F437398

General Info

Members Datasets Scaffolds Average Seq Length
410 232 392 328

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2773857933|2774901669
Length 401
Sequence EEQEELNVTDQKFGDNSDDRHSEHHLFSRGHADRGTATAWLTEAVTRRVSLVRLHPKGRRQRQETPSAPSGRVVACEVYRDGHRDPHPVDHVDALRAAREQRNSFVWLGLYQPTAPELTAIADVYGLHPLAVEDAVNAHQRXKMEQYAETLFVVLKTVCYVDHEELTATSEIVHTGEVMVFLSHDFVVTVRHGEHGGLQSLRSRLEAQPQVLRHGPSAVLHAICDQIVDDYLAVTEKIEVDIDAIEASVFQRSLRPDTGKVYQLKREVLEFKHAIMPLYAPLRALAEPGVIGIDPRIRAYFRDVADHLEEVTARIARFDELLSSILQATLTQVTIAQNEDMRRISAWVAIAAVPTAIAGIYGMNFEHMPELRQVWGYPAVLCLMATVCFFLYRAFKRNGWL

Samples

Sample ID Description Type Environment
1 2506783011 Frankia datiscae Dg1 Isolate Nodule
2 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
3 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
4 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
5 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
6 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
7 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
8 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
9 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
10 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
11 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
12 2773857933 Frankia sp. BMG5.30 Isolate Nodule
13 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
14 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
15 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
16 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
17 2922554459 Rhodococcus sp. 66b Isolate Unclassified
18 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
19 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
128 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
129 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
130 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
131 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
135 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
141 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
142 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
145 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
146 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
147 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
148 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
149 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
150 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
151 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
152 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
155 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
156 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
161 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
162 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
163 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
164 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
165 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
166 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
167 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
168 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
184 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
185 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
186 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
187 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
188 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
189 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
190 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
191 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
205 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
206 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
207 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
208 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
209 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
210 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
211 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
212 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
213 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
214 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
215 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
219 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
220 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
221 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
222 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
223 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
224 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
227 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
228 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
229 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
232 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.37
Metatranscriptomes 0.24
Isolates 4.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.27
Nodule 0.49
Rhizoplane 9.76
Rhizosphere 75.12
Stem 0
Stem Tuber 0
Unclassified 5.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10033023 3300001989 Bacteria 1775
2 Ga0055540_1000052 3300003792 Bacteria 143472
3 Ga0070683_100015353 3300005329 Bacteria 6724
4 Ga0070683_100016492 3300005329 Bacteria 6516
5 Ga0070683_100080615 3300005329 Bacteria 3047
6 Ga0070683_100325688 3300005329 Bacteria 1463
7 Ga0070690_100052950 3300005330 Bacteria 2595
8 Ga0070670_100356937 3300005331 Bacteria 1285
9 Ga0070666_10087462 3300005335 Bacteria 2136
10 Ga0070682_100045256 3300005337 Bacteria 2727
11 Ga0068868_100001566 3300005338 Bacteria 15608
12 Ga0068868_100173691 3300005338 Bacteria 1785
13 Ga0070661_100000005 3300005344 Bacteria 220455
14 Ga0070661_100141715 3300005344 Bacteria 1812
15 Ga0070692_10091152 3300005345 Bacteria 1657
16 Ga0070669_100005932 3300005353 Bacteria 8816
17 Ga0070675_100000008 3300005354 Bacteria 250004
18 Ga0070674_100268668 3300005356 Bacteria 1347
19 Ga0070688_100000022 3300005365 Bacteria 71190
20 Ga0070688_100000369 3300005365 Bacteria 22840
21 Ga0070659_100046534 3300005366 Bacteria 3400
22 Ga0070667_100000107 3300005367 Bacteria 105338
23 Ga0070700_100287388 3300005441 Bacteria 1195
24 Ga0070678_100015464 3300005456 Bacteria 4854
25 Ga0070678_100062947 3300005456 Bacteria 2742
26 Ga0068867_100290454 3300005459 Bacteria 1344
27 Ga0070685_10000047 3300005466 Bacteria 72690
28 Ga0070685_10000243 3300005466 Bacteria 35532
