F437252

General Info

Members Datasets Scaffolds Average Seq Length
410 220 820 167

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10142139|Ga0182008_101421392
Length 188
Sequence MVLMPHSFLDVCYALQLSMKKQLYGELSQDGQSLSSPSAEQLRCWRLFFESAMALLDVLDAELERDAGISQRWYDVLVHLEESPNGVPMTALADRILYSKSGFTRVVDRMEEAGLIQRVRPENDRRTILVVLTETGAATLLRARSYHRDGIDRHFAQHLTDADVKALTKALEKVSAHARPLRPGRIRS

Samples

Sample ID Description Type Environment
1 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
70 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
71 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
75 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
112 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
113 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
114 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
115 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
116 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
117 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
118 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
119 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
120 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
123 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
124 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
133 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
134 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
135 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
136 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
137 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
142 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
143 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
144 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
145 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
146 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
147 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
148 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
149 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
150 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
151 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
156 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
157 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
160 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
161 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
162 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
163 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
164 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
165 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
166 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
167 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
168 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
169 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
170 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
171 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
172 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
173 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
174 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
175 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
176 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
177 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
178 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
179 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
180 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
181 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
182 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
183 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
184 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
185 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
186 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
187 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
188 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
189 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
192 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
210 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
211 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
215 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
216 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
217 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
218 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
219 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.54
Metatranscriptomes 1.46
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.24
Rhizosphere 88.78
Stem 0
Stem Tuber 0
Unclassified 26.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182008_10142139 3300014497 Bacteria 1201
2 JGI24751J29686_10030857 3300002459 Unclassified 1112
3 Ga0070658_11119918 3300005327 Unclassified 685
