F437252
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 410 | 220 | 820 | 167 |
Family's Representative Sequence
| Representative Sequence | 3300014497|Ga0182008_10142139|Ga0182008_101421392 |
| Length | 188 |
| Sequence | MVLMPHSFLDVCYALQLSMKKQLYGELSQDGQSLSSPSAEQLRCWRLFFESAMALLDVLDAELERDAGISQRWYDVLVHLEESPNGVPMTALADRILYSKSGFTRVVDRMEEAGLIQRVRPENDRRTILVVLTETGAATLLRARSYHRDGIDRHFAQHLTDADVKALTKALEKVSAHARPLRPGRIRS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 25 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 43 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 44 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 45 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 47 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 48 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 49 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 50 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 52 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 70 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 71 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 72 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 73 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 74 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 75 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 109 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 110 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 111 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 112 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 113 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 114 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 115 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 116 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 117 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 118 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 119 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 120 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 121 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 122 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 123 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 124 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 125 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 126 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 127 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 128 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 129 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 130 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 131 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 132 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 133 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 134 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 135 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 136 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 137 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 138 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 139 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 194 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 195 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 196 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 197 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 198 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 199 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 200 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 201 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 202 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 204 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 205 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 206 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 207 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 208 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 209 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 213 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 214 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 220 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.54 |
| Metatranscriptomes | 1.46 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 10.24 |
| Rhizosphere | 88.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 26.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0182008_10142139 | 3300014497 | Bacteria | 1201 |
| 2 | JGI24751J29686_10030857 | 3300002459 | Unclassified | 1112 |
| 3 | Ga0070658_11119918 | 3300005327 | Unclassified | 685 |
| 4 | Ga0070683_100005793 | 3300005329 | Bacteria | 10333 |
| 5 | Ga0070683_100023023 | 3300005329 | Bacteria | 5571 |
| 6 | Ga0070683_100306992 | 3300005329 | Bacteria | 1509 |
| 7 | Ga0070680_100007771 | 3300005336 | Bacteria | 8173 |
| 8 | Ga0070682_100089166 | 3300005337 | Bacteria | 2014 |
| 9 | Ga0070682_100196915 | 3300005337 | Bacteria | 1419 |
| 10 | Ga0070682_100529093 | 3300005337 | Bacteria | 918 |
| 11 | Ga0070660_100000326 | 3300005339 | Bacteria | 31349 |
| 12 | Ga0070660_100041032 | 3300005339 | Bacteria | 3525 |
| 13 | Ga0070660_100128474 | 3300005339 | Bacteria | 2026 |
| 14 | Ga0070661_100017362 | 3300005344 | Bacteria | 5105 |
| 15 | Ga0070661_100028244 | 3300005344 | Bacteria | 4045 |
| 16 | Ga0070661_100095991 | 3300005344 | Unclassified | 2199 |
| 17 | Ga0070675_100077141 | 3300005354 | Bacteria | 2773 |
| 18 | Ga0070674_100005842 | 3300005356 | Bacteria | 7153 |
| 19 | Ga0070673_100600130 | 3300005364 | Bacteria | 1004 |