29 Ga0068853_100138061 3300005539 Bacteria 2187
30 Ga0070672_100000058 3300005543 Bacteria 49964
31 Ga0070672_100260295 3300005543 Bacteria 1463
32 Ga0070665_100006601 3300005548 Bacteria 11790
33 Ga0070665_100039516 3300005548 Bacteria 4744
34 Ga0070665_100090049 3300005548 Bacteria 3074
35 Ga0070704_100109182 3300005549 Bacteria 2102
36 Ga0068855_100078275 3300005563 Bacteria 3836
37 Ga0068857_100008248 3300005577 Bacteria 9002
38 Ga0068857_100114166 3300005577 Bacteria 2429
39 Ga0068856_100001747 3300005614 Bacteria 22703
40 Ga0068856_100056356 3300005614 Bacteria 3878
41 Ga0070702_100031370 3300005615 Bacteria 2907
42 Ga0070702_100042001 3300005615 Bacteria 2568
43 Ga0068852_100000002 3300005616 Bacteria 268221
44 Ga0068852_100109276 3300005616 Bacteria 2511
45 Ga0068852_100252303 3300005616 Bacteria 1691
46 Ga0068859_100005604 3300005617 Bacteria 12794
47 Ga0068851_10006925 3300005834 Bacteria 5198
48 Ga0068863_100000833 3300005841 Bacteria 30909
49 Ga0068858_100009472 3300005842 Bacteria 9289
50 Ga0068858_100242165 3300005842 Bacteria 1712
51 Ga0068860_100000174 3300005843 Bacteria 105338
52 Ga0068862_100000019 3300005844 Bacteria 229485
53 Ga0081455_10119281 3300005937 Bacteria 2080
54 Ga0081538_10027672 3300005981 Bacteria 3923
55 Ga0081538_10084638 3300005981 Bacteria 1670
56 Ga0075365_10005768 3300006038 Bacteria 6722
57 Ga0075365_10014420 3300006038 Bacteria 4754
58 Ga0075365_10069662 3300006038 Bacteria 2364
59 Ga0075365_10179592 3300006038 Bacteria 1479
60 Ga0075363_100013998 3300006048 Bacteria 3906
61 Ga0075363_100026645 3300006048 Bacteria 2959
62 Ga0075363_100037653 3300006048 Bacteria 2541
63 Ga0075363_100042237 3300006048 Bacteria 2408
64 Ga0075363_100048473 3300006048 Bacteria 2259
65 Ga0075364_10005844 3300006051 Bacteria 7184
66 Ga0075364_10026694 3300006051 Bacteria 3686
67 Ga0075364_10056190 3300006051 Bacteria 2577
68 Ga0075364_10063553 3300006051 Bacteria 2423
69 Ga0075364_10140250 3300006051 Bacteria 1625
70 Ga0070712_100000820 3300006175 Bacteria 18444
71 Ga0075367_10059872 3300006178 Bacteria 2268
72 Ga0075367_10079174 3300006178 Bacteria 1986
73 Ga0068865_100000438 3300006881 Bacteria 23094
74 Ga0097620_100005604 3300006931 Bacteria 12794
75 Ga0105240_10425906 3300009093 Bacteria 1490
76 Ga0105245_10000026 3300009098 Bacteria 163660
77 Ga0105245_10052165 3300009098 Bacteria 3668
78 Ga0105245_10087176 3300009098 Bacteria 2865
79 Ga0105245_10089126 3300009098 Bacteria 2835
80 Ga0105245_10194638 3300009098 Bacteria 1944
81 Ga0105245_10442398 3300009098 Bacteria 1307
82 Ga0105247_10000023 3300009101 Bacteria 215645
83 Ga0114129_10333724 3300009147 Bacteria 2012
84 Ga0105243_10000243 3300009148 Bacteria 62451
85 Ga0105243_10020690 3300009148 Bacteria 4990
86 Ga0105243_10040662 3300009148 Bacteria 3632
87 Ga0105243_10062971 3300009148 Bacteria 2971
88 Ga0105243_10136858 3300009148 Bacteria 2085
89 Ga0105243_10225878 3300009148 Bacteria 1658
90 Ga0105242_10015689 3300009176 Bacteria 5886
91 Ga0105242_10031173 3300009176 Bacteria 4255
92 Ga0105242_10368040 3300009176 Bacteria 1332
93 Ga0105248_10000020 3300009177 Bacteria 284637
94 Ga0105248_10000557 3300009177 Bacteria 42285
95 Ga0105248_10377021 3300009177 Bacteria 1597
96 Ga0105238_10305938 3300009551 Bacteria 1574
97 Ga0105238_10566863 3300009551 Bacteria 1141
98 Ga0105249_10000033 3300009553 Bacteria 213834
99 Ga0105249_10169647 3300009553 Bacteria 2115
100 Ga0105249_10384370 3300009553 Bacteria 1430
101 Ga0105246_10087806 3300011119 Bacteria 2233
102 Ga0105246_10177419 3300011119 Bacteria 1637
103 Ga0157371_10098550 3300013102 Bacteria 2073
104 Ga0157370_10005465 3300013104 Bacteria 14250
105 Ga0157369_10000014 3300013105 Bacteria 266411
106 Ga0157378_10004034 3300013297 Bacteria 12965
107 Ga0163162_10043599 3300013306 Bacteria 4492
108 Ga0163162_10379148 3300013306 Bacteria 1547
109 Ga0157372_10035360 3300013307 Bacteria 5499
110 Ga0157375_10001577 3300013308 Bacteria 19613
111 Ga0157375_10055378 3300013308 Bacteria 3910
112 Ga0157375_10161269 3300013308 Bacteria 2384
113 Ga0157375_10226668 3300013308 Bacteria 2027
114 Ga0157375_10301485 3300013308 Bacteria 1766
115 Ga0157375_10429449 3300013308 Bacteria 1487
116 Ga0163163_10151582 3300014325 Bacteria 2362
117 Ga0163163_10237356 3300014325 Bacteria 1873
118 Ga0163163_10247245 3300014325 Bacteria 1834
119 Ga0163163_10371033 3300014325 Bacteria 1488
120 Ga0157380_10001764 3300014326 Bacteria 14277
121 Ga0157380_10005999 3300014326 Bacteria 8504
122 Ga0157380_10018827 3300014326 Bacteria 5135
123 Ga0157380_10022204 3300014326 Bacteria 4772
124 Ga0157380_10176033 3300014326 Bacteria 1875
125 Ga0157377_10073855 3300014745 Bacteria 1977
126 Ga0157377_10269056 3300014745 Bacteria 1112
127 Ga0157379_10021687 3300014968 Bacteria 5688
128 Ga0157376_10020164 3300014969 Bacteria 5153
129 Ga0163161_10019211 3300017792 Bacteria 4792
130 Ga0163161_10196839 3300017792 Bacteria 1552
131 Ga0206353_10341763 3300020082 Bacteria 3689
132 Ga0209051_1008278 3300025303 Bacteria 5527
133 Ga0207656_10027785 3300025321 Bacteria 2317
134 Ga0207710_10000010 3300025900 Bacteria 482087
135 Ga0207710_10000027 3300025900 Bacteria 307001
136 Ga0207688_10013958 3300025901 Bacteria 4367
137 Ga0207680_10077718 3300025903 Bacteria 2077
138 Ga0207693_10011264 3300025915 Bacteria 7240
139 Ga0207657_10131456 3300025919 Bacteria 2051
140 Ga0207649_10000005 3300025920 Bacteria 356179
141 Ga0207681_10005429 3300025923 Bacteria 7827
142 Ga0207694_10123607 3300025924 Bacteria 2068
143 Ga0207694_10217182 3300025924 Bacteria 1559
144 Ga0207659_10000014 3300025926 Bacteria 168481
145 Ga0207687_10000017 3300025927 Bacteria 237310
146 Ga0207687_10044531 3300025927 Bacteria 3063
147 Ga0207687_10054755 3300025927 Bacteria 2792
148 Ga0207687_10180345 3300025927 Bacteria 1636
149 Ga0207687_10282473 3300025927 Bacteria 1331
150 Ga0207690_10114448 3300025932 Bacteria 1948
151 Ga0207690_10249885 3300025932 Bacteria 1369
152 Ga0207706_10149083 3300025933 Bacteria 2057
153 Ga0207706_10159679 3300025933 Bacteria 1982
154 Ga0207686_10013594 3300025934 Bacteria 4507
155 Ga0207686_10122075 3300025934 Bacteria 1775
156 Ga0207686_10125705 3300025934 Bacteria 1752
157 Ga0207709_10003252 3300025935 Bacteria 9740
158 Ga0207709_10011241 3300025935 Bacteria 4937
159 Ga0207709_10043357 3300025935 Bacteria 2711
160 Ga0207709_10050741 3300025935 Bacteria 2539
