825_10358352 154
253 3300006944 Ga0099823_1080467 Ga0099823_10804672 154
254 3300009098 Ga0105245_10371079 Ga0105245_103710792 154
255 3300009174 Ga0105241_11318393 Ga0105241_113183931 154
256 3300009545 Ga0105237_10184375 Ga0105237_101843752 154
257 3300009553 Ga0105249_10223851 Ga0105249_102238512 154
258 3300010375 Ga0105239_11998513 Ga0105239_119985131 154
259 3300011119 Ga0105246_10254327 Ga0105246_102543272 154
260 3300012502 Ga0157347_1000671 Ga0157347_10006713 154
261 3300013102 Ga0157371_10938126 Ga0157371_109381261 154
262 3300013296 Ga0157374_10121334 Ga0157374_101213342 154
263 3300013296 Ga0157374_10608909 Ga0157374_106089092 154
264 3300013306 Ga0163162_10253150 Ga0163162_102531502 154
265 3300013307 Ga0157372_11802906 Ga0157372_118029061 154
266 3300025299 Ga0209256_1014792 Ga0209256_10147924 154
267 3300025302 Ga0207426_1000270 Ga0207426_100027037 154
268 3300025304 Ga0209257_1017310 Ga0209257_10173102 154
269 3300025901 Ga0207688_10044077 Ga0207688_100440773 154
270 3300025904 Ga0207647_10002300 Ga0207647_1000230013 154
271 3300025909 Ga0207705_10052653 Ga0207705_100526534 154
272 3300025913 Ga0207695_11634497 Ga0207695_116344971 154
273 3300025919 Ga0207657_10026159 Ga0207657_100261593 154
274 3300025924 Ga0207694_10621971 Ga0207694_106219711 154
275 3300025927 Ga0207687_10082855 Ga0207687_100828552 154
276 3300025931 Ga0207644_10015919 Ga0207644_100159191 154
277 3300025932 Ga0207690_10441916 Ga0207690_104419161 154
278 3300025939 Ga0207665_10323340 Ga0207665_103233402 154
279 3300025944 Ga0207661_10980069 Ga0207661_109800691 154
280 3300026041 Ga0207639_10226109 Ga0207639_102261092 154
281 3300026067 Ga0207678_10040249 Ga0207678_100402493 154
282 3300026078 Ga0207702_10260557 Ga0207702_102605572 154
283 3300026088 Ga0207641_11357043 Ga0207641_113570431 154
284 3300026095 Ga0207676_10963436 Ga0207676_109634362 154
285 3300026142 Ga0207698_10416734 Ga0207698_104167342 154
286 3300027296 Ga0209389_1000001 Ga0209389_100000166 154
287 3300027361 Ga0209489_102213 Ga0209489_10221334 154
288 3300027363 Ga0209700_100007 Ga0209700_100007338 154
289 3300027866 Ga0209813_10050441 Ga0209813_100504411 154
290 3300028381 Ga0268264_11605760 Ga0268264_116057601 154
291 3300028794 Ga0307515_10234851 Ga0307515_102348512 154
292 3300030522 Ga0307512_10102748 Ga0307512_101027483 154
293 3300031456 Ga0307513_10628315 Ga0307513_106283152 154
294 3300031616 Ga0307508_10252908 Ga0307508_102529082 154
295 3300031901 Ga0307406_10765685 Ga0307406_107656852 154
296 3300041453 Ga0451797_0238151 Ga0451797_0238151_106_570 154
297 3300041460 Ga0451802_1009476 Ga0451802_1009476_299_763 154
298 3300046453 Ga0495627_011437 Ga0495627_011437_913_1380 154
299 3300046459 Ga0495629_0001857 Ga0495629_0001857_5615_6079 154
300 3300046459 Ga0495629_0311115 Ga0495629_0311115_16_480 154
301 3300046462 Ga0495651_0035261 Ga0495651_0035261_691_1155 154
302 3300046471 Ga0495650_0085087 Ga0495650_0085087_99_563 154
303 3300046507 Ga0495606_0171431 Ga0495606_0171431_728_1192 154
304 3300046511 Ga0495608_0023909 Ga0495608_0023909_926_1390 154
305 3300046515 Ga0495620_0052529 Ga0495620_0052529_314_781 154
306 3300046522 Ga0495643_0008377 Ga0495643_0008377_4838_5302 154
307 3300046524 Ga0495648_0465087 Ga0495648_0465087_70_534 154