| 20 | Ga0070659_100246113 | 3300005366 | Unclassified | 1481 |
| 21 | Ga0070659_100261326 | 3300005366 | Unclassified | 1436 |
| 22 | Ga0070659_100654652 | 3300005366 | Bacteria | 906 |
| 23 | Ga0070667_100024822 | 3300005367 | Bacteria | 4981 |
| 24 | Ga0070709_10081122 | 3300005434 | Bacteria | 2116 |
| 25 | Ga0070714_100069403 | 3300005435 | Bacteria | 3043 |
| 26 | Ga0070714_100428123 | 3300005435 | Bacteria | 1254 |
| 27 | Ga0070714_100643171 | 3300005435 | Unclassified | 1020 |
| 28 | Ga0070713_100072543 | 3300005436 | Bacteria | 2912 |
| 29 | Ga0070713_100085895 | 3300005436 | Unclassified | 2696 |
| 30 | Ga0070713_100816304 | 3300005436 | Bacteria | 894 |
| 31 | Ga0070710_10151285 | 3300005437 | Unclassified | 1431 |
| 32 | Ga0070711_100026609 | 3300005439 | Bacteria | 3792 |
| 33 | Ga0070705_101132033 | 3300005440 | Unclassified | 642 |
| 34 | Ga0070708_100018651 | 3300005445 | Bacteria | 5808 |
| 35 | Ga0070708_100135289 | 3300005445 | Bacteria | 2282 |
| 36 | Ga0070708_100218252 | 3300005445 | Unclassified | 1788 |
| 37 | Ga0070663_100473650 | 3300005455 | Bacteria | 1036 |
| 38 | Ga0070678_100074269 | 3300005456 | Bacteria | 2555 |
| 39 | Ga0070681_10000927 | 3300005458 | Bacteria | 24715 |
| 40 | Ga0070681_10012019 | 3300005458 | Bacteria | 8584 |
| 41 | Ga0070681_10027103 | 3300005458 | Bacteria | 5761 |
| 42 | Ga0070681_10658697 | 3300005458 | Bacteria | 962 |
| 43 | Ga0070681_11010008 | 3300005458 | Bacteria | 752 |
| 44 | Ga0068867_101018256 | 3300005459 | Bacteria | 752 |
| 45 | Ga0070706_100066310 | 3300005467 | Bacteria | 3339 |
| 46 | Ga0070706_100395187 | 3300005467 | Bacteria | 1287 |
| 47 | Ga0070707_100005772 | 3300005468 | Bacteria | 11544 |
| 48 | Ga0070707_100244662 | 3300005468 | Bacteria | 1746 |
| 49 | Ga0070698_100028358 | 3300005471 | Bacteria | 5815 |
| 50 | Ga0070698_100191366 | 3300005471 | Unclassified | 1983 |
| 51 | Ga0070698_100219160 | 3300005471 | Unclassified | 1837 |
| 52 | Ga0070698_100409613 | 3300005471 | Unclassified | 1290 |
| 53 | Ga0070698_100925835 | 3300005471 | Bacteria | 818 |
| 54 | Ga0070699_100124066 | 3300005518 | Bacteria | 2273 |
| 55 | Ga0070699_100303135 | 3300005518 | Bacteria | 1433 |
| 56 | Ga0070679_100010290 | 3300005530 | Bacteria | 8864 |
| 57 | Ga0070679_100015227 | 3300005530 | Bacteria | 7387 |
| 58 | Ga0070679_100050040 | 3300005530 | Bacteria | 4162 |
| 59 | Ga0070684_100004737 | 3300005535 | Bacteria | 10389 |
| 60 | Ga0070684_100591188 | 3300005535 | Unclassified | 1032 |
| 61 | Ga0070684_100643593 | 3300005535 | Bacteria | 987 |
| 62 | Ga0070697_100097311 | 3300005536 | Bacteria | 2442 |
| 63 | Ga0068853_100173202 | 3300005539 | Unclassified | 1953 |
| 64 | Ga0068853_101422584 | 3300005539 | Unclassified | 671 |
| 65 | Ga0070672_100235515 | 3300005543 | Bacteria | 1539 |
| 66 | Ga0070696_100067011 | 3300005546 | Bacteria | 2519 |
| 67 | Ga0070665_100021630 | 3300005548 | Bacteria | 6468 |
| 68 | Ga0068855_100004092 | 3300005563 | Bacteria | 17784 |
| 69 | Ga0068855_100074781 | 3300005563 | Bacteria | 3934 |
| 70 | Ga0068855_100077326 | 3300005563 | Bacteria | 3861 |
| 71 | Ga0070664_100025282 | 3300005564 | Unclassified | 4921 |
| 72 | Ga0068857_100003795 | 3300005577 | Bacteria | 12715 |
| 73 | Ga0068857_100083049 | 3300005577 | Bacteria | 2861 |
| 74 | Ga0068856_100067516 | 3300005614 | Bacteria | 3534 |
| 75 | Ga0068856_100155880 | 3300005614 | Bacteria | 2294 |
| 76 | Ga0070702_100324556 | 3300005615 | Unclassified | 1074 |
| 77 | Ga0068859_101765974 | 3300005617 | Bacteria | 683 |
| 78 | Ga0068866_10394914 | 3300005718 | Unclassified | 890 |
| 79 | Ga0068858_100395837 | 3300005842 | Bacteria | 1327 |
| 80 | Ga0081538_10004223 | 3300005981 | Bacteria | 13337 |
| 81 | Ga0070712_100102472 | 3300006175 | Bacteria | 2120 |
| 82 | Ga0070712_101323457 | 3300006175 | Bacteria | 628 |
| 83 | Ga0068871_100279861 | 3300006358 | Unclassified | 1459 |
| 84 | Ga0068871_100446257 | 3300006358 | Bacteria | 1159 |
| 85 | Ga0075433_10196239 | 3300006852 | Bacteria | 1795 |
| 86 | Ga0075434_100239719 | 3300006871 | Bacteria | 1833 |
| 87 | Ga0075436_100993669 | 3300006914 | Bacteria | 630 |
| 88 | Ga0097620_101765902 | 3300006931 | Bacteria | 683 |
| 89 | Ga0075435_100238962 | 3300007076 | Bacteria | 1544 |
| 90 | Ga0105240_10079497 | 3300009093 | Bacteria | 4035 |
| 91 | Ga0105240_10123076 | 3300009093 | Bacteria | 3121 |
| 92 | Ga0105240_11025634 | 3300009093 | Bacteria | 881 |
| 93 | Ga0105245_10429753 | 3300009098 | Bacteria | 1325 |
| 94 | Ga0105245_10624010 | 3300009098 | Unclassified | 1106 |
| 95 | Ga0105243_10055633 | 3300009148 | Bacteria | 3144 |
| 96 | Ga0105241_10321696 | 3300009174 | Bacteria | 1334 |
| 97 | Ga0105241_11404987 | 3300009174 | Bacteria | 668 |
| 98 | Ga0105237_10038102 | 3300009545 | Bacteria | 4856 |
| 99 | Ga0105238_10055783 | 3300009551 | Bacteria | 3965 |
| 100 | Ga0105238_10106962 | 3300009551 | Unclassified | 2778 |
| 101 | Ga0105238_10319170 | 3300009551 | Bacteria | 1539 |
| 102 | Ga0105238_11686653 | 3300009551 | Unclassified | 665 |
| 103 | Ga0105239_10039103 | 3300010375 | Bacteria | 5197 |
| 104 | Ga0105239_10351226 | 3300010375 | Bacteria | 1665 |
| 105 | Ga0105239_10532844 | 3300010375 | Bacteria | 1337 |
| 106 | Ga0105246_10131863 | 3300011119 | Bacteria | 1867 |
| 107 | Ga0105246_10969181 | 3300011119 | Bacteria | 768 |
| 108 | Ga0157373_10195694 | 3300013100 | Bacteria | 1425 |
| 109 | Ga0157373_10417685 | 3300013100 | Bacteria | 963 |
| 110 | Ga0157371_10263989 | 3300013102 | Bacteria | 1242 |
| 111 | Ga0157370_10026439 | 3300013104 | Bacteria | 5731 |