161 Ga0207709_10103488 3300025935 Bacteria 1887
162 Ga0207709_10119815 3300025935 Bacteria 1775
163 Ga0207669_10242806 3300025937 Bacteria 1336
164 Ga0207704_10000608 3300025938 Bacteria 15827
165 Ga0207691_10000284 3300025940 Bacteria 49983
166 Ga0207691_10314860 3300025940 Bacteria 1342
167 Ga0207691_10427186 3300025940 Bacteria 1129
168 Ga0207711_10000006 3300025941 Bacteria 792692
169 Ga0207711_10000089 3300025941 Bacteria 97575
170 Ga0207661_10001477 3300025944 Bacteria 15906
171 Ga0207661_10003414 3300025944 Bacteria 11024
172 Ga0207661_10086700 3300025944 Bacteria 2599
173 Ga0207667_10129996 3300025949 Bacteria 2594
174 Ga0207712_10000031 3300025961 Bacteria 213662
175 Ga0207712_10263217 3300025961 Bacteria 1399
176 Ga0207668_10071409 3300025972 Bacteria 2480
177 Ga0207668_10116119 3300025972 Bacteria 2018
178 Ga0207640_10022597 3300025981 Bacteria 3767
179 Ga0207658_10005658 3300025986 Bacteria 8555
180 Ga0207677_10009051 3300026023 Bacteria 5588
181 Ga0207703_10012404 3300026035 Bacteria 6642
182 Ga0207639_10145605 3300026041 Bacteria 1979
183 Ga0207678_10035582 3300026067 Bacteria 4335
184 Ga0207678_10147491 3300026067 Bacteria 2008
185 Ga0207708_10349216 3300026075 Bacteria 1213
186 Ga0207702_10000076 3300026078 Bacteria 112300
187 Ga0207702_10038294 3300026078 Bacteria 4016
188 Ga0207641_10001166 3300026088 Bacteria 26450
189 Ga0207648_10143764 3300026089 Bacteria 2104
190 Ga0207674_10009187 3300026116 Bacteria 11335
191 Ga0207674_10055512 3300026116 Bacteria 4026
192 Ga0207683_10024482 3300026121 Bacteria 5201
193 Ga0207683_10067810 3300026121 Bacteria 3148
194 Ga0207683_10172421 3300026121 Bacteria 1960
195 Ga0207683_10353137 3300026121 Bacteria 1349
196 Ga0207698_10000004 3300026142 Bacteria 313614
197 Ga0268266_10000303 3300028379 Bacteria 78632
198 Ga0268266_10005480 3300028379 Bacteria 11817
199 Ga0268266_10048471 3300028379 Bacteria 3642
200 Ga0268266_10064494 3300028379 Bacteria 3165
201 Ga0268265_10000029 3300028380 Bacteria 229499
202 Ga0268264_10000236 3300028381 Bacteria 105352
203 Ga0316575_10003619 3300031665 Bacteria 5359
204 Ga0316579_10007717 3300031691 Bacteria 4457
205 Ga0316576_10002136 3300031727 Bacteria 11136
206 Ga0316576_10065473 3300031727 Bacteria 2671
207 Ga0316576_10082315 3300031727 Bacteria 2389
208 Ga0316578_10099729 3300031728 Bacteria 1740
209 Ga0316577_10167801 3300031733 Bacteria 1238
210 Ga0307413_10170003 3300031824 Bacteria 1542
211 Ga0307410_10093743 3300031852 Bacteria 2137
212 Ga0307410_10118868 3300031852 Bacteria 1924
213 Ga0307406_10116320 3300031901 Bacteria 1850
214 Ga0307407_10027067 3300031903 Bacteria 3046
215 Ga0307409_100098302 3300031995 Bacteria 2420
216 Ga0307409_100114810 3300031995 Bacteria 2266
217 Ga0307416_100007507 3300032002 Bacteria 6943
218 Ga0307414_10225946 3300032004 Bacteria 1540
219 Ga0307415_100002798 3300032126 Bacteria 8734
220 Ga0307415_100082726 3300032126 Bacteria 2298
221 Ga0316574_0044218 3300035398 Bacteria 2755
222 Ga0316574_0202297 3300035398 Bacteria 1275
223 Ga0316582_0001056 3300036647 Bacteria 11553
224 Ga0316584_0044158 3300036712 Bacteria 3323
225 Ga0316584_0071820 3300036712 Bacteria 2593
226 Ga0436365_1218319 3300039437 Bacteria 2474
227 Ga0439461_0000939 3300041410 Bacteria 4359
228 Ga0439466_0001646 3300041411 Bacteria 8741
229 Ga0451853_0626216 3300041512 Bacteria 3320
230 Ga0439457_019133 3300042014 Bacteria 1521
231 Ga0466963_0056671 3300044694 Bacteria 2608
232 Ga0466963_0085310 3300044694 Bacteria 2144
233 Ga0466957_0001975 3300044842 Bacteria 10920
234 Ga0466957_0008765 3300044842 Bacteria 5756
235 Ga0466957_0030794 3300044842 Bacteria 3204
236 Ga0466958_0025718 3300045836 Bacteria 3473
237 Ga0466967_0000001 3300045976 Bacteria 229823
238 Ga0466967_0012676 3300045976 Bacteria 6468
239 Ga0495603_0101113 3300046455 Bacteria 1683
240 Ga0495629_0000055 3300046459 Bacteria 105268
241 Ga0495641_0008113 3300046461 Bacteria 6450
242 Ga0495641_0065344 3300046461 Bacteria 1637
243 Ga0495653_0100079 3300046463 Bacteria 2102
244 Ga0495606_0000057 3300046507 Bacteria 197956
245 Ga0495630_0000011 3300046517 Bacteria 232063
246 Ga0495630_0124021 3300046517 Bacteria 1960
247 Ga0495668_0000704 3300046616 Bacteria 40286
248 Ga0495634_0148323 3300046642 Bacteria 1485
249 Ga0495588_0000250 3300046674 Bacteria 45010
250 Ga0495647_0002251 3300046681 Bacteria 6053
251 Ga0495658_0037974 3300046683 Bacteria 2665
252 Ga0495624_0000548 3300046690 Bacteria 29416
253 Ga0495624_0088842 3300046690 Bacteria 1908
254 Ga0495581_0029664 3300047315 Bacteria 3170
255 Ga0495676_0156560 3300047321 Bacteria 1616
256 Ga0495676_0179610 3300047321 Bacteria 1484
257 Ga0495680_0225299 3300047322 Bacteria 1337
258 Ga0495593_0036745 3300047673 Bacteria 2654
259 Ga0495602_0058839 3300048088 Bacteria 3361
260 Ga0496101_0155387 3300048904 Bacteria 1752
261 Ga0496101_0201667 3300048904 Bacteria 1538
262 Ga0496102_0000205 3300048905 Bacteria 79771
263 Ga0496102_0011010 3300048905 Bacteria 7793
264 Ga0496102_0140313 3300048905 Bacteria 2266
265 Ga0496103_0000315 3300048906 Bacteria 44709
266 Ga0496103_0097664 3300048906 Bacteria 1857
267 Ga0496104_0183248 3300048907 Bacteria 2004
268 Ga0496104_0336908 3300048907 Bacteria 1421
269 Ga0496105_0277142 3300048908 Bacteria 1353
270 Ga0496106_0254190 3300048909 Bacteria 1405
271 Ga0496107_0145552 3300048910 Bacteria 1752
272 Ga0496107_0163892 3300048910 Bacteria 1648
273 Ga0496108_0000063 3300048911 Bacteria 118950
274 Ga0496108_0007785 3300048911 Bacteria 8679
275 Ga0496108_0008040 3300048911 Bacteria 8560
276 Ga0496108_0008307 3300048911 Bacteria 8420
277 Ga0496108_0031072 3300048911 Bacteria 4428
278 Ga0496108_0044225 3300048911 Bacteria 3719
279 Ga0496109_0000012 3300048912 Bacteria 229699
280 Ga0496109_0000039 3300048912 Bacteria 145769
281 Ga0496109_0021646 3300048912 Bacteria 5689
282 Ga0496109_0040675 3300048912 Bacteria 4210
283 Ga0496109_0081360 3300048912 Bacteria 2984
284 Ga0496109_0121713 3300048912 Bacteria 2431
285 Ga0496110_0004671 3300048913 Bacteria 10648
286 Ga0496110_0112279 3300048913 Bacteria 2450
287 Ga0496110_0202998 3300048913 Bacteria 1801
288 Ga0496111_0019164 3300048914 Bacteria 4748
289 Ga0496111_0025528 3300048914 Bacteria 4170
290 Ga0496111_0088254 3300048914 Bacteria 2271
291 Ga0496111_0126618 3300048914 Bacteria 1888
292 Ga0496112_0014300 3300048915 Bacteria 7353
293 Ga0496112_0182473 3300048915 Bacteria 2062
