F437235

General Info

Members Datasets Scaffolds Average Seq Length
410 263 405 110

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_11103487|Ga0105248_111034872
Length 110
Sequence LKLPESSFQTVDWSNEKVEERQGETGKAYWRTRNVGDLRIRLVEYSPNYLADHWCDRGHVLFVLEGELTTELRDGREFSLLPGMSYHVSDNGDPSHRSRTASGARLFIVD

Samples

Sample ID Description Type Environment
1 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
2 2904424332 Duganella sp. 1411 Isolate Rhizosphere
3 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
4 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
5 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
6 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
107 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
108 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
109 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
166 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
172 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
173 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
174 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
177 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
178 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
179 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
180 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
181 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
182 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
183 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
185 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
191 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
192 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
193 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
194 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
195 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
196 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
197 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
198 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
199 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
200 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
201 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
202 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
203 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
204 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
205 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
206 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
207 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
208 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
209 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
210 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
211 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
212 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
213 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
214 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
215 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
216 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
217 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
218 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
219 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
220 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
221 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
222 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
232 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
234 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
235 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
236 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
237 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
238 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
239 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
240 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
241 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
242 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
243 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
244 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
245 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
246 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
247 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
248 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
249 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
250 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
251 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
255 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
256 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
257 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
258 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
259 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
260 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
261 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
262 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
263 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.78
Metatranscriptomes 0
Isolates 1.22

Biome Distribution

Category Percentage (%)
Aerial Root 0.24
Bulb 0
Endosphere 8.29
Nodule 0
Rhizoplane 3.17
Rhizosphere 86.83
Stem 0
Stem Tuber 0
Unclassified 1.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25163J39215_1000091 3300002771 Bacteria 37957
2 JGI25164J39214_1000042 3300002772 Bacteria 126523
3 JGI25164J39214_1000080 3300002772 Bacteria 94261
4 JGI25164J39214_1000081 3300002772 Bacteria 93862
5 JGI25406J46586_10025664 3300003203 Unclassified 2284
6 JGI25165J46597_1000060 3300003214 Bacteria 208907
7 rootL2_10151593 3300003322 Bacteria 4715
8 JGI26141J51220_1004186 3300003503 Bacteria 892
9 Ga0065712_10435894 3300005290 Bacteria 699
10 Ga0065712_10468527 3300005290 Bacteria 672
11 Ga0065715_10172854 3300005293 Unclassified 1533
12 Ga0070676_10006464 3300005328 Bacteria 6264
13 Ga0070676_10594699 3300005328 Bacteria 797
14 Ga0070683_100091800 3300005329 Unclassified 2852
15 Ga0070683_101946179 3300005329 Unclassified 565
16 Ga0070690_100156789 3300005330 Bacteria 1557