| 112 | Ga0157370_10042728 | 3300013104 | Bacteria | 4366 |
| 113 | Ga0157370_10187481 | 3300013104 | Bacteria | 1920 |
| 114 | Ga0157370_10272882 | 3300013104 | Unclassified | 1562 |
| 115 | Ga0157370_10273905 | 3300013104 | Bacteria | 1559 |
| 116 | Ga0157369_10020760 | 3300013105 | Bacteria | 7342 |
| 117 | Ga0157369_11343724 | 3300013105 | Bacteria | 728 |
| 118 | Ga0157374_10253720 | 3300013296 | Bacteria | 1731 |
| 119 | Ga0157378_11124778 | 3300013297 | Bacteria | 823 |
| 120 | Ga0157372_10034496 | 3300013307 | Bacteria | 5562 |
| 121 | Ga0157372_10136688 | 3300013307 | Bacteria | 2823 |
| 122 | Ga0157372_10369123 | 3300013307 | Bacteria | 1672 |
| 123 | Ga0157372_11914355 | 3300013307 | Unclassified | 682 |
| 124 | Ga0157375_10704017 | 3300013308 | Unclassified | 1164 |
| 125 | Ga0182008_10002491 | 3300014497 | Bacteria | 11505 |
| 126 | Ga0157376_11130337 | 3300014969 | Unclassified | 810 |
| 127 | Ga0182006_1067001 | 3300015261 | Bacteria | 1340 |
| 128 | Ga0182007_10040600 | 3300015262 | Bacteria | 1553 |
| 129 | Ga0206356_11699489 | 3300020070 | Bacteria | 2103 |
| 130 | Ga0206356_11856608 | 3300020070 | Bacteria | 2793 |
| 131 | Ga0206349_1467375 | 3300020075 | Unclassified | 826 |
| 132 | Ga0206354_10355131 | 3300020081 | Bacteria | 1052 |
| 133 | Ga0206354_11338570 | 3300020081 | Unclassified | 623 |
| 134 | Ga0213874_10179509 | 3300021377 | Unclassified | 753 |
| 135 | Ga0207685_10676554 | 3300025905 | Unclassified | 560 |
| 136 | Ga0207705_10051656 | 3300025909 | Bacteria | 2959 |
| 137 | Ga0207705_10135198 | 3300025909 | Unclassified | 1837 |
| 138 | Ga0207705_10508319 | 3300025909 | Bacteria | 936 |
| 139 | Ga0207684_10278790 | 3300025910 | Bacteria | 1442 |
| 140 | Ga0207654_11026440 | 3300025911 | Bacteria | 600 |
| 141 | Ga0207707_10014419 | 3300025912 | Bacteria | 6884 |
| 142 | Ga0207707_10019609 | 3300025912 | Bacteria | 5902 |
| 143 | Ga0207707_10037349 | 3300025912 | Bacteria | 4245 |
| 144 | Ga0207707_10133377 | 3300025912 | Unclassified | 2172 |
| 145 | Ga0207707_10236959 | 3300025912 | Bacteria | 1587 |
| 146 | Ga0207707_10273128 | 3300025912 | Bacteria | 1465 |
| 147 | Ga0207707_10801160 | 3300025912 | Bacteria | 785 |
| 148 | Ga0207695_10355171 | 3300025913 | Bacteria | 1352 |
| 149 | Ga0207693_10103931 | 3300025915 | Unclassified | 2228 |
| 150 | Ga0207693_10388093 | 3300025915 | Bacteria | 1092 |
| 151 | Ga0207693_10744134 | 3300025915 | Bacteria | 758 |
| 152 | Ga0207663_10322997 | 3300025916 | Bacteria | 1160 |
| 153 | Ga0207660_10040934 | 3300025917 | Bacteria | 3246 |
| 154 | Ga0207660_10072769 | 3300025917 | Bacteria | 2504 |
| 155 | Ga0207660_11086049 | 3300025917 | Bacteria | 652 |
| 156 | Ga0207657_10001525 | 3300025919 | Bacteria | 24807 |
| 157 | Ga0207657_10002132 | 3300025919 | Bacteria | 21433 |
| 158 | Ga0207657_10016890 | 3300025919 | Bacteria | 7022 |
| 159 | Ga0207657_10050120 | 3300025919 | Bacteria | 3634 |
| 160 | Ga0207649_10059873 | 3300025920 | Bacteria | 2391 |
| 161 | Ga0207652_10005433 | 3300025921 | Bacteria | 10341 |
| 162 | Ga0207652_10032305 | 3300025921 | Bacteria | 4398 |
| 163 | Ga0207652_10190464 | 3300025921 | Unclassified | 1845 |
| 164 | Ga0207646_10113718 | 3300025922 | Bacteria | 2430 |
| 165 | Ga0207646_10491669 | 3300025922 | Bacteria | 1106 |
| 166 | Ga0207694_10098249 | 3300025924 | Bacteria | 2317 |
| 167 | Ga0207659_10275617 | 3300025926 | Bacteria | 1373 |
| 168 | Ga0207687_10403912 | 3300025927 | Unclassified | 1124 |
| 169 | Ga0207687_10509747 | 3300025927 | Bacteria | 1005 |
| 170 | Ga0207687_10703645 | 3300025927 | Bacteria | 858 |
| 171 | Ga0207664_10001849 | 3300025929 | Bacteria | 13962 |
| 172 | Ga0207690_10186308 | 3300025932 | Bacteria | 1566 |
| 173 | Ga0207709_10051125 | 3300025935 | Bacteria | 2531 |
| 174 | Ga0207669_10028364 | 3300025937 | Bacteria | 3079 |
| 175 | Ga0207691_10547662 | 3300025940 | Unclassified | 981 |
| 176 | Ga0207661_10022184 | 3300025944 | Bacteria | 4775 |
| 177 | Ga0207679_10543030 | 3300025945 | Unclassified | 1042 |
| 178 | Ga0207679_10672997 | 3300025945 | Bacteria | 937 |
| 179 | Ga0207667_10036994 | 3300025949 | Bacteria | 5223 |
| 180 | Ga0207667_10156621 | 3300025949 | Unclassified | 2343 |
| 181 | Ga0207667_10490755 | 3300025949 | Bacteria | 1246 |
| 182 | Ga0207712_10650779 | 3300025961 | Bacteria | 916 |
| 183 | Ga0207658_10033480 | 3300025986 | Unclassified | 3666 |
| 184 | Ga0207703_10686996 | 3300026035 | Bacteria | 973 |
| 185 | Ga0207678_10168509 | 3300026067 | Bacteria | 1870 |
| 186 | Ga0207702_10067145 | 3300026078 | Bacteria | 3077 |
| 187 | Ga0207702_10098314 | 3300026078 | Bacteria | 2578 |
| 188 | Ga0207648_10873698 | 3300026089 | Unclassified | 839 |
| 189 | Ga0207674_10004404 | 3300026116 | Bacteria | 16967 |
| 190 | Ga0207674_10009150 | 3300026116 | Bacteria | 11360 |
| 191 | Ga0207674_10009988 | 3300026116 | Bacteria | 10803 |
| 192 | Ga0207674_10132111 | 3300026116 | Unclassified | 2459 |
| 193 | Ga0207683_10045619 | 3300026121 | Bacteria | 3833 |
| 194 | Ga0268266_10311815 | 3300028379 | Bacteria | 1470 |
| 195 | Ga0307408_100633253 | 3300031548 | Bacteria | 954 |
| 196 | Ga0307405_10261032 | 3300031731 | Unclassified | 1294 |
| 197 | Ga0307416_100196484 | 3300032002 | Bacteria | 1909 |
| 198 | Ga0373926_0121168 | 3300035083 | Bacteria | 986 |
| 199 | Ga0373944_0021031 | 3300035089 | Unclassified | 1885 |
| 200 | Ga0373936_0012963 | 3300035113 | Unclassified | 3179 |
| 201 | Ga0373945_0034251 | 3300035116 | Unclassified | 1809 |
| 202 | Ga0373954_0345426 | 3300035118 | Unclassified | 735 |