294 Ga0496112_0315171 3300048915 Bacteria 1509
295 Ga0496113_0017684 3300048916 Bacteria 4955
296 Ga0496114_0006498 3300048917 Bacteria 9210
297 Ga0496114_0019850 3300048917 Bacteria 5449
298 Ga0496114_0069388 3300048917 Bacteria 2960
299 Ga0496114_0276314 3300048917 Bacteria 1480
300 Ga0496116_0016759 3300048919 Bacteria 5718
301 Ga0496117_0000725 3300048920 Bacteria 51801
302 Ga0496117_0049427 3300048920 Bacteria 2992
303 Ga0496118_0002778 3300048921 Bacteria 22922
304 Ga0496119_0001488 3300048922 Bacteria 28066
305 Ga0496120_0017702 3300048923 Bacteria 4608
306 Ga0496121_0012317 3300048924 Bacteria 9352
307 Ga0496125_0030306 3300048928 Bacteria 4842
308 Ga0496125_0081658 3300048928 Bacteria 2468
309 Ga0496126_0000086 3300048929 Bacteria 215914
310 Ga0496126_0024569 3300048929 Bacteria 5814
311 Ga0501031_0016528 3300049568 Bacteria 4793
312 Ga0501033_0038239 3300049570 Bacteria 3589
313 Ga0501033_0448951 3300049570 Bacteria 896
314 Ga0501034_0031309 3300049571 Bacteria 5404
315 Ga0501034_0278194 3300049571 Bacteria 1613
316 Ga0501036_0007457 3300049572 Bacteria 8915
317 Ga0501036_0009182 3300049572 Bacteria 8131
318 Ga0501036_0029819 3300049572 Bacteria 4610
319 Ga0501036_0135755 3300049572 Bacteria 2077
320 Ga0501037_0013402 3300049573 Bacteria 6038
321 Ga0501037_0092664 3300049573 Bacteria 2185
322 Ga0501039_0024970 3300049575 Bacteria 4590
323 Ga0501039_0038938 3300049575 Bacteria 3672
324 Ga0501040_0000591 3300049576 Bacteria 22116
325 Ga0501040_0347626 3300049576 Bacteria 1062
326 Ga0501041_0001943 3300049577 Bacteria 11603
327 Ga0501041_0053994 3300049577 Bacteria 2451
328 Ga0501042_0000992 3300049578 Bacteria 16089
329 Ga0501042_0010275 3300049578 Bacteria 6267
330 Ga0501042_0155238 3300049578 Bacteria 1651
331 Ga0501043_0002020 3300049579 Bacteria 17327
332 Ga0501043_0214857 3300049579 Bacteria 1490
333 Ga0501046_0007978 3300049580 Bacteria 9258
334 Ga0501046_0115980 3300049580 Bacteria 2042
335 Ga0501047_0004900 3300049581 Bacteria 12574
336 Ga0501048_0007796 3300049582 Bacteria 8118
337 Ga0501048_0008826 3300049582 Bacteria 7593
338 Ga0501068_0082452 3300049584 Bacteria 1975
339 Ga0501069_0122003 3300049585 Bacteria 1489
340 Ga0501070_0030849 3300049586 Bacteria 4490
341 Ga0501071_0001338 3300049587 Bacteria 14072
342 Ga0501071_0094306 3300049587 Bacteria 2201
343 Ga0501072_0001391 3300049588 Bacteria 18210
344 Ga0501072_0088207 3300049588 Bacteria 2462
345 Ga0501074_0001102 3300049590 Bacteria 17638
346 Ga0501074_0006787 3300049590 Bacteria 8263
347 Ga0501074_0284112 3300049590 Bacteria 1176
348 Ga0501075_0006998 3300049591 Bacteria 7792
349 Ga0501075_0177374 3300049591 Bacteria 1626
350 Ga0501076_0002217 3300049592 Bacteria 13307
351 Ga0501077_0005639 3300049593 Bacteria 7629
352 Ga0501079_0177368 3300049741 Bacteria 1662
353 Ga0501081_0000480 3300049743 Bacteria 22204
354 Ga0501081_0058761 3300049743 Bacteria 2662
355 Ga0501083_0114817 3300049744 Bacteria 1768
356 Ga0501035_0330551 3300049822 Bacteria 1279
357 Ga0501044_0006584 3300049823 Bacteria 12821
358 Ga0501044_0085354 3300049823 Bacteria 3190
359 Ga0501045_0000837 3300049824 Bacteria 19927
360 Ga0501045_0095251 3300049824 Bacteria 2202
361 nmdc:mga03683_11339_c1 3300050489 Bacteria 2575
362 nmdc:mga03n38_134517_c1 3300050490 Bacteria 1229
363 nmdc:mga03n38_41067_c1 3300050490 Bacteria 2014
364 nmdc:mga03n38_7427_c1 3300050490 Bacteria 3880
365 nmdc:mga03n38_9131_c1 3300050490 Bacteria 3590
366 nmdc:mga00v17_150033_c1 3300050491 Bacteria 1498
367 nmdc:mga00v17_18998_c1 3300050491 Bacteria 3915
368 nmdc:mga00v17_21912_c1 3300050491 Bacteria 3680
369 nmdc:mga00v17_2268_c1 3300050491 Bacteria 9861
370 nmdc:mga00v17_30398_c1 3300050491 Bacteria 3178
371 nmdc:mga0yw44_147984_c1 3300050492 Bacteria 1530
372 nmdc:mga0yw44_249667_c1 3300050492 Bacteria 1181
373 nmdc:mga0yw44_51928_c1 3300050492 Bacteria 2484
374 nmdc:mga0yw44_6702_c1 3300050492 Bacteria 2472
375 nmdc:mga06z11_176377_c1 3300050494 Bacteria 1230
376 nmdc:mga06z11_50799_c1 3300050494 Bacteria 2120
377 nmdc:mga07m45_206863_c1 3300050496 Bacteria 1142
378 nmdc:mga05p37_112101_c1 3300050507 Bacteria 3354
379 Ga0495612_0004367 3300053078 Bacteria 5866
380 Ga0500568_0000043 3300053139 Bacteria 126766
381 Ga0500616_0000141 3300053153 Bacteria 122164
382 Ga0500645_000027 3300053730 Bacteria 124260
383 Ga0501084_0017167 3300054114 Bacteria 6012
384 Ga0501084_0057738 3300054114 Bacteria 3247
385 Ga0501084_0114638 3300054114 Bacteria 2266
386 Ga0501084_0182762 3300054114 Bacteria 1770
387 Ga0501082_0006187 3300060353 Bacteria 10390
388 Ga0501082_0262581 3300060353 Bacteria 1502
389 Ga0501082_0328628 3300060353 Bacteria 1332
390 Ga0530510_0026633 3300061734 Bacteria 4139
391 Ga0530510_0037255 3300061734 Bacteria 3507
392 Ga0530510_0175515 3300061734 Bacteria 1588

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049570 Ga0501033_0448951 Ga0501033_0448951_13_867 284
2 3300005329 Ga0070683_100325688 Ga0070683_1003256881 287
3 3300005616 Ga0068852_100252303 Ga0068852_1002523031 287
4 3300005842 Ga0068858_100242165 Ga0068858_1002421652 287
5 3300009098 Ga0105245_10194638 Ga0105245_101946383 287
6 3300013102 Ga0157371_10098550 Ga0157371_100985501 287
7 3300013308 Ga0157375_10301485 Ga0157375_103014852 287
8 3300014745 Ga0157377_10073855 Ga0157377_100738553 287
9 3300025901 Ga0207688_10013958 Ga0207688_100139583 287
10 3300025933 Ga0207706_10159679 Ga0207706_101596792 287
11 3300026067 Ga0207678_10035582 Ga0207678_100355823 287
12 3300026121 Ga0207683_10172421 Ga0207683_101724211 287
13 3300025940 Ga0207691_10314860 Ga0207691_103148601 289
14 3300005549 Ga0070704_100109182 Ga0070704_1001091821 290
15 3300025934 Ga0207686_10122075 Ga0207686_101220751 290
16 3300060353 Ga0501082_0328628 Ga0501082_0328628_393_1295 300
17 3300005365 Ga0070688_100000022 Ga0070688_10000002233 302
18 3300005456 Ga0070678_100015464 Ga0070678_1000154643 302
19 3300005466 Ga0070685_10000047 Ga0070685_1000004741 302
20 3300026121 Ga0207683_10024482 Ga0207683_100244824 302
21 3300048914 Ga0496111_0019164 Ga0496111_0019164_39_947 302
22 3300050494 nmdc:mga06z11_176377_c1 nmdc:mga06z11_176377_c1_185_1159 306
23 3300005456 Ga0070678_100062947 Ga0070678_1000629473 309
24 3300025924 Ga0207694_10217182 Ga0207694_102171821 309
25 3300025972 Ga0207668_10116119 Ga0207668_101161192 309
26 3300026121 Ga0207683_10067810 Ga0207683_100678103 309