17 Ga0070690_101169627 3300005330 Bacteria 612
18 Ga0070670_100008614 3300005331 Bacteria 8706
19 Ga0070670_100634024 3300005331 Bacteria 958
20 Ga0070670_100662566 3300005331 Bacteria 937
21 Ga0068869_100413205 3300005334 Bacteria 1112
22 Ga0068869_100875883 3300005334 Bacteria 776
23 Ga0070682_100033693 3300005337 Bacteria 3114
24 Ga0070660_100269721 3300005339 Unclassified 1391
25 Ga0070689_100056514 3300005340 Unclassified 3043
26 Ga0070689_100201253 3300005340 Bacteria 1626
27 Ga0070687_100648492 3300005343 Bacteria 731
28 Ga0070692_10718285 3300005345 Unclassified 674
29 Ga0070692_11155275 3300005345 Bacteria 549
30 Ga0070668_100003448 3300005347 Bacteria 11674
31 Ga0070668_100306195 3300005347 Bacteria 1334
32 Ga0070669_100007024 3300005353 Bacteria 8095
33 Ga0070669_100024966 3300005353 Bacteria 4290
34 Ga0070669_100065865 3300005353 Bacteria 2669
35 Ga0070675_100088798 3300005354 Bacteria 2587
36 Ga0070675_100271520 3300005354 Unclassified 1488
37 Ga0070675_100339705 3300005354 Bacteria 1330
38 Ga0070671_100161621 3300005355 Bacteria 1893
39 Ga0070673_100005748 3300005364 Bacteria 7980
40 Ga0070673_100067800 3300005364 Bacteria 2854
41 Ga0070673_102030383 3300005364 Bacteria 546
42 Ga0070659_100076045 3300005366 Unclassified 2677
43 Ga0070659_101020340 3300005366 Bacteria 727
44 Ga0070667_100080452 3300005367 Bacteria 2787
45 Ga0070667_100205575 3300005367 Bacteria 1748
46 Ga0070714_100010902 3300005435 Bacteria 7196
47 Ga0070705_100210812 3300005440 Bacteria 1339
48 Ga0070705_100503294 3300005440 Bacteria 920
49 Ga0070700_100230417 3300005441 Bacteria 1318
50 Ga0070694_100345257 3300005444 Bacteria 1152
51 Ga0070678_100231497 3300005456 Bacteria 1541
52 Ga0070678_101548894 3300005456 Unclassified 621
53 Ga0070662_100024738 3300005457 Bacteria 4141
54 Ga0068867_100003770 3300005459 Bacteria 10673
55 Ga0068867_100033438 3300005459 Bacteria 3724
56 Ga0070685_10024633 3300005466 Bacteria 3307
57 Ga0070698_100558870 3300005471 Bacteria 1084
58 Ga0070699_101306385 3300005518 Bacteria 665
59 Ga0070679_101146803 3300005530 Bacteria 722
60 Ga0070679_101460487 3300005530 Bacteria 630
61 Ga0070684_100006042 3300005535 Bacteria 9329
62 Ga0070684_101541061 3300005535 Bacteria 627
63 Ga0068853_100021368 3300005539 Bacteria 5396
64 Ga0068853_101620572 3300005539 Bacteria 627
65 Ga0068853_102221402 3300005539 Bacteria 532
66 Ga0070686_100267757 3300005544 Bacteria 1255
67 Ga0070695_100118144 3300005545 Unclassified 1810
68 Ga0070693_100132229 3300005547 Bacteria 1561
69 Ga0068855_100124154 3300005563 Bacteria 2953
70 Ga0068855_100299846 3300005563 Bacteria 1780
71 Ga0068855_100939121 3300005563 Bacteria 912
72 Ga0070664_100018086 3300005564 Bacteria 5786
73 Ga0070664_100049108 3300005564 Bacteria 3568
74 Ga0070664_100309935 3300005564 Bacteria 1428
75 Ga0070664_100449386 3300005564 Unclassified 1183
76 Ga0070664_100578500 3300005564 Bacteria 1040
77 Ga0070664_100680679 3300005564 Bacteria 957
78 Ga0068857_100051088 3300005577 Unclassified 3666
79 Ga0068857_100393401 3300005577 Bacteria 1289
80 Ga0068856_100551083 3300005614 Bacteria 1174
81 Ga0068856_100558636 3300005614 Bacteria 1166
82 Ga0068856_100929660 3300005614 Unclassified 888
83 Ga0068856_101084813 3300005614 Bacteria 818
84 Ga0070702_100035504 3300005615 Unclassified 2755
85 Ga0068852_101057938 3300005616 Bacteria 831
86 Ga0068859_100000868 3300005617 Bacteria 30827
87 Ga0068859_100105053 3300005617 Bacteria 2884
88 Ga0068859_100724670 3300005617 Bacteria 1084
89 Ga0068864_100215863 3300005618 Bacteria 1768
90 Ga0068864_100380070 3300005618 Bacteria 1338
91 Ga0068864_101266693 3300005618 Bacteria 737
92 Ga0068864_101274775 3300005618 Bacteria 735
93 Ga0068861_100008652 3300005719 Bacteria 7000
94 Ga0068851_10023409 3300005834 Bacteria 3019
95 Ga0068851_10174387 3300005834 Bacteria 1188
96 Ga0068870_10072613 3300005840 Bacteria 1881
97 Ga0068863_100281978 3300005841 Bacteria 1610
98 Ga0068863_100446612 3300005841 Bacteria 1269
99 Ga0068863_100973303 3300005841 Bacteria 851
100 Ga0068863_102236473 3300005841 Bacteria 557
101 Ga0068858_100253451 3300005842 Bacteria 1672
102 Ga0068860_100113701 3300005843 Bacteria 2588
103 Ga0068860_101058613 3300005843 Bacteria 830
104 Ga0068862_100000076 3300005844 Bacteria 117053
105 Ga0068862_100025315 3300005844 Bacteria 4982
106 Ga0068862_102642032 3300005844 Bacteria 514
107 Ga0081539_10000159 3300005985 Bacteria 157561
108 Ga0070717_10088606 3300006028 Bacteria 2609
109 Ga0075368_10063343 3300006042 Bacteria 1483
110 Ga0075363_100018324 3300006048 Bacteria 3487
111 Ga0075363_100950528 3300006048 Bacteria 528
112 Ga0075364_10055066 3300006051 Bacteria 2603
113 Ga0075432_10299373 3300006058 Bacteria 667
114 Ga0075366_10339137 3300006195 Bacteria 922
115 Ga0075366_10671805 3300006195 Bacteria 643
116 Ga0075366_10892251 3300006195 Unclassified 554
117 Ga0097621_100160561 3300006237 Bacteria 1932
118 Ga0075370_10483958 3300006353 Bacteria 746
119 Ga0068871_100303251 3300006358 Bacteria 1402
120 Ga0068871_100642382 3300006358 Bacteria 968
121 Ga0068871_101344773 3300006358 Bacteria 673
122 Ga0068871_102162850 3300006358 Bacteria 530
123 Ga0075428_100063124 3300006844 Bacteria 4055
124 Ga0075430_101460758 3300006846 Bacteria 562
125 Ga0075431_101246176 3300006847 Bacteria 706
126 Ga0075433_10215173 3300006852 Bacteria 1707
127 Ga0075434_100142214 3300006871 Bacteria 2419
128 Ga0075434_100151104 3300006871 Bacteria 2343
129 Ga0075434_100330133 3300006871 Unclassified 1546
130 Ga0075434_101787646 3300006871 Unclassified 622
131 Ga0097620_100000868 3300006931 Bacteria 30827
132 Ga0097620_100105051 3300006931 Bacteria 2884
133 Ga0097620_100724616 3300006931 Bacteria 1084
134 Ga0075435_100938624 3300007076 Bacteria 755
135 Ga0105244_10203224 3300009036 Bacteria 934
136 Ga0105240_10397279 3300009093 Bacteria 1554
137 Ga0111539_10232242 3300009094 Bacteria 2148
138 Ga0105245_10012668 3300009098 Bacteria 7343
139 Ga0105245_10373470 3300009098 Bacteria 1418
140 Ga0105247_10307187 3300009101 Bacteria 1102
141 Ga0105247_10605699 3300009101 Bacteria 813