308 3300046529 Ga0495652_0025055 Ga0495652_0025055_3491_3955 154
309 3300046533 Ga0495640_0007993 Ga0495640_0007993_2945_3409 154
310 3300046542 Ga0495597_0058959 Ga0495597_0058959_683_1147 154
311 3300046557 Ga0495622_0347240 Ga0495622_0347240_115_579 154
312 3300046616 Ga0495668_0097278 Ga0495668_0097278_478_945 154
313 3300046616 Ga0495668_0149106 Ga0495668_0149106_805_1269 154
314 3300046616 Ga0495668_0301024 Ga0495668_0301024_315_782 154
315 3300046616 Ga0495668_0381728 Ga0495668_0381728_247_711 154
316 3300046642 Ga0495634_0122405 Ga0495634_0122405_324_788 154
317 3300046663 Ga0495635_0005160 Ga0495635_0005160_961_1425 154
318 3300046674 Ga0495588_0066222 Ga0495588_0066222_593_1057 154
319 3300046675 Ga0495657_0018176 Ga0495657_0018176_3397_3861 154
320 3300046680 Ga0495646_0325121 Ga0495646_0325121_309_773 154
321 3300046689 Ga0495613_0016675 Ga0495613_0016675_216_680 154
322 3300046690 Ga0495624_0017354 Ga0495624_0017354_1243_1707 154
323 3300046692 Ga0495671_0001944 Ga0495671_0001944_12292_12759 154
324 3300046809 Ga0495600_0128260 Ga0495600_0128260_87_551 154
325 3300047317 Ga0495604_0033572 Ga0495604_0033572_1716_2180 154
326 3300047319 Ga0495674_0170460 Ga0495674_0170460_878_1342 154
327 3300047321 Ga0495676_0051873 Ga0495676_0051873_1125_1589 154
328 3300047323 Ga0495683_0063877 Ga0495683_0063877_768_1232 154
329 3300047443 Ga0495687_048674 Ga0495687_048674_292_756 154
330 3300048088 Ga0495602_0053918 Ga0495602_0053918_2048_2512 154
331 3300048089 Ga0495614_0007563 Ga0495614_0007563_2570_3034 154
332 3300048904 Ga0496101_0078813 Ga0496101_0078813_1577_2041 154
333 3300048904 Ga0496101_0381781 Ga0496101_0381781_478_942 154
334 3300048905 Ga0496102_1670993 Ga0496102_1670993_81_545 154
335 3300048907 Ga0496104_0006417 Ga0496104_0006417_3406_3870 154
336 3300048908 Ga0496105_0005595 Ga0496105_0005595_5497_5961 154
337 3300048909 Ga0496106_0446855 Ga0496106_0446855_415_879 154
338 3300048913 Ga0496110_0431725 Ga0496110_0431725_519_983 154
339 3300048914 Ga0496111_0143025 Ga0496111_0143025_634_1098 154
340 3300048915 Ga0496112_0015095 Ga0496112_0015095_2683_3147 154
341 3300048916 Ga0496113_0161156 Ga0496113_0161156_770_1234 154
342 3300048916 Ga0496113_0163154 Ga0496113_0163154_472_936 154
343 3300048918 Ga0496115_0022747 Ga0496115_0022747_1147_1611 154
344 3300048920 Ga0496117_0118927 Ga0496117_0118927_86_550 154
345 3300048921 Ga0496118_0023404 Ga0496118_0023404_440_904 154
346 3300048922 Ga0496119_0033124 Ga0496119_0033124_1687_2151 154
347 3300048922 Ga0496119_0438234 Ga0496119_0438234_58_522 154
348 3300048924 Ga0496121_0055837 Ga0496121_0055837_940_1404 154
349 3300048925 Ga0496122_0081500 Ga0496122_0081500_1717_2181 154
350 3300048925 Ga0496122_0248569 Ga0496122_0248569_11_475 154
351 3300048926 Ga0496123_0159230 Ga0496123_0159230_732_1196 154
352 3300048926 Ga0496123_0184419 Ga0496123_0184419_37_501 154
353 3300048927 Ga0496124_0045249 Ga0496124_0045249_2635_3099 154
354 3300048927 Ga0496124_0143895 Ga0496124_0143895_727_1191 154
355 3300048928 Ga0496125_0085307 Ga0496125_0085307_1149_1613 154
356 3300048929 Ga0496126_0138298 Ga0496126_0138298_558_1022 154
357 3300050491 nmdc:mga00v17_488314_c1 nmdc:mga00v17_488314_c1_262_726 154
358 3300050491 nmdc:mga00v17_99839_c1 nmdc:mga00v17_99839_c1_373_837 154