27 3300050494 nmdc:mga06z11_50799_c1 nmdc:mga06z11_50799_c1_537_1508 310
28 3300049571 Ga0501034_0031309 Ga0501034_0031309_4114_5085 311
29 3300049572 Ga0501036_0009182 Ga0501036_0009182_5273_6244 311
30 3300049573 Ga0501037_0092664 Ga0501037_0092664_1168_2139 311
31 3300049578 Ga0501042_0010275 Ga0501042_0010275_437_1408 311
32 3300049579 Ga0501043_0002020 Ga0501043_0002020_14775_15746 311
33 3300049581 Ga0501047_0004900 Ga0501047_0004900_6450_7421 311
34 3300049582 Ga0501048_0007796 Ga0501048_0007796_932_1903 311
35 3300049590 Ga0501074_0006787 Ga0501074_0006787_270_1241 311
36 3300049823 Ga0501044_0006584 Ga0501044_0006584_1147_2118 311
37 3300050490 nmdc:mga03n38_134517_c1 nmdc:mga03n38_134517_c1_276_1214 311
38 3300005614 Ga0068856_100056356 Ga0068856_1000563563 313
39 3300026078 Ga0207702_10038294 Ga0207702_100382942 313
40 3300045976 Ga0466967_0012676 Ga0466967_0012676_924_1970 316
41 3300025935 Ga0207709_10103488 Ga0207709_101034882 317
42 3300044694 Ga0466963_0085310 Ga0466963_0085310_158_1270 317
43 3300014326 Ga0157380_10005999 Ga0157380_100059992 318
44 3300048912 Ga0496109_0081360 Ga0496109_0081360_1737_2822 319
45 3300048914 Ga0496111_0088254 Ga0496111_0088254_1150_2235 319
46 3300005615 Ga0070702_100031370 Ga0070702_1000313701 320
47 3300006178 Ga0075367_10079174 Ga0075367_100791742 320
48 3300009098 Ga0105245_10442398 Ga0105245_104423981 320
49 3300009551 Ga0105238_10566863 Ga0105238_105668631 320
50 3300025932 Ga0207690_10114448 Ga0207690_101144482 320
51 3300025933 Ga0207706_10149083 Ga0207706_101490832 320
52 3300025972 Ga0207668_10071409 Ga0207668_100714094 320
53 3300025981 Ga0207640_10022597 Ga0207640_100225976 320
54 iso_pu_bacteria 2643221567 2643849845 320
55 iso_pu_bacteria 2643221624 2644135847 320
56 iso_pu_bacteria 2919446982 2919450409 320
57 3300005329 Ga0070683_100015353 Ga0070683_1000153533 321
58 3300005329 Ga0070683_100016492 Ga0070683_1000164925 321
59 3300005330 Ga0070690_100052950 Ga0070690_1000529502 321
60 3300005335 Ga0070666_10087462 Ga0070666_100874622 321
61 3300005338 Ga0068868_100001566 Ga0068868_1000015665 321
62 3300005344 Ga0070661_100000005 Ga0070661_10000000516 321
63 3300005354 Ga0070675_100000008 Ga0070675_100000008252 321
64 3300005365 Ga0070688_100000369 Ga0070688_10000036921 321
65 3300005466 Ga0070685_10000243 Ga0070685_1000024333 321
66 3300005543 Ga0070672_100000058 Ga0070672_10000005843 321
67 3300005548 Ga0070665_100090049 Ga0070665_1000900492 321
68 3300005577 Ga0068857_100114166 Ga0068857_1001141664 321
69 3300005616 Ga0068852_100000002 Ga0068852_100000002143 321
70 3300005616 Ga0068852_100109276 Ga0068852_1001092763 321
71 3300006175 Ga0070712_100000820 Ga0070712_1000008208 321
72 3300006881 Ga0068865_100000438 Ga0068865_10000043816 321
73 3300009098 Ga0105245_10000026 Ga0105245_1000002621 321
74 3300009098 Ga0105245_10089126 Ga0105245_100891262 321
75 3300009148 Ga0105243_10020690 Ga0105243_100206902 321
76 3300009177 Ga0105248_10000020 Ga0105248_10000020209 321
77 3300013105 Ga0157369_10000014 Ga0157369_100000145 321
78 3300013308 Ga0157375_10429449 Ga0157375_104294492 321
79 3300014326 Ga0157380_10001764 Ga0157380_100017643 321
80 3300014969 Ga0157376_10020164 Ga0157376_100201644 321
81 3300025903 Ga0207680_10077718 Ga0207680_100777182 321
82 3300025915 Ga0207693_10011264 Ga0207693_100112644 321
83 3300025920 Ga0207649_10000005 Ga0207649_10000005160 321
84 3300025926 Ga0207659_10000014 Ga0207659_1000001461 321
85 3300025927 Ga0207687_10000017 Ga0207687_10000017161 321
86 3300025935 Ga0207709_10011241 Ga0207709_100112412 321
87 3300025938 Ga0207704_10000608 Ga0207704_100006089 321
88 3300025940 Ga0207691_10000284 Ga0207691_1000028442 321
89 3300025941 Ga0207711_10000006 Ga0207711_10000006169 321
90 3300025944 Ga0207661_10001477 Ga0207661_100014775 321
91 3300025944 Ga0207661_10003414 Ga0207661_100034145 321
92 3300026023 Ga0207677_10009051 Ga0207677_100090512 321
93 3300026116 Ga0207674_10055512 Ga0207674_100555124 321
94 3300026142 Ga0207698_10000004 Ga0207698_10000004142 321
95 3300028379 Ga0268266_10000303 Ga0268266_1000030371 321
96 3300028379 Ga0268266_10048471 Ga0268266_100484712 321
97 3300031665 Ga0316575_10003619 Ga0316575_100036194 321
98 3300031691 Ga0316579_10007717 Ga0316579_100077174 321
99 3300031727 Ga0316576_10002136 Ga0316576_100021365 321
100 3300031728 Ga0316578_10099729 Ga0316578_100997292 321
101 3300032126 Ga0307415_100002798 Ga0307415_1000027983 321
102 3300045976 Ga0466967_0000001 Ga0466967_0000001_186130_187095 321
103 3300046459 Ga0495629_0000055 Ga0495629_0000055_63436_64401 321
104 3300046461 Ga0495641_0008113 Ga0495641_0008113_3395_4360 321
105 3300046507 Ga0495606_0000057 Ga0495606_0000057_115581_116546 321
106 3300046517 Ga0495630_0000011 Ga0495630_0000011_123366_124331 321
107 3300046674 Ga0495588_0000250 Ga0495588_0000250_2230_3195 321
108 3300046681 Ga0495647_0002251 Ga0495647_0002251_4926_5891 321
109 3300046690 Ga0495624_0000548 Ga0495624_0000548_23405_24370 321
110 3300047321 Ga0495676_0179610 Ga0495676_0179610_240_1205 321
111 3300048088 Ga0495602_0058839 Ga0495602_0058839_2130_3095 321
112 3300048913 Ga0496110_0202998 Ga0496110_0202998_360_1325 321
113 3300048917 Ga0496114_0069388 Ga0496114_0069388_375_1340 321
114 3300049584 Ga0501068_0082452 Ga0501068_0082452_711_1676 321
115 3300049823 Ga0501044_0085354 Ga0501044_0085354_1459_2424 321
116 3300053078 Ga0495612_0004367 Ga0495612_0004367_1850_2815 321
117 3300053139 Ga0500568_0000043 Ga0500568_0000043_65004_65969 321
118 3300053153 Ga0500616_0000141 Ga0500616_0000141_97858_98823 321
119 3300005331 Ga0070670_100356937 Ga0070670_1003569371 322
120 3300005356 Ga0070674_100268668 Ga0070674_1002686681 322
121 3300005366 Ga0070659_100046534 Ga0070659_1000465343 322
122 3300005459 Ga0068867_100290454 Ga0068867_1002904542 322
123 3300005539 Ga0068853_100138061 Ga0068853_1001380612 322
124 3300005548 Ga0070665_100039516 Ga0070665_1000395163 322
125 3300005577 Ga0068857_100008248 Ga0068857_1000082482 322
126 3300005614 Ga0068856_100001747 Ga0068856_10000174713 322
127 3300005937 Ga0081455_10119281 Ga0081455_101192812 322
128 3300005981 Ga0081538_10027672 Ga0081538_100276722 322
129 3300005981 Ga0081538_10084638 Ga0081538_100846382 322
130 3300006038 Ga0075365_10005768 Ga0075365_100057684 322
131 3300006038 Ga0075365_10069662 Ga0075365_100696623 322
132 3300006048 Ga0075363_100042237 Ga0075363_1000422372 322