142 Ga0114129_10086996 3300009147 Bacteria 4334
143 Ga0105241_10239612 3300009174 Bacteria 1533
144 Ga0105241_11146196 3300009174 Bacteria 734
145 Ga0105242_10022132 3300009176 Bacteria 4994
146 Ga0105242_10031839 3300009176 Bacteria 4215
147 Ga0105242_11235956 3300009176 Bacteria 768
148 Ga0105242_11561345 3300009176 Bacteria 692
149 Ga0105248_10046399 3300009177 Bacteria 4869
150 Ga0105248_10115091 3300009177 Bacteria 3033
151 Ga0105248_10433635 3300009177 Unclassified 1480
152 Ga0105248_10461716 3300009177 Bacteria 1431
153 Ga0105248_11103487 3300009177 Bacteria 897
154 Ga0105237_10065312 3300009545 Bacteria 3635
155 Ga0105237_10481510 3300009545 Bacteria 1247
156 Ga0105238_10084866 3300009551 Bacteria 3156
157 Ga0105249_10024568 3300009553 Bacteria 5416
158 Ga0105249_11068096 3300009553 Bacteria 877
159 Ga0105249_11103622 3300009553 Bacteria 863
160 Ga0105239_10772038 3300010375 Bacteria 1100
161 Ga0105246_10041635 3300011119 Bacteria 3106
162 Ga0157370_11241217 3300013104 Bacteria 672
163 Ga0157370_11506886 3300013104 Bacteria 605
164 Ga0157369_10193385 3300013105 Bacteria 2137
165 Ga0157374_10386108 3300013296 Bacteria 1395
166 Ga0157378_10015314 3300013297 Bacteria 6716
167 Ga0163162_10019006 3300013306 Bacteria 6739
168 Ga0163162_10019910 3300013306 Bacteria 6590
169 Ga0163162_10718677 3300013306 Bacteria 1120
170 Ga0163162_11386503 3300013306 Bacteria 800
171 Ga0157372_10019692 3300013307 Bacteria 7273
172 Ga0157375_10093791 3300013308 Bacteria 3068
173 Ga0163163_10026502 3300014325 Bacteria 5542
174 Ga0163163_12214681 3300014325 Bacteria 609
175 Ga0157380_12367935 3300014326 Bacteria 596
176 Ga0157380_12977342 3300014326 Bacteria 539
177 Ga0157379_10030579 3300014968 Bacteria 4794
178 Ga0157379_10042388 3300014968 Bacteria 4064
179 Ga0157379_10199952 3300014968 Bacteria 1807
180 Ga0157379_10769006 3300014968 Bacteria 907
181 Ga0157376_10178686 3300014969 Bacteria 1938
182 Ga0157376_11431496 3300014969 Bacteria 723
183 Ga0157376_12065643 3300014969 Bacteria 608
184 Ga0182007_10150684 3300015262 Bacteria 791
185 Ga0163161_10235717 3300017792 Bacteria 1421
186 Ga0163161_10937339 3300017792 Bacteria 736
187 Ga0209760_100013 3300025207 Bacteria 181451
188 Ga0207427_100011 3300025231 Bacteria 640076
189 Ga0209437_100025 3300025233 Bacteria 561333
190 Ga0209233_1000012 3300025261 Bacteria 1019519
191 Ga0207656_10068072 3300025321 Bacteria 1577
192 Ga0207656_10204829 3300025321 Unclassified 954
193 Ga0207710_10310453 3300025900 Bacteria 798
194 Ga0207688_10039798 3300025901 Bacteria 2611
195 Ga0207647_10179965 3300025904 Bacteria 1228
196 Ga0207645_10088724 3300025907 Bacteria 1988
197 Ga0207643_10258180 3300025908 Bacteria 1075
198 Ga0207654_10950249 3300025911 Bacteria 624
199 Ga0207707_10039606 3300025912 Unclassified 4118
200 Ga0207695_10627898 3300025913 Bacteria 955
201 Ga0207671_10012674 3300025914 Bacteria 6765
202 Ga0207663_10069577 3300025916 Bacteria 2265
203 Ga0207657_10241600 3300025919 Unclassified 1442
204 Ga0207649_10377752 3300025920 Bacteria 1055
205 Ga0207652_10408494 3300025921 Bacteria 1225
206 Ga0207681_10021919 3300025923 Bacteria 4068
207 Ga0207681_10124852 3300025923 Bacteria 1893
208 Ga0207694_10211613 3300025924 Bacteria 1579
209 Ga0207650_10025585 3300025925 Bacteria 4205
210 Ga0207650_11325621 3300025925 Bacteria 613
211 Ga0207659_10010832 3300025926 Bacteria 5741
212 Ga0207659_10153087 3300025926 Bacteria 1802
213 Ga0207687_10120287 3300025927 Bacteria 1963
214 Ga0207687_11033992 3300025927 Bacteria 705
215 Ga0207644_10050747 3300025931 Bacteria 2975
216 Ga0207644_10158781 3300025931 Bacteria 1756
217 Ga0207690_10020254 3300025932 Unclassified 4107
218 Ga0207690_10138888 3300025932 Bacteria 1788
219 Ga0207690_10272042 3300025932 Bacteria 1316
220 Ga0207706_10064515 3300025933 Bacteria 3224
221 Ga0207686_10016929 3300025934 Bacteria 4097
222 Ga0207686_10034798 3300025934 Bacteria 3018
223 Ga0207670_11420580 3300025936 Bacteria 589
224 Ga0207669_11013831 3300025937 Bacteria 698
225 Ga0207691_10003781 3300025940 Bacteria 14699
226 Ga0207711_10169112 3300025941 Bacteria 1983
227 Ga0207689_10399128 3300025942 Bacteria 1146
228 Ga0207689_10798503 3300025942 Bacteria 797
229 Ga0207661_10058284 3300025944 Unclassified 3108
230 Ga0207661_10147610 3300025944 Bacteria 2030
231 Ga0207661_10537314 3300025944 Bacteria 1070
232 Ga0207661_10979476 3300025944 Bacteria 779
233 Ga0207679_10021086 3300025945 Bacteria 4409
234 Ga0207679_10022343 3300025945 Unclassified 4306
235 Ga0207679_10060753 3300025945 Bacteria 2810
236 Ga0207679_10165560 3300025945 Bacteria 1815
237 Ga0207679_10311259 3300025945 Unclassified 1361
238 Ga0207679_11019910 3300025945 Unclassified 759
239 Ga0207679_11263495 3300025945 Bacteria 678
240 Ga0207667_10162376 3300025949 Bacteria 2298
241 Ga0207667_10215914 3300025949 Bacteria 1965
242 Ga0207667_10337605 3300025949 Bacteria 1538
243 Ga0207667_10845834 3300025949 Bacteria 909
244 Ga0207651_10353311 3300025960 Bacteria 1238
245 Ga0207651_11185664 3300025960 Bacteria 685
246 Ga0207668_10092373 3300025972 Bacteria 2227
247 Ga0207668_10685545 3300025972 Bacteria 899
248 Ga0207668_11313869 3300025972 Bacteria 651
249 Ga0207640_11869809 3300025981 Bacteria 543
250 Ga0207658_10184107 3300025986 Bacteria 1731
251 Ga0207658_10287255 3300025986 Bacteria 1412
252 Ga0207658_10528022 3300025986 Bacteria 1054
253 Ga0207658_12196177 3300025986 Unclassified 501
254 Ga0207677_10415598 3300026023 Bacteria 1144
255 Ga0207677_11503591 3300026023 Bacteria 622
256 Ga0207703_10069373 3300026035 Bacteria 2907
257 Ga0207703_11830977 3300026035 Bacteria 583
258 Ga0207639_10344767 3300026041 Bacteria 1329
259 Ga0207708_10259592 3300026075 Bacteria 1402
260 Ga0207708_10564557 3300026075 Bacteria 961
261 Ga0207702_10623211 3300026078 Bacteria 1060
262 Ga0207641_10074020 3300026088 Bacteria 2937
263 Ga0207641_10232257 3300026088 Bacteria 1715
264 Ga0207641_10420904 3300026088 Bacteria 1286
265 Ga0207641_10973292 3300026088 Bacteria 845
266 Ga0207641_11817287 3300026088 Bacteria 611
267 Ga0207648_10043987 3300026089 Bacteria 3919