4 Ga0070683_100005793 3300005329 Bacteria 10333
5 Ga0070683_100023023 3300005329 Bacteria 5571
6 Ga0070683_100306992 3300005329 Bacteria 1509
7 Ga0070680_100007771 3300005336 Bacteria 8173
8 Ga0070682_100089166 3300005337 Bacteria 2014
9 Ga0070682_100196915 3300005337 Bacteria 1419
10 Ga0070682_100529093 3300005337 Bacteria 918
11 Ga0070660_100000326 3300005339 Bacteria 31349
12 Ga0070660_100041032 3300005339 Bacteria 3525
13 Ga0070660_100128474 3300005339 Bacteria 2026
14 Ga0070661_100017362 3300005344 Bacteria 5105
15 Ga0070661_100028244 3300005344 Bacteria 4045
16 Ga0070661_100095991 3300005344 Unclassified 2199
17 Ga0070675_100077141 3300005354 Bacteria 2773
18 Ga0070674_100005842 3300005356 Bacteria 7153
19 Ga0070673_100600130 3300005364 Bacteria 1004
20 Ga0070659_100246113 3300005366 Unclassified 1481
21 Ga0070659_100261326 3300005366 Unclassified 1436
22 Ga0070659_100654652 3300005366 Bacteria 906
23 Ga0070667_100024822 3300005367 Bacteria 4981
24 Ga0070709_10081122 3300005434 Bacteria 2116
25 Ga0070714_100069403 3300005435 Bacteria 3043
26 Ga0070714_100428123 3300005435 Bacteria 1254
27 Ga0070714_100643171 3300005435 Unclassified 1020
28 Ga0070713_100072543 3300005436 Bacteria 2912
29 Ga0070713_100085895 3300005436 Unclassified 2696
30 Ga0070713_100816304 3300005436 Bacteria 894
31 Ga0070710_10151285 3300005437 Unclassified 1431
32 Ga0070711_100026609 3300005439 Bacteria 3792
33 Ga0070705_101132033 3300005440 Unclassified 642
34 Ga0070708_100018651 3300005445 Bacteria 5808
35 Ga0070708_100135289 3300005445 Bacteria 2282
36 Ga0070708_100218252 3300005445 Unclassified 1788
37 Ga0070663_100473650 3300005455 Bacteria 1036
38 Ga0070678_100074269 3300005456 Bacteria 2555
39 Ga0070681_10000927 3300005458 Bacteria 24715
40 Ga0070681_10012019 3300005458 Bacteria 8584
41 Ga0070681_10027103 3300005458 Bacteria 5761
42 Ga0070681_10658697 3300005458 Bacteria 962
43 Ga0070681_11010008 3300005458 Bacteria 752
44 Ga0068867_101018256 3300005459 Bacteria 752
45 Ga0070706_100066310 3300005467 Bacteria 3339
46 Ga0070706_100395187 3300005467 Bacteria 1287
47 Ga0070707_100005772 3300005468 Bacteria 11544
48 Ga0070707_100244662 3300005468 Bacteria 1746
49 Ga0070698_100028358 3300005471 Bacteria 5815
50 Ga0070698_100191366 3300005471 Unclassified 1983
51 Ga0070698_100219160 3300005471 Unclassified 1837
52 Ga0070698_100409613 3300005471 Unclassified 1290
53 Ga0070698_100925835 3300005471 Bacteria 818
54 Ga0070699_100124066 3300005518 Bacteria 2273
55 Ga0070699_100303135 3300005518 Bacteria 1433
56 Ga0070679_100010290 3300005530 Bacteria 8864
57 Ga0070679_100015227 3300005530 Bacteria 7387
58 Ga0070679_100050040 3300005530 Bacteria 4162
59 Ga0070684_100004737 3300005535 Bacteria 10389
60 Ga0070684_100591188 3300005535 Unclassified 1032
61 Ga0070684_100643593 3300005535 Bacteria 987
62 Ga0070697_100097311 3300005536 Bacteria 2442
63 Ga0068853_100173202 3300005539 Unclassified 1953
64 Ga0068853_101422584 3300005539 Unclassified 671
65 Ga0070672_100235515 3300005543 Bacteria 1539
66 Ga0070696_100067011 3300005546 Bacteria 2519
67 Ga0070665_100021630 3300005548 Bacteria 6468
68 Ga0068855_100004092 3300005563 Bacteria 17784
69 Ga0068855_100074781 3300005563 Bacteria 3934
70 Ga0068855_100077326 3300005563 Bacteria 3861
71 Ga0070664_100025282 3300005564 Unclassified 4921
72 Ga0068857_100003795 3300005577 Bacteria 12715
73 Ga0068857_100083049 3300005577 Bacteria 2861
74 Ga0068856_100067516 3300005614 Bacteria 3534
75 Ga0068856_100155880 3300005614 Bacteria 2294
76 Ga0070702_100324556 3300005615 Unclassified 1074
77 Ga0068859_101765974 3300005617 Bacteria 683
78 Ga0068866_10394914 3300005718 Unclassified 890
79 Ga0068858_100395837 3300005842 Bacteria 1327
80 Ga0081538_10004223 3300005981 Bacteria 13337
81 Ga0070712_100102472 3300006175 Bacteria 2120
82 Ga0070712_101323457 3300006175 Bacteria 628
83 Ga0068871_100279861 3300006358 Unclassified 1459
84 Ga0068871_100446257 3300006358 Bacteria 1159
85 Ga0075433_10196239 3300006852 Bacteria 1795
86 Ga0075434_100239719 3300006871 Bacteria 1833
87 Ga0075436_100993669 3300006914 Bacteria 630
88 Ga0097620_101765902 3300006931 Bacteria 683
89 Ga0075435_100238962 3300007076 Bacteria 1544
90 Ga0105240_10079497 3300009093 Bacteria 4035
91 Ga0105240_10123076 3300009093 Bacteria 3121
92 Ga0105240_11025634 3300009093 Bacteria 881
93 Ga0105245_10429753 3300009098 Bacteria 1325
94 Ga0105245_10624010 3300009098 Unclassified 1106
95 Ga0105243_10055633 3300009148 Bacteria 3144
96 Ga0105241_10321696 3300009174 Bacteria 1334
97 Ga0105241_11404987 3300009174 Bacteria 668
98 Ga0105237_10038102 3300009545 Bacteria 4856
99 Ga0105238_10055783 3300009551 Bacteria 3965
100 Ga0105238_10106962 3300009551 Unclassified 2778
101 Ga0105238_10319170 3300009551 Bacteria 1539
102 Ga0105238_11686653 3300009551 Unclassified 665
103 Ga0105239_10039103 3300010375 Bacteria 5197