133 3300006051 Ga0075364_10005844 Ga0075364_100058442 322
134 3300009148 Ga0105243_10040662 Ga0105243_100406622 322
135 3300009176 Ga0105242_10031173 Ga0105242_100311734 322
136 3300009551 Ga0105238_10305938 Ga0105238_103059382 322
137 3300011119 Ga0105246_10177419 Ga0105246_101774191 322
138 3300013104 Ga0157370_10005465 Ga0157370_1000546510 322
139 3300013306 Ga0163162_10379148 Ga0163162_103791481 322
140 3300013308 Ga0157375_10055378 Ga0157375_100553784 322
141 3300014326 Ga0157380_10022204 Ga0157380_100222044 322
142 3300014326 Ga0157380_10176033 Ga0157380_101760331 322
143 3300020082 Ga0206353_10341763 Ga0206353_103417634 322
144 3300025919 Ga0207657_10131456 Ga0207657_101314562 322
145 3300025924 Ga0207694_10123607 Ga0207694_101236072 322
146 3300025927 Ga0207687_10180345 Ga0207687_101803452 322
147 3300025932 Ga0207690_10249885 Ga0207690_102498851 322
148 3300025934 Ga0207686_10125705 Ga0207686_101257051 322
149 3300025935 Ga0207709_10043357 Ga0207709_100433573 322
150 3300025937 Ga0207669_10242806 Ga0207669_102428061 322
151 3300026041 Ga0207639_10145605 Ga0207639_101456052 322
152 3300026078 Ga0207702_10000076 Ga0207702_1000007642 322
153 3300026089 Ga0207648_10143764 Ga0207648_101437643 322
154 3300026116 Ga0207674_10009187 Ga0207674_100091877 322
155 3300028379 Ga0268266_10064494 Ga0268266_100644942 322
156 3300031852 Ga0307410_10093743 Ga0307410_100937432 322
157 3300031903 Ga0307407_10027067 Ga0307407_100270672 322
158 3300031995 Ga0307409_100114810 Ga0307409_1001148102 322
159 3300032002 Ga0307416_100007507 Ga0307416_1000075075 322
160 3300032126 Ga0307415_100082726 Ga0307415_1000827262 322
161 3300039437 Ga0436365_1218319 Ga0436365_1218319_471_1442 322
162 3300044694 Ga0466963_0056671 Ga0466963_0056671_1340_2308 322
163 3300044842 Ga0466957_0001975 Ga0466957_0001975_8265_9233 322
164 3300046463 Ga0495653_0100079 Ga0495653_0100079_934_1944 322
165 3300046642 Ga0495634_0148323 Ga0495634_0148323_139_1149 322
166 3300046683 Ga0495658_0037974 Ga0495658_0037974_166_1176 322
167 3300047321 Ga0495676_0156560 Ga0495676_0156560_536_1546 322
168 3300047322 Ga0495680_0225299 Ga0495680_0225299_250_1260 322
169 3300048904 Ga0496101_0155387 Ga0496101_0155387_554_1564 322
170 3300048907 Ga0496104_0336908 Ga0496104_0336908_147_1157 322
171 3300048911 Ga0496108_0000063 Ga0496108_0000063_20858_21826 322
172 3300048911 Ga0496108_0044225 Ga0496108_0044225_2232_3242 322
173 3300048912 Ga0496109_0000012 Ga0496109_0000012_90921_91889 322
174 3300048915 Ga0496112_0315171 Ga0496112_0315171_400_1410 322
175 3300048917 Ga0496114_0276314 Ga0496114_0276314_437_1447 322
176 3300050489 nmdc:mga03683_11339_c1 nmdc:mga03683_11339_c1_1181_2152 322
177 3300050490 nmdc:mga03n38_7427_c1 nmdc:mga03n38_7427_c1_1485_2456 322
178 3300050491 nmdc:mga00v17_2268_c1 nmdc:mga00v17_2268_c1_717_1688 322
179 3300050492 nmdc:mga0yw44_147984_c1 nmdc:mga0yw44_147984_c1_500_1471 322
180 3300050492 nmdc:mga0yw44_249667_c1 nmdc:mga0yw44_249667_c1_11_982 322
181 3300050492 nmdc:mga0yw44_51928_c1 nmdc:mga0yw44_51928_c1_915_1886 322
182 3300006051 Ga0075364_10026694 Ga0075364_100266942 323
183 3300009147 Ga0114129_10333724 Ga0114129_103337242 323
184 3300009148 Ga0105243_10225878 Ga0105243_102258782 323
185 3300009176 Ga0105242_10368040 Ga0105242_103680402 323
186 3300025935 Ga0207709_10050741 Ga0207709_100507412 323
187 3300031727 Ga0316576_10065473 Ga0316576_100654732 323
188 3300031727 Ga0316576_10082315 Ga0316576_100823152 323
189 3300031733 Ga0316577_10167801 Ga0316577_101678012 323
190 3300031824 Ga0307413_10170003 Ga0307413_101700032 323
191 3300031852 Ga0307410_10118868 Ga0307410_101188683 323
192 3300031901 Ga0307406_10116320 Ga0307406_101163202 323
193 3300031995 Ga0307409_100098302 Ga0307409_1000983022 323
194 3300032004 Ga0307414_10225946 Ga0307414_102259461 323
195 3300035398 Ga0316574_0044218 Ga0316574_0044218_766_1740 323
196 3300035398 Ga0316574_0202297 Ga0316574_0202297_190_1164 323
197 3300036712 Ga0316584_0044158 Ga0316584_0044158_2326_3300 323
198 3300049568 Ga0501031_0016528 Ga0501031_0016528_2432_3403 323
199 3300049570 Ga0501033_0038239 Ga0501033_0038239_272_1243 323
200 3300049572 Ga0501036_0007457 Ga0501036_0007457_5908_6879 323
201 3300049572 Ga0501036_0029819 Ga0501036_0029819_1015_1986 323
202 3300049573 Ga0501037_0013402 Ga0501037_0013402_1437_2408 323
203 3300049575 Ga0501039_0024970 Ga0501039_0024970_1560_2531 323
204 3300049575 Ga0501039_0038938 Ga0501039_0038938_1848_2819 323
205 3300049576 Ga0501040_0000591 Ga0501040_0000591_7329_8300 323
206 3300049577 Ga0501041_0001943 Ga0501041_0001943_3463_4434 323
207 3300049577 Ga0501041_0053994 Ga0501041_0053994_397_1368 323
208 3300049578 Ga0501042_0000992 Ga0501042_0000992_8873_9844 323
209 3300049578 Ga0501042_0155238 Ga0501042_0155238_470_1441 323
210 3300049579 Ga0501043_0214857 Ga0501043_0214857_452_1423 323
211 3300049580 Ga0501046_0007978 Ga0501046_0007978_5746_6717 323
212 3300049580 Ga0501046_0115980 Ga0501046_0115980_221_1192 323
213 3300049582 Ga0501048_0008826 Ga0501048_0008826_384_1355 323
214 3300049585 Ga0501069_0122003 Ga0501069_0122003_444_1415 323
215 3300049586 Ga0501070_0030849 Ga0501070_0030849_2754_3725 323
216 3300049587 Ga0501071_0001338 Ga0501071_0001338_7477_8448 323
217 3300049587 Ga0501071_0094306 Ga0501071_0094306_441_1412 323
218 3300049588 Ga0501072_0001391 Ga0501072_0001391_9891_10862 323
219 3300049588 Ga0501072_0088207 Ga0501072_0088207_953_1924 323
220 3300049590 Ga0501074_0001102 Ga0501074_0001102_2017_2988 323
221 3300049590 Ga0501074_0284112 Ga0501074_0284112_61_1032 323
222 3300049591 Ga0501075_0006998 Ga0501075_0006998_2013_2984 323
223 3300049591 Ga0501075_0177374 Ga0501075_0177374_417_1388 323
224 3300049592 Ga0501076_0002217 Ga0501076_0002217_4162_5133 323
225 3300049593 Ga0501077_0005639 Ga0501077_0005639_3403_4374 323
226 3300049743 Ga0501081_0000480 Ga0501081_0000480_6710_7681 323
227 3300049743 Ga0501081_0058761 Ga0501081_0058761_1080_2051 323
228 3300049744 Ga0501083_0114817 Ga0501083_0114817_552_1523 323
229 3300049822 Ga0501035_0330551 Ga0501035_0330551_31_1002 323
230 3300049824 Ga0501045_0000837 Ga0501045_0000837_8254_9225 323
231 3300049824 Ga0501045_0095251 Ga0501045_0095251_966_1937 323
232 3300050491 nmdc:mga00v17_18998_c1 nmdc:mga00v17_18998_c1_2111_3082 323
233 3300050507 nmdc:mga05p37_112101_c1 nmdc:mga05p37_112101_c1_1202_2224 323
234 3300054114 Ga0501084_0017167 Ga0501084_0017167_4591_5562 323