268 Ga0207676_10508181 3300026095 Bacteria 1145
269 Ga0207674_10093182 3300026116 Bacteria 3001
270 Ga0207674_10129528 3300026116 Bacteria 2487
271 Ga0207674_10587691 3300026116 Bacteria 1076
272 Ga0207675_100002909 3300026118 Bacteria 16840
273 Ga0207683_10033867 3300026121 Bacteria 4438
274 Ga0207683_11012985 3300026121 Bacteria 771
275 Ga0209973_1005862 3300027252 Bacteria 1321
276 Ga0209969_1082810 3300027360 Bacteria 514
277 Ga0209981_1002312 3300027378 Bacteria 2420
278 Ga0209996_1045930 3300027395 Bacteria 655
279 Ga0209984_1012964 3300027424 Bacteria 1090
280 Ga0209968_1006181 3300027526 Bacteria 1802
281 Ga0209982_1005544 3300027552 Bacteria 1824
282 Ga0209983_1001606 3300027665 Bacteria 5001
283 Ga0209971_1002136 3300027682 Bacteria 4808
284 Ga0209813_10049215 3300027866 Bacteria 1311
285 Ga0209974_10033333 3300027876 Bacteria 1709
286 Ga0207428_10428824 3300027907 Bacteria 966
287 Ga0268266_10169433 3300028379 Bacteria 1981
288 Ga0268265_10000054 3300028380 Bacteria 165504
289 Ga0268265_10000795 3300028380 Bacteria 30038
290 Ga0268264_10595289 3300028381 Bacteria 1089
291 Ga0268264_11496123 3300028381 Bacteria 686
292 Ga0265327_10046941 3300031251 Bacteria 2282
293 Ga0307509_10001450 3300031507 Bacteria 40076
294 Ga0307408_100126417 3300031548 Bacteria 1989
295 Ga0307516_10017052 3300031730 Bacteria 7583
296 Ga0307516_10019586 3300031730 Bacteria 7006
297 Ga0307516_10540483 3300031730 Bacteria 819
298 Ga0307412_10939312 3300031911 Bacteria 760
299 Ga0307411_10775576 3300032005 Bacteria 842
300 Ga0307415_100357038 3300032126 Bacteria 1233
301 Ga0373934_0247995 3300035086 Bacteria 736
302 Ga0373952_0121957 3300035092 Bacteria 708
303 Ga0373957_0187242 3300035120 Bacteria 859
304 Ga0373955_0716054 3300035172 Bacteria 614
305 Ga0373961_0344209 3300035241 Bacteria 561
306 Ga0373935_0309850 3300035692 Bacteria 1118
307 Ga0373933_0235874 3300035724 Bacteria 1176
308 Ga0373947_0716247 3300035725 Bacteria 683
309 Ga0373937_0871939 3300036401 Bacteria 849
310 Ga0373937_1005300 3300036401 Unclassified 783
311 Ga0373937_1179412 3300036401 Bacteria 714
312 Ga0373925_0560556 3300037068 Bacteria 940
313 Ga0395899_0002985 3300037312 Bacteria 13526
314 Ga0395899_0011851 3300037312 Bacteria 6674
315 Ga0395900_0156116 3300037418 Bacteria 2330
316 Ga0395900_0373513 3300037418 Bacteria 1395
317 Ga0395900_0780207 3300037418 Bacteria 884
318 Ga0395900_0780261 3300037418 Bacteria 884
319 Ga0395898_0797781 3300037466 Bacteria 884
320 Ga0395898_0797799 3300037466 Bacteria 884
321 Ga0436361_0738220 3300039447 Bacteria 2694
322 Ga0451800_0630852 3300041459 Bacteria 713
323 Ga0466969_0014355 3300044656 Bacteria 4163
324 Ga0466965_0028799 3300044683 Bacteria 2700
325 Ga0466966_0027687 3300044684 Bacteria 3695
326 Ga0466961_0000964 3300044693 Bacteria 17803
327 Ga0466961_0147479 3300044693 Bacteria 1471
328 Ga0453684_0394923 3300044712 Bacteria 1550
329 Ga0466970_0411450 3300044765 Bacteria 772
330 Ga0466957_0234011 3300044842 Bacteria 1217
331 Ga0466959_0010067 3300045049 Bacteria 6742
332 Ga0451576_0039463 3300045051 Bacteria 4997
333 Ga0466967_0021007 3300045976 Bacteria 5289
334 Ga0495627_000633 3300046453 Bacteria 27740
335 Ga0495580_0348656 3300046472 Bacteria 1003
336 Ga0495580_0384456 3300046472 Bacteria 948
337 Ga0495582_0030663 3300046473 Bacteria 2953
338 Ga0495639_0147149 3300046475 Bacteria 1135
339 Ga0495630_0016707 3300046517 Bacteria 5368
340 Ga0495587_0050389 3300046536 Bacteria 2464
341 Ga0495611_0429350 3300046648 Bacteria 603
342 Ga0495588_0212233 3300046674 Bacteria 1022
343 Ga0495657_0173122 3300046675 Bacteria 1328
344 Ga0495658_0090133 3300046683 Bacteria 1814
345 Ga0495649_0075196 3300046694 Bacteria 1809
346 Ga0495604_0255543 3300047317 Bacteria 1193
347 Ga0495674_1279712 3300047319 Bacteria 551
348 Ga0495672_0006619 3300047320 Bacteria 8919
349 Ga0495676_0009455 3300047321 Bacteria 8878
350 Ga0495675_0580927 3300047444 Bacteria 637
351 Ga0495673_0223608 3300047469 Bacteria 696
352 Ga0495615_0282763 3300048090 Bacteria 533
353 Ga0496100_0311113 3300048903 Bacteria 1181
354 Ga0496100_0764980 3300048903 Bacteria 756
355 Ga0496103_0013868 3300048906 Bacteria 4785
356 Ga0496104_0001674 3300048907 Bacteria 19138
357 Ga0496105_0024789 3300048908 Bacteria 4876
358 Ga0496106_1261037 3300048909 Bacteria 575
359 Ga0496109_0958018 3300048912 Bacteria 794
360 Ga0496111_0075929 3300048914 Bacteria 2449
361 Ga0496112_0013416 3300048915 Bacteria 7563
362 Ga0496114_0003039 3300048917 Bacteria 12850
363 Ga0496115_0031279 3300048918 Unclassified 4192
364 Ga0496115_0353843 3300048918 Bacteria 1197
365 Ga0501302_020703 3300049525 Bacteria 566
366 Ga0501034_0677293 3300049571 Bacteria 931
367 Ga0501034_0986023 3300049571 Bacteria 727
368 Ga0501073_0085871 3300049589 Bacteria 2189
369 Ga0501206_113671 3300049653 Bacteria 503
370 Ga0501236_097836 3300049670 Bacteria 572
371 Ga0501255_012652 3300049684 Bacteria 992
372 Ga0501257_054345 3300049686 Bacteria 1003
373 Ga0501271_009365 3300049768 Bacteria 1019
374 Ga0501280_073902 3300049776 Bacteria 615
375 Ga0501283_003790 3300049779 Bacteria 2017
376 Ga0501044_0058222 3300049823 Bacteria 3963
377 Ga0501044_0140808 3300049823 Bacteria 2401
378 Ga0501044_0226417 3300049823 Bacteria 1819
379 nmdc:mga03683_459936_c1 3300050489 Bacteria 613
380 nmdc:mga03n38_40788_c1 3300050490 Bacteria 2019
381 nmdc:mga00v17_47116_c1 3300050491 Bacteria 2610
382 nmdc:mga0yw44_116474_c1 3300050492 Bacteria 1717
383 nmdc:mga0k408_111182_c2 3300050493 Bacteria 753
384 nmdc:mga0k408_240817_c1 3300050493 Bacteria 1080
385 nmdc:mga06z11_116866_c1 3300050494 Bacteria 1484
386 nmdc:mga04h51_7694_c1 3300050495 Bacteria 2855
387 nmdc:mga07m45_107715_c1 3300050496 Bacteria 1603
388 nmdc:mga05p37_149300_c1 3300050507 Bacteria 2259
389 nmdc:mga06r32_268944_c1 3300050510 Bacteria 1692
390 nmdc:mga08y16_179336_c1 3300050511 Bacteria 2199
391 nmdc:mga08y16_52455_c1 3300050511 Bacteria 4267
392 nmdc:mga0n895_274754_c1 3300050512 Bacteria 1709
393 nmdc:mga0n895_86152_c1 3300050512 Bacteria 3137
394 nmdc:mga0a205_107257_c1 3300050515 Bacteria 2691