104 Ga0105239_10351226 3300010375 Bacteria 1665
105 Ga0105239_10532844 3300010375 Bacteria 1337
106 Ga0105246_10131863 3300011119 Bacteria 1867
107 Ga0105246_10969181 3300011119 Bacteria 768
108 Ga0157373_10195694 3300013100 Bacteria 1425
109 Ga0157373_10417685 3300013100 Bacteria 963
110 Ga0157371_10263989 3300013102 Bacteria 1242
111 Ga0157370_10026439 3300013104 Bacteria 5731
112 Ga0157370_10042728 3300013104 Bacteria 4366
113 Ga0157370_10187481 3300013104 Bacteria 1920
114 Ga0157370_10272882 3300013104 Unclassified 1562
115 Ga0157370_10273905 3300013104 Bacteria 1559
116 Ga0157369_10020760 3300013105 Bacteria 7342
117 Ga0157369_11343724 3300013105 Bacteria 728
118 Ga0157374_10253720 3300013296 Bacteria 1731
119 Ga0157378_11124778 3300013297 Bacteria 823
120 Ga0157372_10034496 3300013307 Bacteria 5562
121 Ga0157372_10136688 3300013307 Bacteria 2823
122 Ga0157372_10369123 3300013307 Bacteria 1672
123 Ga0157372_11914355 3300013307 Unclassified 682
124 Ga0157375_10704017 3300013308 Unclassified 1164
125 Ga0182008_10002491 3300014497 Bacteria 11505
126 Ga0157376_11130337 3300014969 Unclassified 810
127 Ga0182006_1067001 3300015261 Bacteria 1340
128 Ga0182007_10040600 3300015262 Bacteria 1553
129 Ga0206356_11699489 3300020070 Bacteria 2103
130 Ga0206356_11856608 3300020070 Bacteria 2793
131 Ga0206349_1467375 3300020075 Unclassified 826
132 Ga0206354_10355131 3300020081 Bacteria 1052
133 Ga0206354_11338570 3300020081 Unclassified 623
134 Ga0213874_10179509 3300021377 Unclassified 753
135 Ga0207685_10676554 3300025905 Unclassified 560
136 Ga0207705_10051656 3300025909 Bacteria 2959
137 Ga0207705_10135198 3300025909 Unclassified 1837
138 Ga0207705_10508319 3300025909 Bacteria 936
139 Ga0207684_10278790 3300025910 Bacteria 1442
140 Ga0207654_11026440 3300025911 Bacteria 600
141 Ga0207707_10014419 3300025912 Bacteria 6884
142 Ga0207707_10019609 3300025912 Bacteria 5902
143 Ga0207707_10037349 3300025912 Bacteria 4245
144 Ga0207707_10133377 3300025912 Unclassified 2172
145 Ga0207707_10236959 3300025912 Bacteria 1587
146 Ga0207707_10273128 3300025912 Bacteria 1465
147 Ga0207707_10801160 3300025912 Bacteria 785
148 Ga0207695_10355171 3300025913 Bacteria 1352
149 Ga0207693_10103931 3300025915 Unclassified 2228
150 Ga0207693_10388093 3300025915 Bacteria 1092
151 Ga0207693_10744134 3300025915 Bacteria 758
152 Ga0207663_10322997 3300025916 Bacteria 1160
153 Ga0207660_10040934 3300025917 Bacteria 3246
154 Ga0207660_10072769 3300025917 Bacteria 2504
155 Ga0207660_11086049 3300025917 Bacteria 652
156 Ga0207657_10001525 3300025919 Bacteria 24807
157 Ga0207657_10002132 3300025919 Bacteria 21433
158 Ga0207657_10016890 3300025919 Bacteria 7022
159 Ga0207657_10050120 3300025919 Bacteria 3634
160 Ga0207649_10059873 3300025920 Bacteria 2391
161 Ga0207652_10005433 3300025921 Bacteria 10341
162 Ga0207652_10032305 3300025921 Bacteria 4398
163 Ga0207652_10190464 3300025921 Unclassified 1845
164 Ga0207646_10113718 3300025922 Bacteria 2430
165 Ga0207646_10491669 3300025922 Bacteria 1106
166 Ga0207694_10098249 3300025924 Bacteria 2317
167 Ga0207659_10275617 3300025926 Bacteria 1373
168 Ga0207687_10403912 3300025927 Unclassified 1124
169 Ga0207687_10509747 3300025927 Bacteria 1005
170 Ga0207687_10703645 3300025927 Bacteria 858
171 Ga0207664_10001849 3300025929 Bacteria 13962
172 Ga0207690_10186308 3300025932 Bacteria 1566
173 Ga0207709_10051125 3300025935 Bacteria 2531
174 Ga0207669_10028364 3300025937 Bacteria 3079
175 Ga0207691_10547662 3300025940 Unclassified 981
176 Ga0207661_10022184 3300025944 Bacteria 4775
177 Ga0207679_10543030 3300025945 Unclassified 1042
178 Ga0207679_10672997 3300025945 Bacteria 937
179 Ga0207667_10036994 3300025949 Bacteria 5223
180 Ga0207667_10156621 3300025949 Unclassified 2343
181 Ga0207667_10490755 3300025949 Bacteria 1246
182 Ga0207712_10650779 3300025961 Bacteria 916
183 Ga0207658_10033480 3300025986 Unclassified 3666
184 Ga0207703_10686996 3300026035 Bacteria 973
185 Ga0207678_10168509 3300026067 Bacteria 1870
186 Ga0207702_10067145 3300026078 Bacteria 3077
187 Ga0207702_10098314 3300026078 Bacteria 2578
188 Ga0207648_10873698 3300026089 Unclassified 839
189 Ga0207674_10004404 3300026116 Bacteria 16967
190 Ga0207674_10009150 3300026116 Bacteria 11360
191 Ga0207674_10009988 3300026116 Bacteria 10803
192 Ga0207674_10132111 3300026116 Unclassified 2459
193 Ga0207683_10045619 3300026121 Bacteria 3833
194 Ga0268266_10311815 3300028379 Bacteria 1470
195 Ga0307408_100633253 3300031548 Bacteria 954
196 Ga0307405_10261032 3300031731 Unclassified 1294
197 Ga0307416_100196484 3300032002 Bacteria 1909
198 Ga0373926_0121168 3300035083 Bacteria 986
199 Ga0373944_0021031 3300035089 Unclassified 1885
200 Ga0373936_0012963 3300035113 Unclassified 3179
201 Ga0373945_0034251 3300035116 Unclassified 1809
202 Ga0373954_0345426 3300035118 Unclassified 735