| 203 | Ga0373956_0424969 | 3300035119 | Bacteria | 634 |
| 204 | Ga0373943_0000091 | 3300035170 | Bacteria | 33188 |
| 205 | Ga0373946_0011612 | 3300035171 | Unclassified | 3290 |
| 206 | Ga0373955_0359155 | 3300035172 | Bacteria | 883 |
| 207 | Ga0373924_0047576 | 3300035410 | Bacteria | 1770 |
| 208 | Ga0373935_0049085 | 3300035692 | Bacteria | 2674 |
| 209 | Ga0373927_0062754 | 3300035695 | Bacteria | 2403 |
| 210 | Ga0373933_0112703 | 3300035724 | Unclassified | 1698 |
| 211 | Ga0373947_0000152 | 3300035725 | Bacteria | 36252 |
| 212 | Ga0373937_0000579 | 3300036401 | Bacteria | 32471 |
| 213 | Ga0373937_0888657 | 3300036401 | Bacteria | 840 |
| 214 | Ga0395899_0010183 | 3300037312 | Bacteria | 7205 |
| 215 | Ga0395900_0001311 | 3300037418 | Bacteria | 30204 |
| 216 | Ga0395900_0120677 | 3300037418 | Bacteria | 2690 |
| 217 | Ga0395900_0282451 | 3300037418 | Bacteria | 1651 |
| 218 | Ga0395900_0617403 | 3300037418 | Bacteria | 1023 |
| 219 | Ga0395900_0857702 | 3300037418 | Bacteria | 833 |
| 220 | Ga0395900_1508181 | 3300037418 | Bacteria | 584 |
| 221 | Ga0395898_0000635 | 3300037466 | Bacteria | 64060 |
| 222 | Ga0395898_0013721 | 3300037466 | Bacteria | 8332 |
| 223 | Ga0395898_0066886 | 3300037466 | Bacteria | 3480 |
| 224 | Ga0395898_0313618 | 3300037466 | Bacteria | 1496 |
| 225 | Ga0395905_0001334 | 3300037471 | Bacteria | 30049 |
| 226 | Ga0395905_0094643 | 3300037471 | Bacteria | 2802 |
| 227 | Ga0395905_0258689 | 3300037471 | Bacteria | 1625 |
| 228 | Ga0395901_0001474 | 3300038443 | Bacteria | 24475 |
| 229 | Ga0395901_0012493 | 3300038443 | Bacteria | 8617 |
| 230 | Ga0395901_0161595 | 3300038443 | Bacteria | 2352 |
| 231 | Ga0395901_0386138 | 3300038443 | Bacteria | 1440 |
| 232 | Ga0436365_0413872 | 3300039437 | Bacteria | 1934 |
| 233 | Ga0436363_0680702 | 3300039450 | Unclassified | 2219 |
| 234 | Ga0436363_1027712 | 3300039450 | Unclassified | 1219 |
| 235 | Ga0453683_0738449 | 3300044673 | Bacteria | 646 |
| 236 | Ga0466963_0024659 | 3300044694 | Bacteria | 3829 |
| 237 | Ga0466963_0757252 | 3300044694 | Unclassified | 685 |
| 238 | Ga0466964_0298616 | 3300044706 | Unclassified | 811 |
| 239 | Ga0466957_0093001 | 3300044842 | Unclassified | 1892 |
| 240 | Ga0466958_0094867 | 3300045836 | Bacteria | 1849 |
| 241 | Ga0466958_0505188 | 3300045836 | Unclassified | 784 |
| 242 | Ga0466967_0046296 | 3300045976 | Bacteria | 3786 |
| 243 | Ga0466967_0431057 | 3300045976 | Bacteria | 1286 |
| 244 | Ga0466967_1474336 | 3300045976 | Unclassified | 678 |
| 245 | Ga0495592_0000048 | 3300046454 | Bacteria | 114599 |
| 246 | Ga0495592_0069081 | 3300046454 | Unclassified | 2577 |
| 247 | Ga0495592_0386082 | 3300046454 | Bacteria | 890 |
| 248 | Ga0495592_0480093 | 3300046454 | Bacteria | 774 |
| 249 | Ga0495629_0000592 | 3300046459 | Bacteria | 29489 |
| 250 | Ga0495641_0006180 | 3300046461 | Bacteria | 7832 |
| 251 | Ga0495641_0147888 | 3300046461 | Bacteria | 1050 |
| 252 | Ga0495651_0000049 | 3300046462 | Bacteria | 88249 |
| 253 | Ga0495651_0308765 | 3300046462 | Unclassified | 1058 |
| 254 | Ga0495653_0015490 | 3300046463 | Bacteria | 6214 |
| 255 | Ga0495653_0018108 | 3300046463 | Bacteria | 5727 |
| 256 | Ga0495653_0065496 | 3300046463 | Unclassified | 2735 |
| 257 | Ga0495653_0403258 | 3300046463 | Bacteria | 869 |
| 258 | Ga0495582_0076833 | 3300046473 | Unclassified | 1851 |
| 259 | Ga0495605_0017779 | 3300046474 | Bacteria | 3822 |
| 260 | Ga0495639_0005540 | 3300046475 | Bacteria | 5436 |
| 261 | Ga0495662_0000257 | 3300046476 | Bacteria | 22457 |
| 262 | Ga0495664_0063880 | 3300046477 | Bacteria | 2194 |
| 263 | Ga0495584_0365421 | 3300046491 | Unclassified | 733 |
| 264 | Ga0495596_0070821 | 3300046500 | Bacteria | 1355 |
| 265 | Ga0495607_0472476 | 3300046501 | Unclassified | 560 |
| 266 | Ga0495608_0000437 | 3300046511 | Bacteria | 29080 |
| 267 | Ga0495618_0000786 | 3300046514 | Bacteria | 22158 |
| 268 | Ga0495628_0000026 | 3300046516 | Bacteria | 127398 |
| 269 | Ga0495628_0060984 | 3300046516 | Bacteria | 2959 |
| 270 | Ga0495628_0137786 | 3300046516 | Unclassified | 1864 |
| 271 | Ga0495630_0003377 | 3300046517 | Bacteria | 11118 |
| 272 | Ga0495630_0130942 | 3300046517 | Unclassified | 1905 |
| 273 | Ga0495630_0343341 | 3300046517 | Bacteria | 1142 |
| 274 | Ga0495666_0281468 | 3300046526 | Bacteria | 754 |
| 275 | Ga0495642_0370229 | 3300046528 | Bacteria | 631 |
| 276 | Ga0495652_0000172 | 3300046529 | Bacteria | 74042 |
| 277 | Ga0495652_0094951 | 3300046529 | Bacteria | 2431 |
| 278 | Ga0495652_0139445 | 3300046529 | Bacteria | 1908 |
| 279 | Ga0495665_0002192 | 3300046531 | Bacteria | 10570 |
| 280 | Ga0495640_0014077 | 3300046533 | Bacteria | 6066 |
| 281 | Ga0495640_0055305 | 3300046533 | Bacteria | 2715 |
| 282 | Ga0495640_0236922 | 3300046533 | Bacteria | 1146 |
| 283 | Ga0495586_0354622 | 3300046535 | Bacteria | 843 |
| 284 | Ga0495587_0000080 | 3300046536 | Bacteria | 75321 |
| 285 | Ga0495587_0197082 | 3300046536 | Unclassified | 1139 |
| 286 | Ga0495609_0129415 | 3300046538 | Bacteria | 1082 |
| 287 | Ga0495597_0141098 | 3300046542 | Bacteria | 994 |
| 288 | Ga0495645_0000016 | 3300046543 | Bacteria | 158415 |
| 289 | Ga0495645_0087348 | 3300046543 | Bacteria | 2231 |
| 290 | Ga0495645_0126930 | 3300046543 | Bacteria | 1792 |
| 291 | Ga0495622_0340204 | 3300046557 | Bacteria | 650 |
| 292 | Ga0495667_0012450 | 3300046559 | Bacteria | 5768 |
| 293 | Ga0495656_0075520 | 3300046615 | Unclassified | 1508 |
| 294 | Ga0495668_0294257 | 3300046616 | Bacteria | 890 |
| 295 | Ga0495634_0043250 | 3300046642 | Bacteria | 3053 |