395 Ga0495601_1082343 3300053077 Bacteria 502
396 Ga0495655_0045272 3300053083 Bacteria 1142
397 Ga0500641_0224080 3300053096 Unclassified 796
398 Ga0500568_0019849 3300053139 Unclassified 2914
399 Ga0500568_0043769 3300053139 Bacteria 1788
400 Ga0500573_0036446 3300053140 Bacteria 2840
401 Ga0500616_0000018 3300053153 Bacteria 610976
402 Ga0500616_0078974 3300053153 Bacteria 1658
403 Ga0500645_006434 3300053730 Bacteria 4194
404 Ga0501084_0020354 3300054114 Bacteria 5533
405 Ga0530510_1065411 3300061734 Unclassified 619

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2844665904 2844669988 105
2 iso_pu_bacteria 2904424332 2904429627 105
3 iso_pu_bacteria 2984499530 2984501176 105
4 iso_pu_bacteria 2998344455 2998345088 105
5 iso_pu_bacteria 3007395558 3007401498 105
6 3300003322 rootL2_10151593 rootL2_101515935 107
7 3300005293 Ga0065715_10172854 Ga0065715_101728542 107
8 3300005328 Ga0070676_10006464 Ga0070676_100064649 107
9 3300005340 Ga0070689_100056514 Ga0070689_1000565143 107
10 3300005345 Ga0070692_10718285 Ga0070692_107182851 107
11 3300005347 Ga0070668_100003448 Ga0070668_10000344813 107
12 3300005353 Ga0070669_100007024 Ga0070669_1000070246 107
13 3300005354 Ga0070675_100271520 Ga0070675_1002715201 107
14 3300005364 Ga0070673_100005748 Ga0070673_1000057482 107
15 3300005459 Ga0068867_100003770 Ga0068867_10000377013 107
16 3300005539 Ga0068853_100021368 Ga0068853_1000213683 107
17 3300005545 Ga0070695_100118144 Ga0070695_1001181442 107
18 3300005615 Ga0070702_100035504 Ga0070702_1000355043 107
19 3300009147 Ga0114129_10086996 Ga0114129_100869965 107
20 3300009176 Ga0105242_11235956 Ga0105242_112359562 107
21 3300014326 Ga0157380_12977342 Ga0157380_129773422 107
22 3300014968 Ga0157379_10042388 Ga0157379_100423886 107
23 3300031730 Ga0307516_10019586 Ga0307516_100195863 107
24 3300035725 Ga0373947_0716247 Ga0373947_0716247_292_615 107
25 3300050507 nmdc:mga05p37_149300_c1 nmdc:mga05p37_149300_c1_1676_1999 107
26 3300050511 nmdc:mga08y16_179336_c1 nmdc:mga08y16_179336_c1_653_976 107
27 3300050512 nmdc:mga0n895_274754_c1 nmdc:mga0n895_274754_c1_302_625 107
28 3300050515 nmdc:mga0a205_107257_c1 nmdc:mga0a205_107257_c1_1398_1721 107
29 3300054114 Ga0501084_0020354 Ga0501084_0020354_2521_2844 107
30 3300002771 JGI25163J39215_1000091 JGI25163J39215_100009130 109
31 3300002772 JGI25164J39214_1000042 JGI25164J39214_100004225 109
32 3300002772 JGI25164J39214_1000080 JGI25164J39214_100008046 109
33 3300002772 JGI25164J39214_1000081 JGI25164J39214_100008132 109
34 3300003203 JGI25406J46586_10025664 JGI25406J46586_100256642 109
35 3300003214 JGI25165J46597_1000060 JGI25165J46597_100006047 109
36 3300003503 JGI26141J51220_1004186 JGI26141J51220_10041862 109
37 3300005290 Ga0065712_10435894 Ga0065712_104358941 109
38 3300005290 Ga0065712_10468527 Ga0065712_104685271 109
39 3300005328 Ga0070676_10594699 Ga0070676_105946992 109
40 3300005329 Ga0070683_100091800 Ga0070683_1000918005 109
41 3300005329 Ga0070683_101946179 Ga0070683_1019461791 109
42 3300005330 Ga0070690_100156789 Ga0070690_1001567893 109
43 3300005330 Ga0070690_101169627 Ga0070690_1011696271 109
44 3300005331 Ga0070670_100008614 Ga0070670_1000086143 109
45 3300005331 Ga0070670_100634024 Ga0070670_1006340242 109
46 3300005331 Ga0070670_100662566 Ga0070670_1006625662 109
47 3300005334 Ga0068869_100413205 Ga0068869_1004132052 109
48 3300005334 Ga0068869_100875883 Ga0068869_1008758832 109
49 3300005337 Ga0070682_100033693 Ga0070682_1000336933 109
50 3300005339 Ga0070660_100269721 Ga0070660_1002697212 109
51 3300005340 Ga0070689_100201253 Ga0070689_1002012534 109
52 3300005343 Ga0070687_100648492 Ga0070687_1006484921 109
53 3300005345 Ga0070692_11155275 Ga0070692_111552751 109
54 3300005347 Ga0070668_100306195 Ga0070668_1003061952 109
55 3300005353 Ga0070669_100024966 Ga0070669_1000249663 109
56 3300005353 Ga0070669_100065865 Ga0070669_1000658653 109
57 3300005354 Ga0070675_100088798 Ga0070675_1000887983 109
58 3300005354 Ga0070675_100339705 Ga0070675_1003397052 109
59 3300005355 Ga0070671_100161621 Ga0070671_1001616213 109
60 3300005364 Ga0070673_100067800 Ga0070673_1000678003 109
61 3300005364 Ga0070673_102030383 Ga0070673_1020303831 109
62 3300005366 Ga0070659_100076045 Ga0070659_1000760451 109
63 3300005366 Ga0070659_101020340 Ga0070659_1010203402 109
64 3300005367 Ga0070667_100080452 Ga0070667_1000804523 109
65 3300005367 Ga0070667_100205575 Ga0070667_1002055753 109
66 3300005435 Ga0070714_100010902 Ga0070714_1000109025 109
67 3300005440 Ga0070705_100210812 Ga0070705_1002108122 109
68 3300005440 Ga0070705_100503294 Ga0070705_1005032942 109
69 3300005441 Ga0070700_100230417 Ga0070700_1002304172 109
70 3300005444 Ga0070694_100345257 Ga0070694_1003452572 109
71 3300005456 Ga0070678_100231497 Ga0070678_1002314971 109
72 3300005456 Ga0070678_101548894 Ga0070678_1015488942 109
73 3300005457 Ga0070662_100024738 Ga0070662_1000247384 109
74 3300005459 Ga0068867_100033438 Ga0068867_1000334382 109
75 3300005466 Ga0070685_10024633 Ga0070685_100246332 109
76 3300005471 Ga0070698_100558870 Ga0070698_1005588702 109
77 3300005518 Ga0070699_101306385 Ga0070699_1013063852 109
78 3300005530 Ga0070679_101146803 Ga0070679_1011468032 109
79 3300005530 Ga0070679_101460487 Ga0070679_1014604871 109
80 3300005535 Ga0070684_100006042 Ga0070684_1000060429 109
81 3300005535 Ga0070684_101541061 Ga0070684_1015410612 109
82 3300005539 Ga0068853_101620572 Ga0068853_1016205721 109
83 3300005539 Ga0068853_102221402 Ga0068853_1022214021 109
84 3300005544 Ga0070686_100267757 Ga0070686_1002677572 109
85 3300005547 Ga0070693_100132229 Ga0070693_1001322293 109
86 3300005563 Ga0068855_100124154 Ga0068855_1001241543 109
87 3300005563 Ga0068855_100299846 Ga0068855_1002998462 109
88 3300005563 Ga0068855_100939121 Ga0068855_1009391212 109
89 3300005564 Ga0070664_100018086 Ga0070664_1000180864 109
90 3300005564 Ga0070664_100049108 Ga0070664_1000491084 109
91 3300005564 Ga0070664_100309935 Ga0070664_1003099352 109
92 3300005564 Ga0070664_100449386 Ga0070664_1004493863 109
93 3300005564 Ga0070664_100578500 Ga0070664_1005785001 109