359 3300050492 nmdc:mga0yw44_123968_c1 nmdc:mga0yw44_123968_c1_227_691 154
360 3300050493 nmdc:mga0k408_45179_c1 nmdc:mga0k408_45179_c1_1218_1682 154
361 3300050496 nmdc:mga07m45_251081_c1 nmdc:mga07m45_251081_c1_223_687 154
362 3300050516 nmdc:mga0sz30_48771_c1 nmdc:mga0sz30_48771_c1_141_605 154
363 3300050516 nmdc:mga0sz30_95996_c1 nmdc:mga0sz30_95996_c1_108_572 154
364 3300053079 Ga0500610_0029879 Ga0500610_0029879_1177_1644 154
365 3300053080 Ga0500635_0020322 Ga0500635_0020322_396_860 154
366 3300053085 Ga0495619_0375545 Ga0495619_0375545_26_490 154
367 3300053086 Ga0500578_0476728 Ga0500578_0476728_27_491 154
368 3300053090 Ga0500646_0167165 Ga0500646_0167165_194_658 154
369 3300053093 Ga0500651_0062374 Ga0500651_0062374_1252_1716 154
370 3300053109 Ga0500569_094045 Ga0500569_094045_26_490 154
371 3300053117 Ga0500593_034845 Ga0500593_034845_1184_1651 154
372 3300053121 Ga0500607_009331 Ga0500607_009331_5180_5647 154
373 3300053134 Ga0500658_0217840 Ga0500658_0217840_395_859 154
374 3300053136 Ga0500559_0133847 Ga0500559_0133847_128_592 154
375 3300053138 Ga0500564_085838 Ga0500564_085838_608_1072 154
376 3300053139 Ga0500568_0106379 Ga0500568_0106379_489_953 154
377 3300053142 Ga0500577_0033509 Ga0500577_0033509_27_491 154
378 3300053146 Ga0500588_0010843 Ga0500588_0010843_675_1139 154
379 3300053148 Ga0500590_039312 Ga0500590_039312_1248_1712 154
380 3300053158 Ga0500627_0000293 Ga0500627_0000293_179_646 154
381 3300053161 Ga0500634_0041197 Ga0500634_0041197_535_1002 154
382 3300053177 Ga0500636_0000166 Ga0500636_0000166_25652_26116 154
383 3300053733 Ga0500552_022486 Ga0500552_022486_53_517 154
384 iso_pu_bacteria 8016622563 8016625542 154
385 iso_pu_bacteria 8019547302 8019552599 154
386 3300002773 JGI25152J39213_1016830 JGI25152J39213_10168302 156
387 3300003187 JGI25151J46595_10047293 JGI25151J46595_100472932 156
388 3300003215 JGI25153J46596_10042082 JGI25153J46596_100420822 156
389 3300003773 Ga0055537_1012516 Ga0055537_10125162 156
390 3300003775 Ga0055524_1034376 Ga0055524_10343762 156
391 3300003790 Ga0055528_1031108 Ga0055528_10311082 156
392 3300003791 Ga0055530_10020559 Ga0055530_100205592 156
393 3300003792 Ga0055540_1001842 Ga0055540_10018422 156
394 3300003794 Ga0055531_10002636 Ga0055531_1000263611 156
395 3300005457 Ga0070662_100042564 Ga0070662_1000425642 156
396 3300005616 Ga0068852_101414435 Ga0068852_1014144351 156
397 3300006358 Ga0068871_100481100 Ga0068871_1004811001 156
398 3300013100 Ga0157373_10453515 Ga0157373_104535152 156
399 3300014969 Ga0157376_10580699 Ga0157376_105806992 156
400 3300015261 Ga0182006_1009529 Ga0182006_10095292 156
401 3300025292 Ga0209676_1000403 Ga0209676_100040364 156
402 3300025298 Ga0209050_1001095 Ga0209050_10010952 156
403 3300025303 Ga0209051_1000423 Ga0209051_100042331 156
404 3300025304 Ga0209257_1000215 Ga0209257_1000215101 156
405 3300025933 Ga0207706_10075127 Ga0207706_100751272 156
406 3300025942 Ga0207689_10122070 Ga0207689_101220702 156
407 3300046660 Ga0495625_0028232 Ga0495625_0028232_742_1212 156
408 3300046691 Ga0495670_0022247 Ga0495670_0022247_317_787 156
409 3300048921 Ga0496118_0018486 Ga0496118_0018486_2739_3209 156
410 3300048924 Ga0496121_0121479 Ga0496121_0121479_326_796 156