235 3300054114 Ga0501084_0057738 Ga0501084_0057738_846_1817 323
236 3300060353 Ga0501082_0006187 Ga0501082_0006187_2071_3042 323
237 3300061734 Ga0530510_0026633 Ga0530510_0026633_451_1422 323
238 3300061734 Ga0530510_0037255 Ga0530510_0037255_205_1176 323
239 3300061734 Ga0530510_0175515 Ga0530510_0175515_27_998 323
240 3300005329 Ga0070683_100080615 Ga0070683_1000806152 324
241 3300005338 Ga0068868_100173691 Ga0068868_1001736912 324
242 3300005344 Ga0070661_100141715 Ga0070661_1001417152 324
243 3300009098 Ga0105245_10052165 Ga0105245_100521652 324
244 3300009098 Ga0105245_10087176 Ga0105245_100871762 324
245 3300009148 Ga0105243_10000243 Ga0105243_1000024348 324
246 3300009553 Ga0105249_10384370 Ga0105249_103843702 324
247 3300011119 Ga0105246_10087806 Ga0105246_100878063 324
248 3300013308 Ga0157375_10001577 Ga0157375_100015778 324
249 3300014325 Ga0163163_10151582 Ga0163163_101515822 324
250 3300014325 Ga0163163_10247245 Ga0163163_102472452 324
251 3300025927 Ga0207687_10044531 Ga0207687_100445312 324
252 3300025927 Ga0207687_10054755 Ga0207687_100547553 324
253 3300025961 Ga0207712_10263217 Ga0207712_102632172 324
254 3300044842 Ga0466957_0030794 Ga0466957_0030794_1128_2117 324
255 3300045836 Ga0466958_0025718 Ga0466958_0025718_1597_2586 324
256 3300048905 Ga0496102_0140313 Ga0496102_0140313_397_1371 324
257 3300048907 Ga0496104_0183248 Ga0496104_0183248_761_1735 324
258 3300048908 Ga0496105_0277142 Ga0496105_0277142_140_1114 324
259 3300048909 Ga0496106_0254190 Ga0496106_0254190_56_1030 324
260 3300048910 Ga0496107_0163892 Ga0496107_0163892_40_1014 324
261 3300048911 Ga0496108_0031072 Ga0496108_0031072_58_1032 324
262 3300048912 Ga0496109_0121713 Ga0496109_0121713_228_1202 324
263 3300048914 Ga0496111_0126618 Ga0496111_0126618_678_1652 324
264 3300048915 Ga0496112_0182473 Ga0496112_0182473_705_1679 324
265 3300048917 Ga0496114_0019850 Ga0496114_0019850_4274_5248 324
266 3300005615 Ga0070702_100042001 Ga0070702_1000420013 325
267 3300009148 Ga0105243_10062971 Ga0105243_100629712 325
268 3300009176 Ga0105242_10015689 Ga0105242_100156892 325
269 3300009553 Ga0105249_10000033 Ga0105249_10000033169 325
270 3300013297 Ga0157378_10004034 Ga0157378_1000403410 325
271 3300013306 Ga0163162_10043599 Ga0163162_100435995 325
272 3300014968 Ga0157379_10021687 Ga0157379_100216874 325
273 3300017792 Ga0163161_10019211 Ga0163161_100192113 325
274 3300025934 Ga0207686_10013594 Ga0207686_100135943 325
275 3300025935 Ga0207709_10119815 Ga0207709_101198152 325
276 3300048904 Ga0496101_0201667 Ga0496101_0201667_122_1183 325
277 3300048919 Ga0496116_0016759 Ga0496116_0016759_3684_4745 325
278 3300048923 Ga0496120_0017702 Ga0496120_0017702_332_1393 325
279 3300048928 Ga0496125_0081658 Ga0496125_0081658_288_1349 325
280 3300048929 Ga0496126_0024569 Ga0496126_0024569_4391_5452 325
281 3300005543 Ga0070672_100260295 Ga0070672_1002602952 326
282 3300009148 Ga0105243_10136858 Ga0105243_101368582 326
283 3300013307 Ga0157372_10035360 Ga0157372_100353601 326
284 3300014325 Ga0163163_10237356 Ga0163163_102373562 326
285 3300014325 Ga0163163_10371033 Ga0163163_103710332 326
286 3300014326 Ga0157380_10018827 Ga0157380_100188272 326
287 3300017792 Ga0163161_10196839 Ga0163161_101968392 326
288 3300036647 Ga0316582_0001056 Ga0316582_0001056_692_1678 326
289 3300036712 Ga0316584_0071820 Ga0316584_0071820_1416_2402 326
290 3300041512 Ga0451853_0626216 Ga0451853_0626216_92_1078 326
291 3300042014 Ga0439457_019133 Ga0439457_019133_151_1164 326
292 3300048911 Ga0496108_0007785 Ga0496108_0007785_5971_6984 326
293 3300048912 Ga0496109_0040675 Ga0496109_0040675_805_1818 326
294 3300048913 Ga0496110_0112279 Ga0496110_0112279_899_1912 326
295 3300048914 Ga0496111_0025528 Ga0496111_0025528_1662_2675 326
296 3300048917 Ga0496114_0006498 Ga0496114_0006498_8098_9111 326
297 3300005441 Ga0070700_100287388 Ga0070700_1002873881 327
298 3300009553 Ga0105249_10169647 Ga0105249_101696473 327
299 3300013308 Ga0157375_10226668 Ga0157375_102266681 327
300 3300014745 Ga0157377_10269056 Ga0157377_102690561 327
301 3300025940 Ga0207691_10427186 Ga0207691_104271861 327
302 3300025944 Ga0207661_10086700 Ga0207661_100867002 327
303 3300026075 Ga0207708_10349216 Ga0207708_103492162 327
304 3300049572 Ga0501036_0135755 Ga0501036_0135755_15_1004 329
305 3300049576 Ga0501040_0347626 Ga0501040_0347626_46_1035 329
306 3300049741 Ga0501079_0177368 Ga0501079_0177368_577_1566 329
307 3300054114 Ga0501084_0114638 Ga0501084_0114638_1203_2192 329
308 3300054114 Ga0501084_0182762 Ga0501084_0182762_145_1134 329
309 3300060353 Ga0501082_0262581 Ga0501082_0262581_42_1031 329
310 3300009093 Ga0105240_10425906 Ga0105240_104259062 330
311 3300013308 Ga0157375_10161269 Ga0157375_101612694 330
312 3300048929 Ga0496126_0000086 Ga0496126_0000086_7651_8655 330
313 3300005563 Ga0068855_100078275 Ga0068855_1000782752 331
314 3300006048 Ga0075363_100013998 Ga0075363_1000139982 331
315 3300006178 Ga0075367_10059872 Ga0075367_100598722 331
316 3300025949 Ga0207667_10129996 Ga0207667_101299962 331
317 3300048905 Ga0496102_0011010 Ga0496102_0011010_1933_2979 331
318 3300050490 nmdc:mga03n38_41067_c1 nmdc:mga03n38_41067_c1_853_1905 331
319 3300050491 nmdc:mga00v17_150033_c1 nmdc:mga00v17_150033_c1_112_1164 331
320 3300005834 Ga0068851_10006925 Ga0068851_100069252 332
321 3300006048 Ga0075363_100026645 Ga0075363_1000266452 332
322 3300025321 Ga0207656_10027785 Ga0207656_100277852 332
323 3300048911 Ga0496108_0008040 Ga0496108_0008040_5181_6191 332
324 3300048912 Ga0496109_0000039 Ga0496109_0000039_128132_129142 332
325 3300025303 Ga0209051_1008278 Ga0209051_10082782 333
326 3300046455 Ga0495603_0101113 Ga0495603_0101113_180_1181 333
327 3300046461 Ga0495641_0065344 Ga0495641_0065344_412_1413 333
328 3300046517 Ga0495630_0124021 Ga0495630_0124021_896_1897 333
329 3300046690 Ga0495624_0088842 Ga0495624_0088842_830_1831 333
330 3300047673 Ga0495593_0036745 Ga0495593_0036745_1183_2184 333
331 3300048912 Ga0496109_0021646 Ga0496109_0021646_2315_3316 333
332 3300048915 Ga0496112_0014300 Ga0496112_0014300_4389_5390 333
333 3300050490 nmdc:mga03n38_9131_c1 nmdc:mga03n38_9131_c1_1428_2429 333
334 3300050491 nmdc:mga00v17_30398_c1 nmdc:mga00v17_30398_c1_566_1567 333
335 3300005353 Ga0070669_100005932 Ga0070669_1000059327 334
336 3300005367 Ga0070667_100000107 Ga0070667_10000010763 334
337 3300005548 Ga0070665_100006601 Ga0070665_1000066017 334