94 3300005564 Ga0070664_100680679 Ga0070664_1006806792 109
95 3300005577 Ga0068857_100051088 Ga0068857_1000510887 109
96 3300005577 Ga0068857_100393401 Ga0068857_1003934012 109
97 3300005614 Ga0068856_100551083 Ga0068856_1005510832 109
98 3300005614 Ga0068856_100558636 Ga0068856_1005586362 109
99 3300005614 Ga0068856_100929660 Ga0068856_1009296601 109
100 3300005614 Ga0068856_101084813 Ga0068856_1010848131 109
101 3300005616 Ga0068852_101057938 Ga0068852_1010579381 109
102 3300005617 Ga0068859_100000868 Ga0068859_1000008688 109
103 3300005617 Ga0068859_100105053 Ga0068859_1001050533 109
104 3300005617 Ga0068859_100724670 Ga0068859_1007246702 109
105 3300005618 Ga0068864_100215863 Ga0068864_1002158631 109
106 3300005618 Ga0068864_100380070 Ga0068864_1003800702 109
107 3300005618 Ga0068864_101266693 Ga0068864_1012666931 109
108 3300005618 Ga0068864_101274775 Ga0068864_1012747752 109
109 3300005719 Ga0068861_100008652 Ga0068861_1000086528 109
110 3300005834 Ga0068851_10023409 Ga0068851_100234093 109
111 3300005834 Ga0068851_10174387 Ga0068851_101743871 109
112 3300005840 Ga0068870_10072613 Ga0068870_100726133 109
113 3300005841 Ga0068863_100281978 Ga0068863_1002819783 109
114 3300005841 Ga0068863_100446612 Ga0068863_1004466122 109
115 3300005841 Ga0068863_100973303 Ga0068863_1009733032 109
116 3300005841 Ga0068863_102236473 Ga0068863_1022364732 109
117 3300005842 Ga0068858_100253451 Ga0068858_1002534512 109
118 3300005843 Ga0068860_100113701 Ga0068860_1001137014 109
119 3300005843 Ga0068860_101058613 Ga0068860_1010586131 109
120 3300005844 Ga0068862_100000076 Ga0068862_10000007647 109
121 3300005844 Ga0068862_100025315 Ga0068862_1000253154 109
122 3300005844 Ga0068862_102642032 Ga0068862_1026420321 109
123 3300005985 Ga0081539_10000159 Ga0081539_10000159142 109
124 3300006028 Ga0070717_10088606 Ga0070717_100886064 109
125 3300006042 Ga0075368_10063343 Ga0075368_100633432 109
126 3300006048 Ga0075363_100018324 Ga0075363_1000183244 109
127 3300006048 Ga0075363_100950528 Ga0075363_1009505281 109
128 3300006051 Ga0075364_10055066 Ga0075364_100550664 109
129 3300006058 Ga0075432_10299373 Ga0075432_102993732 109
130 3300006195 Ga0075366_10339137 Ga0075366_103391372 109
131 3300006195 Ga0075366_10671805 Ga0075366_106718052 109
132 3300006195 Ga0075366_10892251 Ga0075366_108922511 109
133 3300006237 Ga0097621_100160561 Ga0097621_1001605612 109
134 3300006353 Ga0075370_10483958 Ga0075370_104839582 109
135 3300006358 Ga0068871_100303251 Ga0068871_1003032512 109
136 3300006358 Ga0068871_100642382 Ga0068871_1006423822 109
137 3300006358 Ga0068871_101344773 Ga0068871_1013447731 109
138 3300006358 Ga0068871_102162850 Ga0068871_1021628501 109
139 3300006844 Ga0075428_100063124 Ga0075428_1000631244 109
140 3300006846 Ga0075430_101460758 Ga0075430_1014607582 109
141 3300006847 Ga0075431_101246176 Ga0075431_1012461762 109
142 3300006852 Ga0075433_10215173 Ga0075433_102151733 109
143 3300006871 Ga0075434_100142214 Ga0075434_1001422143 109
144 3300006871 Ga0075434_100151104 Ga0075434_1001511042 109
145 3300006871 Ga0075434_100330133 Ga0075434_1003301332 109
146 3300006871 Ga0075434_101787646 Ga0075434_1017876461 109
147 3300006931 Ga0097620_100000868 Ga0097620_1000008688 109
148 3300006931 Ga0097620_100105051 Ga0097620_1001050513 109
149 3300006931 Ga0097620_100724616 Ga0097620_1007246162 109
150 3300007076 Ga0075435_100938624 Ga0075435_1009386242 109
151 3300009036 Ga0105244_10203224 Ga0105244_102032241 109
152 3300009093 Ga0105240_10397279 Ga0105240_103972792 109
153 3300009094 Ga0111539_10232242 Ga0111539_102322422 109
154 3300009098 Ga0105245_10012668 Ga0105245_100126685 109
155 3300009098 Ga0105245_10373470 Ga0105245_103734703 109
156 3300009101 Ga0105247_10307187 Ga0105247_103071872 109
157 3300009101 Ga0105247_10605699 Ga0105247_106056991 109
158 3300009174 Ga0105241_10239612 Ga0105241_102396122 109
159 3300009174 Ga0105241_11146196 Ga0105241_111461962 109
160 3300009176 Ga0105242_10022132 Ga0105242_100221323 109
161 3300009176 Ga0105242_10031839 Ga0105242_100318394 109
162 3300009176 Ga0105242_11561345 Ga0105242_115613452 109
163 3300009177 Ga0105248_10046399 Ga0105248_100463997 109
164 3300009177 Ga0105248_10115091 Ga0105248_101150913 109
165 3300009177 Ga0105248_10433635 Ga0105248_104336351 109
166 3300009177 Ga0105248_10461716 Ga0105248_104617162 109
167 3300009177 Ga0105248_11103487 Ga0105248_111034872 109
168 3300009545 Ga0105237_10065312 Ga0105237_100653122 109
169 3300009545 Ga0105237_10481510 Ga0105237_104815102 109
170 3300009551 Ga0105238_10084866 Ga0105238_100848662 109
171 3300009553 Ga0105249_10024568 Ga0105249_100245684 109
172 3300009553 Ga0105249_11068096 Ga0105249_110680962 109
173 3300009553 Ga0105249_11103622 Ga0105249_111036222 109
174 3300010375 Ga0105239_10772038 Ga0105239_107720381 109
175 3300011119 Ga0105246_10041635 Ga0105246_100416354 109
176 3300013104 Ga0157370_11241217 Ga0157370_112412171 109
177 3300013104 Ga0157370_11506886 Ga0157370_115068862 109
178 3300013105 Ga0157369_10193385 Ga0157369_101933852 109
179 3300013296 Ga0157374_10386108 Ga0157374_103861082 109
180 3300013297 Ga0157378_10015314 Ga0157378_1001531410 109
181 3300013306 Ga0163162_10019006 Ga0163162_100190066 109
182 3300013306 Ga0163162_10019910 Ga0163162_100199107 109
183 3300013306 Ga0163162_10718677 Ga0163162_107186772 109
184 3300013306 Ga0163162_11386503 Ga0163162_113865031 109
185 3300013307 Ga0157372_10019692 Ga0157372_100196928 109
186 3300013308 Ga0157375_10093791 Ga0157375_100937913 109
187 3300014325 Ga0163163_10026502 Ga0163163_100265026 109
188 3300014325 Ga0163163_12214681 Ga0163163_122146812 109
189 3300014326 Ga0157380_12367935 Ga0157380_123679352 109
190 3300014968 Ga0157379_10030579 Ga0157379_100305796 109
191 3300014968 Ga0157379_10199952 Ga0157379_101999521 109
192 3300014968 Ga0157379_10769006 Ga0157379_107690062 109
193 3300014969 Ga0157376_10178686 Ga0157376_101786863 109
194 3300014969 Ga0157376_11431496 Ga0157376_114314962 109
195 3300014969 Ga0157376_12065643 Ga0157376_120656432 109
196 3300015262 Ga0182007_10150684 Ga0182007_101506842 109