| 296 | Ga0495635_0048229 | 3300046663 | Bacteria | 2936 |
| 297 | Ga0495635_0153704 | 3300046663 | Unclassified | 1566 |
| 298 | Ga0495635_0384075 | 3300046663 | Bacteria | 934 |
| 299 | Ga0495635_0950944 | 3300046663 | Unclassified | 548 |
| 300 | Ga0495659_0271650 | 3300046664 | Bacteria | 711 |
| 301 | Ga0495588_0042274 | 3300046674 | Bacteria | 2330 |
| 302 | Ga0495657_0023892 | 3300046675 | Unclassified | 4362 |
| 303 | Ga0495657_0072096 | 3300046675 | Unclassified | 2254 |
| 304 | Ga0495599_0000016 | 3300046678 | Bacteria | 169605 |
| 305 | Ga0495599_0452074 | 3300046678 | Bacteria | 760 |
| 306 | Ga0495623_0000046 | 3300046679 | Bacteria | 74571 |
| 307 | Ga0495623_0194062 | 3300046679 | Bacteria | 1171 |
| 308 | Ga0495646_0000201 | 3300046680 | Bacteria | 29539 |
| 309 | Ga0495647_0024442 | 3300046681 | Unclassified | 2199 |
| 310 | Ga0495658_0000149 | 3300046683 | Bacteria | 39059 |
| 311 | Ga0495658_0278232 | 3300046683 | Bacteria | 1056 |
| 312 | Ga0495613_0000639 | 3300046689 | Bacteria | 27810 |
| 313 | Ga0495624_0010098 | 3300046690 | Bacteria | 6508 |
| 314 | Ga0495670_0487280 | 3300046691 | Unclassified | 669 |
| 315 | Ga0495600_0028375 | 3300046809 | Bacteria | 3620 |
| 316 | Ga0495600_0041710 | 3300046809 | Bacteria | 2991 |
| 317 | Ga0495600_0055305 | 3300046809 | Unclassified | 2592 |
| 318 | Ga0495600_0057227 | 3300046809 | Bacteria | 2547 |
| 319 | Ga0495600_0154686 | 3300046809 | Unclassified | 1483 |
| 320 | Ga0495581_0000188 | 3300047315 | Bacteria | 28598 |
| 321 | Ga0495604_0000004 | 3300047317 | Bacteria | 456385 |
| 322 | Ga0495604_0123787 | 3300047317 | Unclassified | 1868 |
| 323 | Ga0495604_0335677 | 3300047317 | Bacteria | 1007 |
| 324 | Ga0495604_0743459 | 3300047317 | Unclassified | 621 |
| 325 | Ga0495674_0014456 | 3300047319 | Bacteria | 7388 |
| 326 | Ga0495674_0074919 | 3300047319 | Bacteria | 2913 |
| 327 | Ga0495676_0012454 | 3300047321 | Bacteria | 7660 |
| 328 | Ga0495676_0270297 | 3300047321 | Bacteria | 1154 |
| 329 | Ga0495680_0005890 | 3300047322 | Bacteria | 11466 |
| 330 | Ga0495680_0007800 | 3300047322 | Bacteria | 9775 |
| 331 | Ga0495680_0012368 | 3300047322 | Bacteria | 7511 |
| 332 | Ga0495680_0034919 | 3300047322 | Bacteria | 4055 |
| 333 | Ga0495680_0266136 | 3300047322 | Bacteria | 1211 |
| 334 | Ga0495675_0000033 | 3300047444 | Bacteria | 98338 |
| 335 | Ga0495675_0229395 | 3300047444 | Bacteria | 1121 |
| 336 | Ga0495684_0003470 | 3300047471 | Bacteria | 12337 |
| 337 | Ga0495684_0009467 | 3300047471 | Bacteria | 7518 |
| 338 | Ga0495684_0152717 | 3300047471 | Unclassified | 1726 |
| 339 | Ga0495684_0946653 | 3300047471 | Unclassified | 551 |
| 340 | Ga0495593_0118182 | 3300047673 | Bacteria | 1350 |
| 341 | Ga0495602_0000036 | 3300048088 | Bacteria | 133584 |
| 342 | Ga0495602_0289148 | 3300048088 | Bacteria | 1204 |
| 343 | Ga0495602_0621775 | 3300048088 | Bacteria | 740 |
| 344 | Ga0495602_0696834 | 3300048088 | Unclassified | 690 |
| 345 | Ga0496100_0459871 | 3300048903 | Unclassified | 976 |
| 346 | Ga0496101_0253496 | 3300048904 | Unclassified | 1371 |
| 347 | Ga0496102_0083874 | 3300048905 | Unclassified | 2940 |
| 348 | Ga0496102_0463733 | 3300048905 | Bacteria | 1188 |
| 349 | Ga0496103_0098826 | 3300048906 | Unclassified | 1846 |
| 350 | Ga0496104_0057735 | 3300048907 | Bacteria | 3672 |
| 351 | Ga0496104_0241201 | 3300048907 | Bacteria | 1720 |
| 352 | Ga0496104_0265174 | 3300048907 | Unclassified | 1630 |
| 353 | Ga0496104_0880577 | 3300048907 | Bacteria | 801 |
| 354 | Ga0496105_0064711 | 3300048908 | Unclassified | 3017 |
| 355 | Ga0496105_0191157 | 3300048908 | Bacteria | 1674 |
| 356 | Ga0496105_0572069 | 3300048908 | Bacteria | 880 |
| 357 | Ga0496106_0302105 | 3300048909 | Unclassified | 1284 |
| 358 | Ga0496106_0326118 | 3300048909 | Unclassified | 1232 |
| 359 | Ga0496106_1127144 | 3300048909 | Unclassified | 614 |
| 360 | Ga0496107_0066149 | 3300048910 | Unclassified | 2620 |
| 361 | Ga0496107_0163121 | 3300048910 | Unclassified | 1652 |
| 362 | Ga0496108_0001649 | 3300048911 | Bacteria | 17687 |
| 363 | Ga0496108_0129635 | 3300048911 | Unclassified | 2168 |
| 364 | Ga0496109_0001364 | 3300048912 | Bacteria | 20245 |
| 365 | Ga0496109_0055173 | 3300048912 | Unclassified | 3625 |
| 366 | Ga0496109_0110991 | 3300048912 | Unclassified | 2550 |
| 367 | Ga0496109_2024695 | 3300048912 | Bacteria | 508 |
| 368 | Ga0496110_0025630 | 3300048913 | Bacteria | 5042 |
| 369 | Ga0496110_0037902 | 3300048913 | Unclassified | 4192 |
| 370 | Ga0496110_0039886 | 3300048913 | Unclassified | 4091 |
| 371 | Ga0496110_0053158 | 3300048913 | Bacteria | 3560 |
| 372 | Ga0496110_0332650 | 3300048913 | Bacteria | 1384 |
| 373 | Ga0496111_0114822 | 3300048914 | Bacteria | 1985 |
| 374 | Ga0496111_0193870 | 3300048914 | Unclassified | 1510 |
| 375 | Ga0496111_0495955 | 3300048914 | Unclassified | 899 |
| 376 | Ga0496112_0034350 | 3300048915 | Bacteria | 4935 |
| 377 | Ga0496112_0035989 | 3300048915 | Bacteria | 4826 |
| 378 | Ga0496112_0098174 | 3300048915 | Unclassified | 2899 |
| 379 | Ga0496112_0127413 | 3300048915 | Bacteria | 2516 |
| 380 | Ga0496112_0807741 | 3300048915 | Unclassified | 862 |
| 381 | Ga0496113_0081762 | 3300048916 | Unclassified | 2477 |
| 382 | Ga0496114_0000644 | 3300048917 | Bacteria | 25695 |
| 383 | Ga0496114_0049248 | 3300048917 | Bacteria | 3505 |
| 384 | Ga0496114_0484713 | 3300048917 | Bacteria | 1094 |
| 385 | Ga0496115_0017968 | 3300048918 | Bacteria | 5418 |
| 386 | Ga0496115_0064649 | 3300048918 | Unclassified | 2953 |