338 3300005617 Ga0068859_100005604 Ga0068859_1000056044 334
339 3300005841 Ga0068863_100000833 Ga0068863_1000008335 334
340 3300005842 Ga0068858_100009472 Ga0068858_1000094722 334
341 3300005843 Ga0068860_100000174 Ga0068860_10000017430 334
342 3300005844 Ga0068862_100000019 Ga0068862_100000019190 334
343 3300006931 Ga0097620_100005604 Ga0097620_1000056044 334
344 3300009101 Ga0105247_10000023 Ga0105247_1000002328 334
345 3300009177 Ga0105248_10000557 Ga0105248_1000055712 334
346 3300025900 Ga0207710_10000010 Ga0207710_10000010421 334
347 3300025900 Ga0207710_10000027 Ga0207710_10000027285 334
348 3300025923 Ga0207681_10005429 Ga0207681_100054293 334
349 3300025927 Ga0207687_10282473 Ga0207687_102824731 334
350 3300025941 Ga0207711_10000089 Ga0207711_1000008983 334
351 3300025961 Ga0207712_10000031 Ga0207712_1000003129 334
352 3300025986 Ga0207658_10005658 Ga0207658_100056587 334
353 3300026035 Ga0207703_10012404 Ga0207703_100124042 334
354 3300026088 Ga0207641_10001166 Ga0207641_1000116624 334
355 3300028379 Ga0268266_10005480 Ga0268266_100054807 334
356 3300028380 Ga0268265_10000029 Ga0268265_10000029187 334
357 3300028381 Ga0268264_10000236 Ga0268264_1000023662 334
358 3300048905 Ga0496102_0000205 Ga0496102_0000205_26309_27400 334
359 3300048906 Ga0496103_0000315 Ga0496103_0000315_17216_18307 334
360 3300048906 Ga0496103_0097664 Ga0496103_0097664_216_1229 334
361 3300048910 Ga0496107_0145552 Ga0496107_0145552_516_1607 334
362 3300048913 Ga0496110_0004671 Ga0496110_0004671_1559_2572 334
363 3300048916 Ga0496113_0017684 Ga0496113_0017684_1839_2852 334
364 3300048920 Ga0496117_0000725 Ga0496117_0000725_24384_25475 334
365 3300048921 Ga0496118_0002778 Ga0496118_0002778_13848_14939 334
366 3300048922 Ga0496119_0001488 Ga0496119_0001488_20318_21409 334
367 3300048924 Ga0496121_0012317 Ga0496121_0012317_1572_2663 334
368 3300041410 Ga0439461_0000939 Ga0439461_0000939_1371_2471 337
369 3300041411 Ga0439466_0001646 Ga0439466_0001646_6461_7561 337
370 3300003792 Ga0055540_1000052 Ga0055540_100005222 338
371 3300026067 Ga0207678_10147491 Ga0207678_101474911 338
372 3300006048 Ga0075363_100037653 Ga0075363_1000376533 343
373 3300006038 Ga0075365_10014420 Ga0075365_100144202 349
374 3300050492 nmdc:mga0yw44_6702_c1 nmdc:mga0yw44_6702_c1_190_1293 349
375 iso_pu_bacteria 2731639228 2731908232 349
376 iso_pu_bacteria 2565956761 2566997381 350
377 iso_pu_bacteria 2738541308 2738888068 350
378 iso_pu_bacteria 2751185725 2753039132 351
379 iso_pu_bacteria 2751185792 2753327643 351
380 iso_pu_bacteria 2799112218 2799185460 351
381 3300006051 Ga0075364_10056190 Ga0075364_100561902 353
382 3300049571 Ga0501034_0278194 Ga0501034_0278194_397_1458 353
383 3300050491 nmdc:mga00v17_21912_c1 nmdc:mga00v17_21912_c1_1833_2930 353
384 3300050496 nmdc:mga07m45_206863_c1 nmdc:mga07m45_206863_c1_36_1097 353
385 iso_pu_bacteria 2738543011 2739238530 353
386 iso_pu_bacteria 2889300758 2889302964 353
387 iso_pu_bacteria 2904535858 2904538310 353
388 iso_pu_bacteria 2922554459 2922557502 353
389 iso_pu_bacteria 2939743619 2939746158 353
390 3300046616 Ga0495668_0000704 Ga0495668_0000704_17264_18334 354
391 3300048911 Ga0496108_0008307 Ga0496108_0008307_7214_8284 354
392 3300048928 Ga0496125_0030306 Ga0496125_0030306_57_1127 354
393 iso_pu_bacteria 2551306166 2552110323 354
394 3300025935 Ga0207709_10003252 Ga0207709_100032526 357
395 3300047315 Ga0495581_0029664 Ga0495581_0029664_1614_2693 357
396 3300048920 Ga0496117_0049427 Ga0496117_0049427_159_1232 357
397 iso_pu_bacteria 2738543034 2739366118 357
398 iso_pu_bacteria 2506783011 2506868916 358
399 iso_pu_bacteria 2773857933 2774901669 358
400 3300044842 Ga0466957_0008765 Ga0466957_0008765_1331_2539 364
401 3300005337 Ga0070682_100045256 Ga0070682_1000452562 366
402 3300005345 Ga0070692_10091152 Ga0070692_100911521 366
403 3300026121 Ga0207683_10353137 Ga0207683_103531371 366
404 3300001989 JGI24739J22299_10033023 JGI24739J22299_100330231 367
405 3300006038 Ga0075365_10179592 Ga0075365_101795922 367
406 3300006048 Ga0075363_100048473 Ga0075363_1000484732 367
407 3300006051 Ga0075364_10063553 Ga0075364_100635532 367
408 3300006051 Ga0075364_10140250 Ga0075364_101402502 367
409 3300009177 Ga0105248_10377021 Ga0105248_103770211 367
410 3300053730 Ga0500645_000027 Ga0500645_000027_25289_26395 367

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01544

CorA

CorA-like Mg2+ transporter protein

102

397

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4eeb-assembly1.cif.gz_C cora coiled-coil mutant under mg2+ absence 0.8361 38 363
3nvo-assembly1.cif.gz_A the soluble domain structure of the zntb zn2+ efflux system 0.8212 35 303
4eeb-assembly1.cif.gz_C cora coiled-coil mutant under mg2+ absence 0.8171 38 363
4egw-assembly1.cif.gz_B the structure of the soluble domain of cora from methanocaldococcus jannaschii 0.8141 34 297
3nvo-assembly2.cif.gz_B-2 the soluble domain structure of the zntb zn2+ efflux system 0.8043 29 297
ID Description Score Start End Superfamily
af_O50455_48_179_3.30.460.20 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;CorA soluble domain-like 0.997 49 180 3.30.460.20
af_O50455_48_179_3.30.460.20 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;CorA soluble domain-like 0.9895 49 180 3.30.460.20
af_O50455_180_293_1.20.58.340 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.9857 181 293 1.20.58.340
af_O50455_180_293_1.20.58.340 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.9687 181 293 1.20.58.340
af_Q58439_132_258_1.20.58.340 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.9355 185 307 1.20.58.340
ID Description Score Start End GO Terms
AF-X8DYD1-F1-model_v4 CorA-like Mg2+ transporter family protein 0.9797 51 181 GO:0000287
GO:0005886
GO:0015087
GO:0015095
GO:0050897
AF-A0A7Y3G1W9-F1-model_v4 Magnesium and cobalt transport protein CorA 0.9446 35 335 GO:0000287
GO:0005886
GO:0015087
GO:0015095
GO:0050897
AF-X8DYD1-F1-model_v4 CorA-like Mg2+ transporter family protein 0.9442 51 181 GO:0000287
GO:0005886
GO:0015087
GO:0015095
GO:0050897
AF-A0A3C2BVY7-F1-model_v4 Transporter 0.9427 34 257 GO:0000287
GO:0005886
GO:0015087
GO:0015095
GO:0050897
AF-A0A529L5Y1-F1-model_v4 Magnesium transporter 0.9393 71 288 GO:0000287
GO:0005886
GO:0015087
GO:0015095
GO:0050897

Feature Viewer

pLDDT pTM Quality
86.31 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map