197 3300017792 Ga0163161_10235717 Ga0163161_102357172 109
198 3300017792 Ga0163161_10937339 Ga0163161_109373392 109
199 3300025207 Ga0209760_100013 Ga0209760_10001326 109
200 3300025231 Ga0207427_100011 Ga0207427_100011415 109
201 3300025233 Ga0209437_100025 Ga0209437_100025155 109
202 3300025261 Ga0209233_1000012 Ga0209233_1000012674 109
203 3300025321 Ga0207656_10068072 Ga0207656_100680722 109
204 3300025321 Ga0207656_10204829 Ga0207656_102048291 109
205 3300025900 Ga0207710_10310453 Ga0207710_103104532 109
206 3300025901 Ga0207688_10039798 Ga0207688_100397982 109
207 3300025904 Ga0207647_10179965 Ga0207647_101799653 109
208 3300025907 Ga0207645_10088724 Ga0207645_100887243 109
209 3300025908 Ga0207643_10258180 Ga0207643_102581802 109
210 3300025911 Ga0207654_10950249 Ga0207654_109502491 109
211 3300025912 Ga0207707_10039606 Ga0207707_100396068 109
212 3300025913 Ga0207695_10627898 Ga0207695_106278982 109
213 3300025914 Ga0207671_10012674 Ga0207671_100126744 109
214 3300025916 Ga0207663_10069577 Ga0207663_100695771 109
215 3300025919 Ga0207657_10241600 Ga0207657_102416002 109
216 3300025920 Ga0207649_10377752 Ga0207649_103777521 109
217 3300025921 Ga0207652_10408494 Ga0207652_104084941 109
218 3300025923 Ga0207681_10021919 Ga0207681_100219193 109
219 3300025923 Ga0207681_10124852 Ga0207681_101248522 109
220 3300025924 Ga0207694_10211613 Ga0207694_102116133 109
221 3300025925 Ga0207650_10025585 Ga0207650_100255853 109
222 3300025925 Ga0207650_11325621 Ga0207650_113256211 109
223 3300025926 Ga0207659_10010832 Ga0207659_100108324 109
224 3300025926 Ga0207659_10153087 Ga0207659_101530873 109
225 3300025927 Ga0207687_10120287 Ga0207687_101202873 109
226 3300025927 Ga0207687_11033992 Ga0207687_110339922 109
227 3300025931 Ga0207644_10050747 Ga0207644_100507472 109
228 3300025931 Ga0207644_10158781 Ga0207644_101587812 109
229 3300025932 Ga0207690_10020254 Ga0207690_100202545 109
230 3300025932 Ga0207690_10138888 Ga0207690_101388882 109
231 3300025932 Ga0207690_10272042 Ga0207690_102720422 109
232 3300025933 Ga0207706_10064515 Ga0207706_100645153 109
233 3300025934 Ga0207686_10016929 Ga0207686_100169293 109
234 3300025934 Ga0207686_10034798 Ga0207686_100347984 109
235 3300025936 Ga0207670_11420580 Ga0207670_114205802 109
236 3300025937 Ga0207669_11013831 Ga0207669_110138312 109
237 3300025940 Ga0207691_10003781 Ga0207691_100037819 109
238 3300025941 Ga0207711_10169112 Ga0207711_101691122 109
239 3300025942 Ga0207689_10399128 Ga0207689_103991282 109
240 3300025942 Ga0207689_10798503 Ga0207689_107985031 109
241 3300025944 Ga0207661_10058284 Ga0207661_100582843 109
242 3300025944 Ga0207661_10147610 Ga0207661_101476103 109
243 3300025944 Ga0207661_10537314 Ga0207661_105373142 109
244 3300025944 Ga0207661_10979476 Ga0207661_109794761 109
245 3300025945 Ga0207679_10021086 Ga0207679_100210862 109
246 3300025945 Ga0207679_10022343 Ga0207679_100223438 109
247 3300025945 Ga0207679_10060753 Ga0207679_100607533 109
248 3300025945 Ga0207679_10165560 Ga0207679_101655603 109
249 3300025945 Ga0207679_10311259 Ga0207679_103112591 109
250 3300025945 Ga0207679_11019910 Ga0207679_110199102 109
251 3300025945 Ga0207679_11263495 Ga0207679_112634952 109
252 3300025949 Ga0207667_10162376 Ga0207667_101623762 109
253 3300025949 Ga0207667_10215914 Ga0207667_102159143 109
254 3300025949 Ga0207667_10337605 Ga0207667_103376052 109
255 3300025949 Ga0207667_10845834 Ga0207667_108458342 109
256 3300025960 Ga0207651_10353311 Ga0207651_103533112 109
257 3300025960 Ga0207651_11185664 Ga0207651_111856642 109
258 3300025972 Ga0207668_10092373 Ga0207668_100923733 109
259 3300025972 Ga0207668_10685545 Ga0207668_106855452 109
260 3300025972 Ga0207668_11313869 Ga0207668_113138692 109
261 3300025981 Ga0207640_11869809 Ga0207640_118698092 109
262 3300025986 Ga0207658_10184107 Ga0207658_101841072 109
263 3300025986 Ga0207658_10287255 Ga0207658_102872552 109
264 3300025986 Ga0207658_10528022 Ga0207658_105280222 109
265 3300025986 Ga0207658_12196177 Ga0207658_121961771 109
266 3300026023 Ga0207677_10415598 Ga0207677_104155982 109
267 3300026023 Ga0207677_11503591 Ga0207677_115035912 109
268 3300026035 Ga0207703_10069373 Ga0207703_100693733 109
269 3300026035 Ga0207703_11830977 Ga0207703_118309772 109
270 3300026041 Ga0207639_10344767 Ga0207639_103447672 109
271 3300026075 Ga0207708_10259592 Ga0207708_102595922 109
272 3300026075 Ga0207708_10564557 Ga0207708_105645573 109
273 3300026078 Ga0207702_10623211 Ga0207702_106232112 109
274 3300026088 Ga0207641_10074020 Ga0207641_100740205 109
275 3300026088 Ga0207641_10232257 Ga0207641_102322573 109
276 3300026088 Ga0207641_10420904 Ga0207641_104209042 109
277 3300026088 Ga0207641_10973292 Ga0207641_109732921 109
278 3300026088 Ga0207641_11817287 Ga0207641_118172872 109
279 3300026089 Ga0207648_10043987 Ga0207648_100439872 109
280 3300026095 Ga0207676_10508181 Ga0207676_105081813 109
281 3300026116 Ga0207674_10093182 Ga0207674_100931822 109
282 3300026116 Ga0207674_10129528 Ga0207674_101295283 109
283 3300026116 Ga0207674_10587691 Ga0207674_105876911 109
284 3300026118 Ga0207675_100002909 Ga0207675_10000290912 109
285 3300026121 Ga0207683_10033867 Ga0207683_100338675 109
286 3300026121 Ga0207683_11012985 Ga0207683_110129852 109
287 3300027252 Ga0209973_1005862 Ga0209973_10058622 109
288 3300027360 Ga0209969_1082810 Ga0209969_10828101 109
289 3300027378 Ga0209981_1002312 Ga0209981_10023122 109
290 3300027395 Ga0209996_1045930 Ga0209996_10459302 109
291 3300027424 Ga0209984_1012964 Ga0209984_10129641 109
292 3300027526 Ga0209968_1006181 Ga0209968_10061812 109
293 3300027552 Ga0209982_1005544 Ga0209982_10055442 109
294 3300027665 Ga0209983_1001606 Ga0209983_10016063 109
295 3300027682 Ga0209971_1002136 Ga0209971_10021362 109
296 3300027866 Ga0209813_10049215 Ga0209813_100492153 109
297 3300027876 Ga0209974_10033333 Ga0209974_100333332 109
298 3300027907 Ga0207428_10428824 Ga0207428_104288241 109
299 3300028379 Ga0268266_10169433 Ga0268266_101694332 109
300 3300028380 Ga0268265_10000054 Ga0268265_1000005412 109
301 3300028380 Ga0268265_10000795 Ga0268265_1000079522 109