203 Ga0373956_0424969 3300035119 Bacteria 634
204 Ga0373943_0000091 3300035170 Bacteria 33188
205 Ga0373946_0011612 3300035171 Unclassified 3290
206 Ga0373955_0359155 3300035172 Bacteria 883
207 Ga0373924_0047576 3300035410 Bacteria 1770
208 Ga0373935_0049085 3300035692 Bacteria 2674
209 Ga0373927_0062754 3300035695 Bacteria 2403
210 Ga0373933_0112703 3300035724 Unclassified 1698
211 Ga0373947_0000152 3300035725 Bacteria 36252
212 Ga0373937_0000579 3300036401 Bacteria 32471
213 Ga0373937_0888657 3300036401 Bacteria 840
214 Ga0395899_0010183 3300037312 Bacteria 7205
215 Ga0395900_0001311 3300037418 Bacteria 30204
216 Ga0395900_0120677 3300037418 Bacteria 2690
217 Ga0395900_0282451 3300037418 Bacteria 1651
218 Ga0395900_0617403 3300037418 Bacteria 1023
219 Ga0395900_0857702 3300037418 Bacteria 833
220 Ga0395900_1508181 3300037418 Bacteria 584
221 Ga0395898_0000635 3300037466 Bacteria 64060
222 Ga0395898_0013721 3300037466 Bacteria 8332
223 Ga0395898_0066886 3300037466 Bacteria 3480
224 Ga0395898_0313618 3300037466 Bacteria 1496
225 Ga0395905_0001334 3300037471 Bacteria 30049
226 Ga0395905_0094643 3300037471 Bacteria 2802
227 Ga0395905_0258689 3300037471 Bacteria 1625
228 Ga0395901_0001474 3300038443 Bacteria 24475
229 Ga0395901_0012493 3300038443 Bacteria 8617
230 Ga0395901_0161595 3300038443 Bacteria 2352
231 Ga0395901_0386138 3300038443 Bacteria 1440
232 Ga0436365_0413872 3300039437 Bacteria 1934
233 Ga0436363_0680702 3300039450 Unclassified 2219
234 Ga0436363_1027712 3300039450 Unclassified 1219
235 Ga0453683_0738449 3300044673 Bacteria 646
236 Ga0466963_0024659 3300044694 Bacteria 3829
237 Ga0466963_0757252 3300044694 Unclassified 685
238 Ga0466964_0298616 3300044706 Unclassified 811
239 Ga0466957_0093001 3300044842 Unclassified 1892
240 Ga0466958_0094867 3300045836 Bacteria 1849
241 Ga0466958_0505188 3300045836 Unclassified 784
242 Ga0466967_0046296 3300045976 Bacteria 3786
243 Ga0466967_0431057 3300045976 Bacteria 1286
244 Ga0466967_1474336 3300045976 Unclassified 678
245 Ga0495592_0000048 3300046454 Bacteria 114599
246 Ga0495592_0069081 3300046454 Unclassified 2577
247 Ga0495592_0386082 3300046454 Bacteria 890
248 Ga0495592_0480093 3300046454 Bacteria 774
249 Ga0495629_0000592 3300046459 Bacteria 29489
250 Ga0495641_0006180 3300046461 Bacteria 7832
251 Ga0495641_0147888 3300046461 Bacteria 1050
252 Ga0495651_0000049 3300046462 Bacteria 88249
253 Ga0495651_0308765 3300046462 Unclassified 1058
254 Ga0495653_0015490 3300046463 Bacteria 6214
255 Ga0495653_0018108 3300046463 Bacteria 5727
256 Ga0495653_0065496 3300046463 Unclassified 2735
257 Ga0495653_0403258 3300046463 Bacteria 869
258 Ga0495582_0076833 3300046473 Unclassified 1851
259 Ga0495605_0017779 3300046474 Bacteria 3822
260 Ga0495639_0005540 3300046475 Bacteria 5436
261 Ga0495662_0000257 3300046476 Bacteria 22457
262 Ga0495664_0063880 3300046477 Bacteria 2194
263 Ga0495584_0365421 3300046491 Unclassified 733
264 Ga0495596_0070821 3300046500 Bacteria 1355
265 Ga0495607_0472476 3300046501 Unclassified 560
266 Ga0495608_0000437 3300046511 Bacteria 29080
267 Ga0495618_0000786 3300046514 Bacteria 22158
268 Ga0495628_0000026 3300046516 Bacteria 127398
269 Ga0495628_0060984 3300046516 Bacteria 2959
270 Ga0495628_0137786 3300046516 Unclassified 1864
271 Ga0495630_0003377 3300046517 Bacteria 11118
272 Ga0495630_0130942 3300046517 Unclassified 1905
273 Ga0495630_0343341 3300046517 Bacteria 1142
274 Ga0495666_0281468 3300046526 Bacteria 754
275 Ga0495642_0370229 3300046528 Bacteria 631
276 Ga0495652_0000172 3300046529 Bacteria 74042
277 Ga0495652_0094951 3300046529 Bacteria 2431
278 Ga0495652_0139445 3300046529 Bacteria 1908
279 Ga0495665_0002192 3300046531 Bacteria 10570
280 Ga0495640_0014077 3300046533 Bacteria 6066
281 Ga0495640_0055305 3300046533 Bacteria 2715
282 Ga0495640_0236922 3300046533 Bacteria 1146
283 Ga0495586_0354622 3300046535 Bacteria 843
284 Ga0495587_0000080 3300046536 Bacteria 75321
285 Ga0495587_0197082 3300046536 Unclassified 1139
286 Ga0495609_0129415 3300046538 Bacteria 1082
287 Ga0495597_0141098 3300046542 Bacteria 994
288 Ga0495645_0000016 3300046543 Bacteria 158415
289 Ga0495645_0087348 3300046543 Bacteria 2231
290 Ga0495645_0126930 3300046543 Bacteria 1792
291 Ga0495622_0340204 3300046557 Bacteria 650
292 Ga0495667_0012450 3300046559 Bacteria 5768
293 Ga0495656_0075520 3300046615 Unclassified 1508
294 Ga0495668_0294257 3300046616 Bacteria 890
295 Ga0495634_0043250 3300046642 Bacteria 3053
296 Ga0495635_0048229 3300046663 Bacteria 2936
297 Ga0495635_0153704 3300046663 Unclassified 1566
298 Ga0495635_0384075 3300046663 Bacteria 934
299 Ga0495635_0950944 3300046663 Unclassified 548
300 Ga0495659_0271650 3300046664 Bacteria 711
301 Ga0495588_0042274 3300046674 Bacteria 2330
302 Ga0495657_0023892 3300046675 Unclassified 4362
303 Ga0495657_0072096 3300046675 Unclassified 2254