| 387 | Ga0501067_0042438 | 3300049583 | Bacteria | 2525 |
| 388 | Ga0501068_0586359 | 3300049584 | Bacteria | 726 |
| 389 | Ga0501068_0719262 | 3300049584 | Unclassified | 653 |
| 390 | Ga0501069_0061326 | 3300049585 | Bacteria | 2100 |
| 391 | nmdc:mga0n895_366442_c1 | 3300050512 | Unclassified | 1459 |
| 392 | nmdc:mga0a205_244682_c1 | 3300050515 | Bacteria | 1674 |
| 393 | Ga0495601_0002396 | 3300053077 | Bacteria | 10640 |
| 394 | Ga0495601_0018447 | 3300053077 | Bacteria | 4248 |
| 395 | Ga0495601_0243774 | 3300053077 | Bacteria | 1173 |
| 396 | Ga0495601_0388159 | 3300053077 | Unclassified | 906 |
| 397 | Ga0495601_0408207 | 3300053077 | Bacteria | 880 |
| 398 | Ga0495612_0015027 | 3300053078 | Bacteria | 3105 |
| 399 | Ga0495612_0282898 | 3300053078 | Bacteria | 742 |
| 400 | Ga0495655_0122973 | 3300053083 | Unclassified | 792 |
| 401 | Ga0495595_0022360 | 3300053084 | Unclassified | 2776 |
| 402 | Ga0495595_0029806 | 3300053084 | Unclassified | 2444 |
| 403 | Ga0495619_0001743 | 3300053085 | Bacteria | 14445 |
| 404 | Ga0495619_0001850 | 3300053085 | Bacteria | 14082 |
| 405 | Ga0495619_0006658 | 3300053085 | Bacteria | 7314 |
| 406 | Ga0495619_0018056 | 3300053085 | Unclassified | 4473 |
| 407 | Ga0495619_0034753 | 3300053085 | Unclassified | 3277 |
| 408 | Ga0495619_0776195 | 3300053085 | Unclassified | 649 |
| 409 | Ga0587090_077071 | 3300059510 | Bacteria | 661 |
| 410 | Ga0530510_0129175 | 3300061734 | Bacteria | 1858 |
| 411 | Ga0182008_10142139 | |||
| 412 | JGI24751J29686_10030857 | |||
| 413 | Ga0070658_11119918 | |||
| 414 | Ga0070683_100005793 | |||
| 415 | Ga0070683_100023023 | |||
| 416 | Ga0070683_100306992 | |||
| 417 | Ga0070680_100007771 | |||
| 418 | Ga0070682_100089166 | |||
| 419 | Ga0070682_100196915 | |||
| 420 | Ga0070682_100529093 | |||
| 421 | Ga0070660_100000326 | |||
| 422 | Ga0070660_100041032 | |||
| 423 | Ga0070660_100128474 | |||
| 424 | Ga0070661_100017362 | |||
| 425 | Ga0070661_100028244 | |||
| 426 | Ga0070661_100095991 | |||
| 427 | Ga0070675_100077141 | |||
| 428 | Ga0070674_100005842 | |||
| 429 | Ga0070673_100600130 | |||
| 430 | Ga0070659_100246113 | |||
| 431 | Ga0070659_100261326 | |||
| 432 | Ga0070659_100654652 | |||
| 433 | Ga0070667_100024822 | |||
| 434 | Ga0070709_10081122 | |||
| 435 | Ga0070714_100069403 | |||
| 436 | Ga0070714_100428123 | |||
| 437 | Ga0070714_100643171 | |||
| 438 | Ga0070713_100072543 | |||
| 439 | Ga0070713_100085895 | |||
| 440 | Ga0070713_100816304 | |||
| 441 | Ga0070710_10151285 | |||
| 442 | Ga0070711_100026609 | |||
| 443 | Ga0070705_101132033 | |||
| 444 | Ga0070708_100018651 | |||
| 445 | Ga0070708_100135289 | |||
| 446 | Ga0070708_100218252 | |||
| 447 | Ga0070663_100473650 | |||
| 448 | Ga0070678_100074269 | |||
| 449 | Ga0070681_10000927 | |||
| 450 | Ga0070681_10012019 | |||
| 451 | Ga0070681_10027103 | |||
| 452 | Ga0070681_10658697 | |||
| 453 | Ga0070681_11010008 | |||
| 454 | Ga0068867_101018256 | |||
| 455 | Ga0070706_100066310 | |||
| 456 | Ga0070706_100395187 | |||
| 457 | Ga0070707_100005772 | |||
| 458 | Ga0070707_100244662 | |||
| 459 | Ga0070698_100028358 | |||
| 460 | Ga0070698_100191366 | |||
| 461 | Ga0070698_100219160 | |||
| 462 | Ga0070698_100409613 | |||
| 463 | Ga0070698_100925835 | |||
| 464 | Ga0070699_100124066 | |||
| 465 | Ga0070699_100303135 | |||
| 466 | Ga0070679_100010290 | |||
| 467 | Ga0070679_100015227 | |||
| 468 | Ga0070679_100050040 | |||
| 469 | Ga0070684_100004737 | |||
| 470 | Ga0070684_100591188 | |||
| 471 | Ga0070684_100643593 | |||
| 472 | Ga0070697_100097311 | |||
| 473 | Ga0068853_100173202 | |||
| 474 | Ga0068853_101422584 | |||
| 475 | Ga0070672_100235515 | |||
| 476 | Ga0070696_100067011 | |||
| 477 | Ga0070665_100021630 | |||
| 478 | Ga0068855_100004092 | |||
| 479 | Ga0068855_100074781 | |||
| 480 | Ga0068855_100077326 | |||
| 481 | Ga0070664_100025282 | |||
| 482 | Ga0068857_100003795 | |||
| 483 | Ga0068857_100083049 | |||
| 484 | Ga0068856_100067516 | |||
| 485 | Ga0068856_100155880 | |||
| 486 | Ga0070702_100324556 | |||
| 487 | Ga0068859_101765974 | |||
| 488 | Ga0068866_10394914 | |||
| 489 | Ga0068858_100395837 | |||
| 490 | Ga0081538_10004223 | |||
| 491 | Ga0070712_100102472 | |||
| 492 | Ga0070712_101323457 | |||
| 493 | Ga0068871_100279861 | |||
| 494 | Ga0068871_100446257 | |||
| 495 | Ga0075433_10196239 | |||
| 496 | Ga0075434_100239719 | |||
| 497 | Ga0075436_100993669 | |||
| 498 | Ga0097620_101765902 | |||
| 499 | Ga0075435_100238962 | |||
| 500 | Ga0105240_10079497 | |||
| 501 | Ga0105240_10123076 | |||
| 502 | Ga0105240_11025634 | |||
| 503 | Ga0105245_10429753 | |||
| 504 | Ga0105245_10624010 | |||
| 505 | Ga0105243_10055633 | |||
| 506 | Ga0105241_10321696 | |||
| 507 | Ga0105241_11404987 | |||
| 508 | Ga0105237_10038102 | |||
| 509 | Ga0105238_10055783 | |||
| 510 | Ga0105238_10106962 | |||
| 511 | Ga0105238_10319170 | |||
| 512 | Ga0105238_11686653 | |||
| 513 | Ga0105239_10039103 | |||
| 514 | Ga0105239_10351226 | |||
| 515 | Ga0105239_10532844 | |||
| 516 | Ga0105246_10131863 | |||
| 517 | Ga0105246_10969181 | |||
| 518 | Ga0157373_10195694 | |||
| 519 | Ga0157373_10417685 | |||
| 520 | Ga0157371_10263989 | |||
| 521 | Ga0157370_10026439 | |||
| 522 | Ga0157370_10042728 | |||
| 523 | Ga0157370_10187481 | |||
| 524 | Ga0157370_10272882 | |||
| 525 | Ga0157370_10273905 | |||
| 526 | Ga0157369_10020760 | |||
| 527 | Ga0157369_11343724 | |||
| 528 | Ga0157374_10253720 | |||
| 529 | Ga0157378_11124778 | |||
| 530 | Ga0157372_10034496 | |||
| 531 | Ga0157372_10136688 | |||
| 532 | Ga0157372_10369123 | |||