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12680

SnoaL_2

SnoaL-like domain

64

161

0.93

PF07366

SnoaL

SnoaL-like polyketide cyclase

62

170

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g0k-assembly1.cif.gz_A-2 crystal structure of a protein of unknown function with a cystatin-like fold (saro_2880) from novosphingobium aromaticivorans dsm at 1.30 a resolution 0.8692 32 151
4kvh-assembly1.cif.gz_A-2 crystal structure of ketosteroid isomerase fold protein hmuk_0747 0.8336 37 138
5jk2-assembly5.cif.gz_E crystal structure of treponema pallidum tp0751 (pallilysin) 0.8269 91 139
5jk2-assembly10.cif.gz_B crystal structure of treponema pallidum tp0751 (pallilysin) 0.8193 91 139
3ff2-assembly1.cif.gz_A-2 crystal structure of an uncharacterized cystatin fold protein (saro_2299) from novosphingobium aromaticivorans dsm at 1.90 a resolution 0.814 37 136
ID Description Score Start End Superfamily
4kvhA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8336 37 138 3.10.450.50
3f40A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8221 37 139 3.10.450.50
3g0kA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8055 34 150 3.10.450.50
af_Q58217_26_175_3.40.1410.10 Alpha Beta;3-Layer(aba) Sandwich;Chorismate lyase;Chorismate lyase-like 0.796 91 124 3.40.1410.10
af_P72035_5_114_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.789 41 138 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A0Q8BRI2-F1-model_v4 deleted 0.9274 33 151
AF-A0A0W0TU92-F1-model_v4 SnoaL-like polyketide cyclase 0.9264 32 151 GO:0030638
AF-A0A7D3VT00-F1-model_v4 Polyketide cyclase 0.9261 32 151 GO:0030638
AF-A0A1M5SIK0-F1-model_v4 Predicted SnoaL-like aldol condensation-catalyzing enzyme 0.9226 27 151 GO:0030638
AF-A0A5N8A9K0-F1-model_v4 SnoaL-like domain-containing protein 0.9186 33 151

Feature Viewer

pLDDT pTM Quality
86.7 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map