304 Ga0495599_0000016 3300046678 Bacteria 169605
305 Ga0495599_0452074 3300046678 Bacteria 760
306 Ga0495623_0000046 3300046679 Bacteria 74571
307 Ga0495623_0194062 3300046679 Bacteria 1171
308 Ga0495646_0000201 3300046680 Bacteria 29539
309 Ga0495647_0024442 3300046681 Unclassified 2199
310 Ga0495658_0000149 3300046683 Bacteria 39059
311 Ga0495658_0278232 3300046683 Bacteria 1056
312 Ga0495613_0000639 3300046689 Bacteria 27810
313 Ga0495624_0010098 3300046690 Bacteria 6508
314 Ga0495670_0487280 3300046691 Unclassified 669
315 Ga0495600_0028375 3300046809 Bacteria 3620
316 Ga0495600_0041710 3300046809 Bacteria 2991
317 Ga0495600_0055305 3300046809 Unclassified 2592
318 Ga0495600_0057227 3300046809 Bacteria 2547
319 Ga0495600_0154686 3300046809 Unclassified 1483
320 Ga0495581_0000188 3300047315 Bacteria 28598
321 Ga0495604_0000004 3300047317 Bacteria 456385
322 Ga0495604_0123787 3300047317 Unclassified 1868
323 Ga0495604_0335677 3300047317 Bacteria 1007
324 Ga0495604_0743459 3300047317 Unclassified 621
325 Ga0495674_0014456 3300047319 Bacteria 7388
326 Ga0495674_0074919 3300047319 Bacteria 2913
327 Ga0495676_0012454 3300047321 Bacteria 7660
328 Ga0495676_0270297 3300047321 Bacteria 1154
329 Ga0495680_0005890 3300047322 Bacteria 11466
330 Ga0495680_0007800 3300047322 Bacteria 9775
331 Ga0495680_0012368 3300047322 Bacteria 7511
332 Ga0495680_0034919 3300047322 Bacteria 4055
333 Ga0495680_0266136 3300047322 Bacteria 1211
334 Ga0495675_0000033 3300047444 Bacteria 98338
335 Ga0495675_0229395 3300047444 Bacteria 1121
336 Ga0495684_0003470 3300047471 Bacteria 12337
337 Ga0495684_0009467 3300047471 Bacteria 7518
338 Ga0495684_0152717 3300047471 Unclassified 1726
339 Ga0495684_0946653 3300047471 Unclassified 551
340 Ga0495593_0118182 3300047673 Bacteria 1350
341 Ga0495602_0000036 3300048088 Bacteria 133584
342 Ga0495602_0289148 3300048088 Bacteria 1204
343 Ga0495602_0621775 3300048088 Bacteria 740
344 Ga0495602_0696834 3300048088 Unclassified 690
345 Ga0496100_0459871 3300048903 Unclassified 976
346 Ga0496101_0253496 3300048904 Unclassified 1371
347 Ga0496102_0083874 3300048905 Unclassified 2940
348 Ga0496102_0463733 3300048905 Bacteria 1188
349 Ga0496103_0098826 3300048906 Unclassified 1846
350 Ga0496104_0057735 3300048907 Bacteria 3672
351 Ga0496104_0241201 3300048907 Bacteria 1720
352 Ga0496104_0265174 3300048907 Unclassified 1630
353 Ga0496104_0880577 3300048907 Bacteria 801
354 Ga0496105_0064711 3300048908 Unclassified 3017
355 Ga0496105_0191157 3300048908 Bacteria 1674
356 Ga0496105_0572069 3300048908 Bacteria 880
357 Ga0496106_0302105 3300048909 Unclassified 1284
358 Ga0496106_0326118 3300048909 Unclassified 1232
359 Ga0496106_1127144 3300048909 Unclassified 614
360 Ga0496107_0066149 3300048910 Unclassified 2620
361 Ga0496107_0163121 3300048910 Unclassified 1652
362 Ga0496108_0001649 3300048911 Bacteria 17687
363 Ga0496108_0129635 3300048911 Unclassified 2168
364 Ga0496109_0001364 3300048912 Bacteria 20245
365 Ga0496109_0055173 3300048912 Unclassified 3625
366 Ga0496109_0110991 3300048912 Unclassified 2550
367 Ga0496109_2024695 3300048912 Bacteria 508
368 Ga0496110_0025630 3300048913 Bacteria 5042
369 Ga0496110_0037902 3300048913 Unclassified 4192
370 Ga0496110_0039886 3300048913 Unclassified 4091
371 Ga0496110_0053158 3300048913 Bacteria 3560
372 Ga0496110_0332650 3300048913 Bacteria 1384
373 Ga0496111_0114822 3300048914 Bacteria 1985
374 Ga0496111_0193870 3300048914 Unclassified 1510
375 Ga0496111_0495955 3300048914 Unclassified 899
376 Ga0496112_0034350 3300048915 Bacteria 4935
377 Ga0496112_0035989 3300048915 Bacteria 4826
378 Ga0496112_0098174 3300048915 Unclassified 2899
379 Ga0496112_0127413 3300048915 Bacteria 2516
380 Ga0496112_0807741 3300048915 Unclassified 862
381 Ga0496113_0081762 3300048916 Unclassified 2477
382 Ga0496114_0000644 3300048917 Bacteria 25695
383 Ga0496114_0049248 3300048917 Bacteria 3505
384 Ga0496114_0484713 3300048917 Bacteria 1094
385 Ga0496115_0017968 3300048918 Bacteria 5418
386 Ga0496115_0064649 3300048918 Unclassified 2953
387 Ga0501067_0042438 3300049583 Bacteria 2525
388 Ga0501068_0586359 3300049584 Bacteria 726
389 Ga0501068_0719262 3300049584 Unclassified 653
390 Ga0501069_0061326 3300049585 Bacteria 2100
391 nmdc:mga0n895_366442_c1 3300050512 Unclassified 1459
392 nmdc:mga0a205_244682_c1 3300050515 Bacteria 1674
393 Ga0495601_0002396 3300053077 Bacteria 10640
394 Ga0495601_0018447 3300053077 Bacteria 4248
395 Ga0495601_0243774 3300053077 Bacteria 1173
396 Ga0495601_0388159 3300053077 Unclassified 906
397 Ga0495601_0408207 3300053077 Bacteria 880
398 Ga0495612_0015027 3300053078 Bacteria 3105
399 Ga0495612_0282898 3300053078 Bacteria 742
400 Ga0495655_0122973 3300053083 Unclassified 792
401 Ga0495595_0022360 3300053084 Unclassified 2776
402 Ga0495595_0029806 3300053084 Unclassified 2444
403 Ga0495619_0001743 3300053085 Bacteria 14445