| 533 | Ga0157372_11914355 | |||
| 534 | Ga0157375_10704017 | |||
| 535 | Ga0182008_10002491 | |||
| 536 | Ga0157376_11130337 | |||
| 537 | Ga0182006_1067001 | |||
| 538 | Ga0182007_10040600 | |||
| 539 | Ga0206356_11699489 | |||
| 540 | Ga0206356_11856608 | |||
| 541 | Ga0206349_1467375 | |||
| 542 | Ga0206354_10355131 | |||
| 543 | Ga0206354_11338570 | |||
| 544 | Ga0213874_10179509 | |||
| 545 | Ga0207685_10676554 | |||
| 546 | Ga0207705_10051656 | |||
| 547 | Ga0207705_10135198 | |||
| 548 | Ga0207705_10508319 | |||
| 549 | Ga0207684_10278790 | |||
| 550 | Ga0207654_11026440 | |||
| 551 | Ga0207707_10014419 | |||
| 552 | Ga0207707_10019609 | |||
| 553 | Ga0207707_10037349 | |||
| 554 | Ga0207707_10133377 | |||
| 555 | Ga0207707_10236959 | |||
| 556 | Ga0207707_10273128 | |||
| 557 | Ga0207707_10801160 | |||
| 558 | Ga0207695_10355171 | |||
| 559 | Ga0207693_10103931 | |||
| 560 | Ga0207693_10388093 | |||
| 561 | Ga0207693_10744134 | |||
| 562 | Ga0207663_10322997 | |||
| 563 | Ga0207660_10040934 | |||
| 564 | Ga0207660_10072769 | |||
| 565 | Ga0207660_11086049 | |||
| 566 | Ga0207657_10001525 | |||
| 567 | Ga0207657_10002132 | |||
| 568 | Ga0207657_10016890 | |||
| 569 | Ga0207657_10050120 | |||
| 570 | Ga0207649_10059873 | |||
| 571 | Ga0207652_10005433 | |||
| 572 | Ga0207652_10032305 | |||
| 573 | Ga0207652_10190464 | |||
| 574 | Ga0207646_10113718 | |||
| 575 | Ga0207646_10491669 | |||
| 576 | Ga0207694_10098249 | |||
| 577 | Ga0207659_10275617 | |||
| 578 | Ga0207687_10403912 | |||
| 579 | Ga0207687_10509747 | |||
| 580 | Ga0207687_10703645 | |||
| 581 | Ga0207664_10001849 | |||
| 582 | Ga0207690_10186308 | |||
| 583 | Ga0207709_10051125 | |||
| 584 | Ga0207669_10028364 | |||
| 585 | Ga0207691_10547662 | |||
| 586 | Ga0207661_10022184 | |||
| 587 | Ga0207679_10543030 | |||
| 588 | Ga0207679_10672997 | |||
| 589 | Ga0207667_10036994 | |||
| 590 | Ga0207667_10156621 | |||
| 591 | Ga0207667_10490755 | |||
| 592 | Ga0207712_10650779 | |||
| 593 | Ga0207658_10033480 | |||
| 594 | Ga0207703_10686996 | |||
| 595 | Ga0207678_10168509 | |||
| 596 | Ga0207702_10067145 | |||
| 597 | Ga0207702_10098314 | |||
| 598 | Ga0207648_10873698 | |||
| 599 | Ga0207674_10004404 | |||
| 600 | Ga0207674_10009150 | |||
| 601 | Ga0207674_10009988 | |||
| 602 | Ga0207674_10132111 | |||
| 603 | Ga0207683_10045619 | |||
| 604 | Ga0268266_10311815 | |||
| 605 | Ga0307408_100633253 | |||
| 606 | Ga0307405_10261032 | |||
| 607 | Ga0307416_100196484 | |||
| 608 | Ga0373926_0121168 | |||
| 609 | Ga0373944_0021031 | |||
| 610 | Ga0373936_0012963 | |||
| 611 | Ga0373945_0034251 | |||
| 612 | Ga0373954_0345426 | |||
| 613 | Ga0373956_0424969 | |||
| 614 | Ga0373943_0000091 | |||
| 615 | Ga0373946_0011612 | |||
| 616 | Ga0373955_0359155 | |||
| 617 | Ga0373924_0047576 | |||
| 618 | Ga0373935_0049085 | |||
| 619 | Ga0373927_0062754 | |||
| 620 | Ga0373933_0112703 | |||
| 621 | Ga0373947_0000152 | |||
| 622 | Ga0373937_0000579 | |||
| 623 | Ga0373937_0888657 | |||
| 624 | Ga0395899_0010183 | |||
| 625 | Ga0395900_0001311 | |||
| 626 | Ga0395900_0120677 | |||
| 627 | Ga0395900_0282451 | |||
| 628 | Ga0395900_0617403 | |||
| 629 | Ga0395900_0857702 | |||
| 630 | Ga0395900_1508181 | |||
| 631 | Ga0395898_0000635 | |||
| 632 | Ga0395898_0013721 | |||
| 633 | Ga0395898_0066886 | |||
| 634 | Ga0395898_0313618 | |||
| 635 | Ga0395905_0001334 | |||
| 636 | Ga0395905_0094643 | |||
| 637 | Ga0395905_0258689 | |||
| 638 | Ga0395901_0001474 | |||
| 639 | Ga0395901_0012493 | |||
| 640 | Ga0395901_0161595 | |||
| 641 | Ga0395901_0386138 | |||
| 642 | Ga0436365_0413872 | |||
| 643 | Ga0436363_0680702 | |||
| 644 | Ga0436363_1027712 | |||
| 645 | Ga0453683_0738449 | |||
| 646 | Ga0466963_0024659 | |||
| 647 | Ga0466963_0757252 | |||
| 648 | Ga0466964_0298616 | |||
| 649 | Ga0466957_0093001 | |||
| 650 | Ga0466958_0094867 | |||
| 651 | Ga0466958_0505188 | |||
| 652 | Ga0466967_0046296 | |||
| 653 | Ga0466967_0431057 | |||
| 654 | Ga0466967_1474336 | |||
| 655 | Ga0495592_0000048 | |||
| 656 | Ga0495592_0069081 | |||
| 657 | Ga0495592_0386082 | |||
| 658 | Ga0495592_0480093 | |||
| 659 | Ga0495629_0000592 | |||
| 660 | Ga0495641_0006180 | |||
| 661 | Ga0495641_0147888 | |||
| 662 | Ga0495651_0000049 | |||
| 663 | Ga0495651_0308765 | |||
| 664 | Ga0495653_0015490 | |||
| 665 | Ga0495653_0018108 | |||
| 666 | Ga0495653_0065496 | |||
| 667 | Ga0495653_0403258 | |||
| 668 | Ga0495582_0076833 | |||
| 669 | Ga0495605_0017779 | |||
| 670 | Ga0495639_0005540 | |||
| 671 | Ga0495662_0000257 | |||
| 672 | Ga0495664_0063880 | |||
| 673 | Ga0495584_0365421 | |||
| 674 | Ga0495596_0070821 | |||
| 675 | Ga0495607_0472476 | |||
| 676 | Ga0495608_0000437 | |||
| 677 | Ga0495618_0000786 | |||
| 678 | Ga0495628_0000026 | |||
| 679 | Ga0495628_0060984 | |||
| 680 | Ga0495628_0137786 | |||
| 681 | Ga0495630_0003377 | |||
| 682 | Ga0495630_0130942 | |||
| 683 | Ga0495630_0343341 | |||
| 684 | Ga0495666_0281468 | |||
| 685 | Ga0495642_0370229 | |||
| 686 | Ga0495652_0000172 | |||
| 687 | Ga0495652_0094951 | |||
| 688 | Ga0495652_0139445 | |||
| 689 | Ga0495665_0002192 | |||
| 690 | Ga0495640_0014077 | |||
| 691 | Ga0495640_0055305 | |||
| 692 | Ga0495640_0236922 | |||
| 693 | Ga0495586_0354622 | |||
| 694 | Ga0495587_0000080 | |||
| 695 | Ga0495587_0197082 | |||
| 696 | Ga0495609_0129415 | |||
| 697 | Ga0495597_0141098 | |||
| 698 | Ga0495645_0000016 | |||
| 699 | Ga0495645_0087348 | |||
| 700 | Ga0495645_0126930 | |||
| 701 | Ga0495622_0340204 | |||
| 702 | Ga0495667_0012450 | |||
| 703 | Ga0495656_0075520 | |||