404 Ga0495619_0001850 3300053085 Bacteria 14082
405 Ga0495619_0006658 3300053085 Bacteria 7314
406 Ga0495619_0018056 3300053085 Unclassified 4473
407 Ga0495619_0034753 3300053085 Unclassified 3277
408 Ga0495619_0776195 3300053085 Unclassified 649
409 Ga0587090_077071 3300059510 Bacteria 661
410 Ga0530510_0129175 3300061734 Bacteria 1858
411 Ga0182008_10142139
412 JGI24751J29686_10030857
413 Ga0070658_11119918
414 Ga0070683_100005793
415 Ga0070683_100023023
416 Ga0070683_100306992
417 Ga0070680_100007771
418 Ga0070682_100089166
419 Ga0070682_100196915
420 Ga0070682_100529093
421 Ga0070660_100000326
422 Ga0070660_100041032
423 Ga0070660_100128474
424 Ga0070661_100017362
425 Ga0070661_100028244
426 Ga0070661_100095991
427 Ga0070675_100077141
428 Ga0070674_100005842
429 Ga0070673_100600130
430 Ga0070659_100246113
431 Ga0070659_100261326
432 Ga0070659_100654652
433 Ga0070667_100024822
434 Ga0070709_10081122
435 Ga0070714_100069403
436 Ga0070714_100428123
437 Ga0070714_100643171
438 Ga0070713_100072543
439 Ga0070713_100085895
440 Ga0070713_100816304
441 Ga0070710_10151285
442 Ga0070711_100026609
443 Ga0070705_101132033
444 Ga0070708_100018651
445 Ga0070708_100135289
446 Ga0070708_100218252
447 Ga0070663_100473650
448 Ga0070678_100074269
449 Ga0070681_10000927
450 Ga0070681_10012019
451 Ga0070681_10027103
452 Ga0070681_10658697
453 Ga0070681_11010008
454 Ga0068867_101018256
455 Ga0070706_100066310
456 Ga0070706_100395187
457 Ga0070707_100005772
458 Ga0070707_100244662
459 Ga0070698_100028358
460 Ga0070698_100191366
461 Ga0070698_100219160
462 Ga0070698_100409613
463 Ga0070698_100925835
464 Ga0070699_100124066
465 Ga0070699_100303135
466 Ga0070679_100010290
467 Ga0070679_100015227
468 Ga0070679_100050040
469 Ga0070684_100004737
470 Ga0070684_100591188
471 Ga0070684_100643593
472 Ga0070697_100097311
473 Ga0068853_100173202
474 Ga0068853_101422584
475 Ga0070672_100235515
476 Ga0070696_100067011
477 Ga0070665_100021630
478 Ga0068855_100004092
479 Ga0068855_100074781
480 Ga0068855_100077326
481 Ga0070664_100025282
482 Ga0068857_100003795
483 Ga0068857_100083049
484 Ga0068856_100067516
485 Ga0068856_100155880
486 Ga0070702_100324556
487 Ga0068859_101765974
488 Ga0068866_10394914
489 Ga0068858_100395837
490 Ga0081538_10004223
491 Ga0070712_100102472
492 Ga0070712_101323457
493 Ga0068871_100279861
494 Ga0068871_100446257
495 Ga0075433_10196239
496 Ga0075434_100239719
497 Ga0075436_100993669
498 Ga0097620_101765902
499 Ga0075435_100238962
500 Ga0105240_10079497
501 Ga0105240_10123076
502 Ga0105240_11025634
503 Ga0105245_10429753
504 Ga0105245_10624010
505 Ga0105243_10055633
506 Ga0105241_10321696
507 Ga0105241_11404987
508 Ga0105237_10038102
509 Ga0105238_10055783
510 Ga0105238_10106962
511 Ga0105238_10319170
512 Ga0105238_11686653
513 Ga0105239_10039103
514 Ga0105239_10351226
515 Ga0105239_10532844
516 Ga0105246_10131863
517 Ga0105246_10969181
518 Ga0157373_10195694
519 Ga0157373_10417685
520 Ga0157371_10263989
521 Ga0157370_10026439
522 Ga0157370_10042728
523 Ga0157370_10187481
524 Ga0157370_10272882
525 Ga0157370_10273905
526 Ga0157369_10020760
527 Ga0157369_11343724
528 Ga0157374_10253720
529 Ga0157378_11124778
530 Ga0157372_10034496
531 Ga0157372_10136688
532 Ga0157372_10369123
533 Ga0157372_11914355
534 Ga0157375_10704017
535 Ga0182008_10002491
536 Ga0157376_11130337
537 Ga0182006_1067001
538 Ga0182007_10040600
539 Ga0206356_11699489
540 Ga0206356_11856608
541 Ga0206349_1467375
542 Ga0206354_10355131
543 Ga0206354_11338570
544 Ga0213874_10179509
545 Ga0207685_10676554
546 Ga0207705_10051656
547 Ga0207705_10135198
548 Ga0207705_10508319
549 Ga0207684_10278790
550 Ga0207654_11026440
551 Ga0207707_10014419
552 Ga0207707_10019609
553 Ga0207707_10037349
554 Ga0207707_10133377
555 Ga0207707_10236959
556 Ga0207707_10273128
557 Ga0207707_10801160
558 Ga0207695_10355171
559 Ga0207693_10103931
560 Ga0207693_10388093
561 Ga0207693_10744134
562 Ga0207663_10322997
563 Ga0207660_10040934
564 Ga0207660_10072769
565 Ga0207660_11086049
566 Ga0207657_10001525
567 Ga0207657_10002132
568 Ga0207657_10016890
569 Ga0207657_10050120
570 Ga0207649_10059873
571 Ga0207652_10005433
572 Ga0207652_10032305
573 Ga0207652_10190464
574 Ga0207646_10113718
575 Ga0207646_10491669
576 Ga0207694_10098249
577 Ga0207659_10275617
578 Ga0207687_10403912
579 Ga0207687_10509747
580 Ga0207687_10703645
581 Ga0207664_10001849
582 Ga0207690_10186308
583 Ga0207709_10051125
584 Ga0207669_10028364
585 Ga0207691_10547662
586 Ga0207661_10022184
587 Ga0207679_10543030
588 Ga0207679_10672997
589 Ga0207667_10036994
590 Ga0207667_10156621
591 Ga0207667_10490755
592 Ga0207712_10650779
593 Ga0207658_10033480
594 Ga0207703_10686996
595 Ga0207678_10168509
596 Ga0207702_10067145
597 Ga0207702_10098314
598 Ga0207648_10873698
599 Ga0207674_10004404
600 Ga0207674_10009150
601 Ga0207674_10009988
602 Ga0207674_10132111
603 Ga0207683_10045619
604 Ga0268266_10311815
605 Ga0307408_100633253
606 Ga0307405_10261032
607 Ga0307416_100196484
608 Ga0373926_0121168
609 Ga0373944_0021031
610 Ga0373936_0012963
611 Ga0373945_0034251
612 Ga0373954_0345426
613 Ga0373956_0424969
614 Ga0373943_0000091
615 Ga0373946_0011612
616 Ga0373955_0359155
617 Ga0373924_0047576
618 Ga0373935_0049085
619 Ga0373927_0062754
620 Ga0373933_0112703
621 Ga0373947_0000152
622 Ga0373937_0000579
623 Ga0373937_0888657
624 Ga0395899_0010183
625 Ga0395900_0001311
626 Ga0395900_0120677
627 Ga0395900_0282451
628 Ga0395900_0617403
629 Ga0395900_0857702
630 Ga0395900_1508181
631 Ga0395898_0000635
632 Ga0395898_0013721
633 Ga0395898_0066886
634 Ga0395898_0313618
635 Ga0395905_0001334
636 Ga0395905_0094643
637 Ga0395905_0258689
638 Ga0395901_0001474
639 Ga0395901_0012493
640 Ga0395901_0161595
641 Ga0395901_0386138
642 Ga0436365_0413872
643 Ga0436363_0680702
644 Ga0436363_1027712
645 Ga0453683_0738449
646 Ga0466963_0024659
647 Ga0466963_0757252
648 Ga0466964_0298616
649 Ga0466957_0093001
650 Ga0466958_0094867
651 Ga0466958_0505188
652 Ga0466967_0046296
653 Ga0466967_0431057
654 Ga0466967_1474336
655 Ga0495592_0000048
656 Ga0495592_0069081
657 Ga0495592_0386082
658 Ga0495592_0480093
659 Ga0495629_0000592
660 Ga0495641_0006180
661 Ga0495641_0147888
662 Ga0495651_0000049
663 Ga0495651_0308765
664 Ga0495653_0015490
665 Ga0495653_0018108
666 Ga0495653_0065496
667 Ga0495653_0403258
668 Ga0495582_0076833
669 Ga0495605_0017779
670 Ga0495639_0005540
671 Ga0495662_0000257
672 Ga0495664_0063880
673 Ga0495584_0365421
674 Ga0495596_0070821
675 Ga0495607_0472476
676 Ga0495608_0000437
677 Ga0495618_0000786
678 Ga0495628_0000026
679 Ga0495628_0060984
680 Ga0495628_0137786
681 Ga0495630_0003377
682 Ga0495630_0130942
683 Ga0495630_0343341
684 Ga0495666_0281468
685 Ga0495642_0370229
686 Ga0495652_0000172
687 Ga0495652_0094951
688 Ga0495652_0139445
689 Ga0495665_0002192
690 Ga0495640_0014077
691 Ga0495640_0055305
692 Ga0495640_0236922
693 Ga0495586_0354622
694 Ga0495587_0000080
695 Ga0495587_0197082
696 Ga0495609_0129415
697 Ga0495597_0141098
698 Ga0495645_0000016
699 Ga0495645_0087348
700 Ga0495645_0126930
701 Ga0495622_0340204
702 Ga0495667_0012450
703 Ga0495656_0075520
704 Ga0495668_0294257
705 Ga0495634_0043250
706 Ga0495635_0048229
707 Ga0495635_0153704
708 Ga0495635_0384075
709 Ga0495635_0950944
710 Ga0495659_0271650
711 Ga0495588_0042274
712 Ga0495657_0023892
713 Ga0495657_0072096
714 Ga0495599_0000016
715 Ga0495599_0452074
716 Ga0495623_0000046
717 Ga0495623_0194062
718 Ga0495646_0000201
719 Ga0495647_0024442
720 Ga0495658_0000149
721 Ga0495658_0278232
722 Ga0495613_0000639
723 Ga0495624_0010098
724 Ga0495670_0487280
725 Ga0495600_0028375
726 Ga0495600_0041710
727 Ga0495600_0055305
728 Ga0495600_0057227
729 Ga0495600_0154686
730 Ga0495581_0000188
731 Ga0495604_0000004
732 Ga0495604_0123787
733 Ga0495604_0335677
734 Ga0495604_0743459
735 Ga0495674_0014456
736 Ga0495674_0074919
737 Ga0495676_0012454
738 Ga0495676_0270297
739 Ga0495680_0005890
740 Ga0495680_0007800
741 Ga0495680_0012368
742 Ga0495680_0034919
743 Ga0495680_0266136
744 Ga0495675_0000033
745 Ga0495675_0229395
746 Ga0495684_0003470
747 Ga0495684_0009467
748 Ga0495684_0152717
749 Ga0495684_0946653
750 Ga0495593_0118182
751 Ga0495602_0000036
752 Ga0495602_0289148
753 Ga0495602_0621775
754 Ga0495602_0696834
755 Ga0496100_0459871
756 Ga0496101_0253496
757 Ga0496102_0083874
758 Ga0496102_0463733
759 Ga0496103_0098826
760 Ga0496104_0057735
761 Ga0496104_0241201
762 Ga0496104_0265174
763 Ga0496104_0880577
764 Ga0496105_0064711
765 Ga0496105_0191157
766 Ga0496105_0572069
767 Ga0496106_0302105
768 Ga0496106_0326118
769 Ga0496106_1127144
770 Ga0496107_0066149
771 Ga0496107_0163121
772 Ga0496108_0001649
773 Ga0496108_0129635
774 Ga0496109_0001364
775 Ga0496109_0055173
776 Ga0496109_0110991
777 Ga0496109_2024695
778 Ga0496110_0025630
779 Ga0496110_0037902
780 Ga0496110_0039886
781 Ga0496110_0053158
782 Ga0496110_0332650
783 Ga0496111_0114822
784 Ga0496111_0193870
785 Ga0496111_0495955
786 Ga0496112_0034350
787 Ga0496112_0035989
788 Ga0496112_0098174
789 Ga0496112_0127413
790 Ga0496112_0807741
791 Ga0496113_0081762
792 Ga0496114_0000644
793 Ga0496114_0049248
794 Ga0496114_0484713
795 Ga0496115_0017968
796 Ga0496115_0064649
797 Ga0501067_0042438
798 Ga0501068_0586359
799 Ga0501068_0719262
800 Ga0501069_0061326
801 nmdc:mga0n895_366442_c1
802 nmdc:mga0a205_244682_c1
803 Ga0495601_0002396
804 Ga0495601_0018447
805 Ga0495601_0243774
806 Ga0495601_0388159
807 Ga0495601_0408207
808 Ga0495612_0015027
809 Ga0495612_0282898
810 Ga0495655_0122973
811 Ga0495595_0022360
812 Ga0495595_0029806
813 Ga0495619_0001743
814 Ga0495619_0001850
815 Ga0495619_0006658
816 Ga0495619_0018056
817 Ga0495619_0034753
818 Ga0495619_0776195
819 Ga0587090_077071
820 Ga0530510_0129175