| 704 | Ga0495668_0294257 | |||
| 705 | Ga0495634_0043250 | |||
| 706 | Ga0495635_0048229 | |||
| 707 | Ga0495635_0153704 | |||
| 708 | Ga0495635_0384075 | |||
| 709 | Ga0495635_0950944 | |||
| 710 | Ga0495659_0271650 | |||
| 711 | Ga0495588_0042274 | |||
| 712 | Ga0495657_0023892 | |||
| 713 | Ga0495657_0072096 | |||
| 714 | Ga0495599_0000016 | |||
| 715 | Ga0495599_0452074 | |||
| 716 | Ga0495623_0000046 | |||
| 717 | Ga0495623_0194062 | |||
| 718 | Ga0495646_0000201 | |||
| 719 | Ga0495647_0024442 | |||
| 720 | Ga0495658_0000149 | |||
| 721 | Ga0495658_0278232 | |||
| 722 | Ga0495613_0000639 | |||
| 723 | Ga0495624_0010098 | |||
| 724 | Ga0495670_0487280 | |||
| 725 | Ga0495600_0028375 | |||
| 726 | Ga0495600_0041710 | |||
| 727 | Ga0495600_0055305 | |||
| 728 | Ga0495600_0057227 | |||
| 729 | Ga0495600_0154686 | |||
| 730 | Ga0495581_0000188 | |||
| 731 | Ga0495604_0000004 | |||
| 732 | Ga0495604_0123787 | |||
| 733 | Ga0495604_0335677 | |||
| 734 | Ga0495604_0743459 | |||
| 735 | Ga0495674_0014456 | |||
| 736 | Ga0495674_0074919 | |||
| 737 | Ga0495676_0012454 | |||
| 738 | Ga0495676_0270297 | |||
| 739 | Ga0495680_0005890 | |||
| 740 | Ga0495680_0007800 | |||
| 741 | Ga0495680_0012368 | |||
| 742 | Ga0495680_0034919 | |||
| 743 | Ga0495680_0266136 | |||
| 744 | Ga0495675_0000033 | |||
| 745 | Ga0495675_0229395 | |||
| 746 | Ga0495684_0003470 | |||
| 747 | Ga0495684_0009467 | |||
| 748 | Ga0495684_0152717 | |||
| 749 | Ga0495684_0946653 | |||
| 750 | Ga0495593_0118182 | |||
| 751 | Ga0495602_0000036 | |||
| 752 | Ga0495602_0289148 | |||
| 753 | Ga0495602_0621775 | |||
| 754 | Ga0495602_0696834 | |||
| 755 | Ga0496100_0459871 | |||
| 756 | Ga0496101_0253496 | |||
| 757 | Ga0496102_0083874 | |||
| 758 | Ga0496102_0463733 | |||
| 759 | Ga0496103_0098826 | |||
| 760 | Ga0496104_0057735 | |||
| 761 | Ga0496104_0241201 | |||
| 762 | Ga0496104_0265174 | |||
| 763 | Ga0496104_0880577 | |||
| 764 | Ga0496105_0064711 | |||
| 765 | Ga0496105_0191157 | |||
| 766 | Ga0496105_0572069 | |||
| 767 | Ga0496106_0302105 | |||
| 768 | Ga0496106_0326118 | |||
| 769 | Ga0496106_1127144 | |||
| 770 | Ga0496107_0066149 | |||
| 771 | Ga0496107_0163121 | |||
| 772 | Ga0496108_0001649 | |||
| 773 | Ga0496108_0129635 | |||
| 774 | Ga0496109_0001364 | |||
| 775 | Ga0496109_0055173 | |||
| 776 | Ga0496109_0110991 | |||
| 777 | Ga0496109_2024695 | |||
| 778 | Ga0496110_0025630 | |||
| 779 | Ga0496110_0037902 | |||
| 780 | Ga0496110_0039886 | |||
| 781 | Ga0496110_0053158 | |||
| 782 | Ga0496110_0332650 | |||
| 783 | Ga0496111_0114822 | |||
| 784 | Ga0496111_0193870 | |||
| 785 | Ga0496111_0495955 | |||
| 786 | Ga0496112_0034350 | |||
| 787 | Ga0496112_0035989 | |||
| 788 | Ga0496112_0098174 | |||
| 789 | Ga0496112_0127413 | |||
| 790 | Ga0496112_0807741 | |||
| 791 | Ga0496113_0081762 | |||
| 792 | Ga0496114_0000644 | |||
| 793 | Ga0496114_0049248 | |||
| 794 | Ga0496114_0484713 | |||
| 795 | Ga0496115_0017968 | |||
| 796 | Ga0496115_0064649 | |||
| 797 | Ga0501067_0042438 | |||
| 798 | Ga0501068_0586359 | |||
| 799 | Ga0501068_0719262 | |||
| 800 | Ga0501069_0061326 | |||
| 801 | nmdc:mga0n895_366442_c1 | |||
| 802 | nmdc:mga0a205_244682_c1 | |||
| 803 | Ga0495601_0002396 | |||
| 804 | Ga0495601_0018447 | |||
| 805 | Ga0495601_0243774 | |||
| 806 | Ga0495601_0388159 | |||
| 807 | Ga0495601_0408207 | |||
| 808 | Ga0495612_0015027 | |||
| 809 | Ga0495612_0282898 | |||
| 810 | Ga0495655_0122973 | |||
| 811 | Ga0495595_0022360 | |||
| 812 | Ga0495595_0029806 | |||
| 813 | Ga0495619_0001743 | |||
| 814 | Ga0495619_0001850 | |||
| 815 | Ga0495619_0006658 | |||
| 816 | Ga0495619_0018056 | |||
| 817 | Ga0495619_0034753 | |||
| 818 | Ga0495619_0776195 | |||
| 819 | Ga0587090_077071 | |||
| 820 | Ga0530510_0129175 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5k5q-assembly1.cif.gz_A | structure of aspa-dna complex: novel centromere bindng protein-centromere complex | 0.8996 | 43 | 123 |
| 5k5o-assembly1.cif.gz_C | structure of aspa-26mer dna complex | 0.893 | 43 | 123 |
| 5k5o-assembly1.cif.gz_D | structure of aspa-26mer dna complex | 0.8902 | 47 | 123 |
| 5k5q-assembly1.cif.gz_C | structure of aspa-dna complex: novel centromere bindng protein-centromere complex | 0.8837 | 40 | 123 |
| 5k5q-assembly1.cif.gz_D | structure of aspa-dna complex: novel centromere bindng protein-centromere complex | 0.8821 | 40 | 120 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9VD25_77_142_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9253 | 42 | 103 | 1.10.10.10 |
| af_Q58948_3_81_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.915 | 40 | 113 | 1.10.10.10 |
| af_P32910_88_152_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9138 | 43 | 103 | 1.10.10.10 |
| af_Q69XJ1_51_114_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9132 | 42 | 102 | 1.10.10.10 |
| af_P30852_292_361_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9101 | 55 | 104 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-K6GI45-F1-model_v4 | Transcriptional regulator | 0.9333 | 7 | 149 |
GO:0003677
GO:0003700 GO:0006950 |
| AF-A0A543IV39-F1-model_v4 | DNA-binding MarR family transcriptional regulator | 0.9323 | 8 | 125 |
GO:0003677
GO:0003700 GO:0006950 |
| AF-A0A7Y1SRK4-F1-model_v4 | MarR family transcriptional regulator | 0.9315 | 17 | 131 |
GO:0003677
GO:0003700 GO:0006950 |
| AF-U7UGC9-F1-model_v4 | MarR family protein | 0.9315 | 5 | 145 |
GO:0003677
GO:0003700 |
| AF-A0A3N1GTK6-F1-model_v4 | DNA-binding MarR family transcriptional regulator | 0.9238 | 1 | 147 |
GO:0003677
GO:0003700 GO:0006950 |