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12802

MarR_2

MarR family

67

127

0.98

PF01047

MarR

MarR family

69

128

0.94

PF22381

Staph_reg_Sar_Rot

Transcriptional regulator SarA/Rot

62

141

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5k5q-assembly1.cif.gz_A structure of aspa-dna complex: novel centromere bindng protein-centromere complex 0.8996 43 123
5k5o-assembly1.cif.gz_C structure of aspa-26mer dna complex 0.893 43 123
5k5o-assembly1.cif.gz_D structure of aspa-26mer dna complex 0.8902 47 123
5k5q-assembly1.cif.gz_C structure of aspa-dna complex: novel centromere bindng protein-centromere complex 0.8837 40 123
5k5q-assembly1.cif.gz_D structure of aspa-dna complex: novel centromere bindng protein-centromere complex 0.8821 40 120
ID Description Score Start End Superfamily
af_Q9VD25_77_142_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9253 42 103 1.10.10.10
af_Q58948_3_81_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.915 40 113 1.10.10.10
af_P32910_88_152_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9138 43 103 1.10.10.10
af_Q69XJ1_51_114_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9132 42 102 1.10.10.10
af_P30852_292_361_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9101 55 104 1.10.10.10
ID Description Score Start End GO Terms
AF-K6GI45-F1-model_v4 Transcriptional regulator 0.9333 7 149 GO:0003677
GO:0003700
GO:0006950
AF-A0A543IV39-F1-model_v4 DNA-binding MarR family transcriptional regulator 0.9323 8 125 GO:0003677
GO:0003700
GO:0006950
AF-A0A7Y1SRK4-F1-model_v4 MarR family transcriptional regulator 0.9315 17 131 GO:0003677
GO:0003700
GO:0006950
AF-U7UGC9-F1-model_v4 MarR family protein 0.9315 5 145 GO:0003677
GO:0003700
AF-A0A3N1GTK6-F1-model_v4 DNA-binding MarR family transcriptional regulator 0.9238 1 147 GO:0003677
GO:0003700
GO:0006950

Map