302 3300028381 Ga0268264_10595289 Ga0268264_105952892 109
303 3300028381 Ga0268264_11496123 Ga0268264_114961232 109
304 3300031251 Ga0265327_10046941 Ga0265327_100469414 109
305 3300031507 Ga0307509_10001450 Ga0307509_1000145022 109
306 3300031548 Ga0307408_100126417 Ga0307408_1001264172 109
307 3300031730 Ga0307516_10017052 Ga0307516_100170525 109
308 3300031730 Ga0307516_10540483 Ga0307516_105404832 109
309 3300031911 Ga0307412_10939312 Ga0307412_109393121 109
310 3300032005 Ga0307411_10775576 Ga0307411_107755761 109
311 3300032126 Ga0307415_100357038 Ga0307415_1003570382 109
312 3300035086 Ga0373934_0247995 Ga0373934_0247995_81_410 109
313 3300035092 Ga0373952_0121957 Ga0373952_0121957_146_475 109
314 3300035120 Ga0373957_0187242 Ga0373957_0187242_405_734 109
315 3300035172 Ga0373955_0716054 Ga0373955_0716054_112_441 109
316 3300035241 Ga0373961_0344209 Ga0373961_0344209_216_545 109
317 3300035692 Ga0373935_0309850 Ga0373935_0309850_216_545 109
318 3300035724 Ga0373933_0235874 Ga0373933_0235874_797_1126 109
319 3300036401 Ga0373937_0871939 Ga0373937_0871939_235_564 109
320 3300036401 Ga0373937_1005300 Ga0373937_1005300_185_514 109
321 3300036401 Ga0373937_1179412 Ga0373937_1179412_14_343 109
322 3300037068 Ga0373925_0560556 Ga0373925_0560556_232_561 109
323 3300037312 Ga0395899_0002985 Ga0395899_0002985_3420_3749 109
324 3300037312 Ga0395899_0011851 Ga0395899_0011851_3479_3808 109
325 3300037418 Ga0395900_0156116 Ga0395900_0156116_141_470 109
326 3300037418 Ga0395900_0373513 Ga0395900_0373513_397_726 109
327 3300037418 Ga0395900_0780207 Ga0395900_0780207_203_532 109
328 3300037418 Ga0395900_0780261 Ga0395900_0780261_353_682 109
329 3300037466 Ga0395898_0797781 Ga0395898_0797781_353_682 109
330 3300037466 Ga0395898_0797799 Ga0395898_0797799_353_682 109
331 3300039447 Ga0436361_0738220 Ga0436361_0738220_297_626 109
332 3300041459 Ga0451800_0630852 Ga0451800_0630852_143_538 109
333 3300044656 Ga0466969_0014355 Ga0466969_0014355_2126_2455 109
334 3300044683 Ga0466965_0028799 Ga0466965_0028799_1078_1407 109
335 3300044684 Ga0466966_0027687 Ga0466966_0027687_3052_3381 109
336 3300044693 Ga0466961_0000964 Ga0466961_0000964_10711_11040 109
337 3300044693 Ga0466961_0147479 Ga0466961_0147479_144_473 109
338 3300044712 Ga0453684_0394923 Ga0453684_0394923_888_1217 109
339 3300044765 Ga0466970_0411450 Ga0466970_0411450_94_423 109
340 3300044842 Ga0466957_0234011 Ga0466957_0234011_422_751 109
341 3300045049 Ga0466959_0010067 Ga0466959_0010067_6072_6401 109
342 3300045051 Ga0451576_0039463 Ga0451576_0039463_1509_1871 109
343 3300045976 Ga0466967_0021007 Ga0466967_0021007_3935_4264 109
344 3300046453 Ga0495627_000633 Ga0495627_000633_17165_17494 109
345 3300046472 Ga0495580_0348656 Ga0495580_0348656_96_425 109
346 3300046472 Ga0495580_0384456 Ga0495580_0384456_301_630 109
347 3300046473 Ga0495582_0030663 Ga0495582_0030663_820_1149 109
348 3300046475 Ga0495639_0147149 Ga0495639_0147149_573_902 109
349 3300046517 Ga0495630_0016707 Ga0495630_0016707_1813_2142 109
350 3300046536 Ga0495587_0050389 Ga0495587_0050389_291_620 109
351 3300046648 Ga0495611_0429350 Ga0495611_0429350_190_519 109
352 3300046674 Ga0495588_0212233 Ga0495588_0212233_525_854 109
353 3300046675 Ga0495657_0173122 Ga0495657_0173122_751_1080 109
354 3300046683 Ga0495658_0090133 Ga0495658_0090133_32_361 109
355 3300046694 Ga0495649_0075196 Ga0495649_0075196_854_1222 109
356 3300047317 Ga0495604_0255543 Ga0495604_0255543_674_1003 109
357 3300047319 Ga0495674_1279712 Ga0495674_1279712_188_517 109
358 3300047320 Ga0495672_0006619 Ga0495672_0006619_2987_3316 109
359 3300047321 Ga0495676_0009455 Ga0495676_0009455_242_571 109
360 3300047444 Ga0495675_0580927 Ga0495675_0580927_13_342 109
361 3300047469 Ga0495673_0223608 Ga0495673_0223608_305_634 109
362 3300048090 Ga0495615_0282763 Ga0495615_0282763_20_349 109
363 3300048903 Ga0496100_0311113 Ga0496100_0311113_90_419 109
364 3300048903 Ga0496100_0764980 Ga0496100_0764980_385_714 109
365 3300048906 Ga0496103_0013868 Ga0496103_0013868_1860_2189 109
366 3300048907 Ga0496104_0001674 Ga0496104_0001674_16791_17120 109
367 3300048908 Ga0496105_0024789 Ga0496105_0024789_2194_2523 109
368 3300048909 Ga0496106_1261037 Ga0496106_1261037_87_416 109
369 3300048912 Ga0496109_0958018 Ga0496109_0958018_420_749 109
370 3300048914 Ga0496111_0075929 Ga0496111_0075929_1449_1778 109
371 3300048915 Ga0496112_0013416 Ga0496112_0013416_2894_3223 109
372 3300048917 Ga0496114_0003039 Ga0496114_0003039_473_802 109
373 3300048918 Ga0496115_0031279 Ga0496115_0031279_2363_2692 109
374 3300048918 Ga0496115_0353843 Ga0496115_0353843_199_528 109
375 3300049525 Ga0501302_020703 Ga0501302_020703_214_543 109
376 3300049571 Ga0501034_0677293 Ga0501034_0677293_568_900 109
377 3300049571 Ga0501034_0986023 Ga0501034_0986023_376_708 109
378 3300049589 Ga0501073_0085871 Ga0501073_0085871_1644_1973 109
379 3300049653 Ga0501206_113671 Ga0501206_113671_146_475 109
380 3300049670 Ga0501236_097836 Ga0501236_097836_55_384 109
381 3300049684 Ga0501255_012652 Ga0501255_012652_364_693 109
382 3300049686 Ga0501257_054345 Ga0501257_054345_89_418 109
383 3300049768 Ga0501271_009365 Ga0501271_009365_500_829 109
384 3300049776 Ga0501280_073902 Ga0501280_073902_271_600 109
385 3300049779 Ga0501283_003790 Ga0501283_003790_298_627 109
386 3300049823 Ga0501044_0058222 Ga0501044_0058222_461_790 109
387 3300049823 Ga0501044_0140808 Ga0501044_0140808_1137_1466 109
388 3300049823 Ga0501044_0226417 Ga0501044_0226417_1141_1473 109
389 3300050489 nmdc:mga03683_459936_c1 nmdc:mga03683_459936_c1_264_593 109
390 3300050490 nmdc:mga03n38_40788_c1 nmdc:mga03n38_40788_c1_1532_1861 109
391 3300050491 nmdc:mga00v17_47116_c1 nmdc:mga00v17_47116_c1_1098_1427 109
392 3300050492 nmdc:mga0yw44_116474_c1 nmdc:mga0yw44_116474_c1_1101_1430 109
393 3300050493 nmdc:mga0k408_111182_c2 nmdc:mga0k408_111182_c2_145_474 109
394 3300050493 nmdc:mga0k408_240817_c1 nmdc:mga0k408_240817_c1_425_754 109
395 3300050494 nmdc:mga06z11_116866_c1 nmdc:mga06z11_116866_c1_223_552 109
396 3300050495 nmdc:mga04h51_7694_c1 nmdc:mga04h51_7694_c1_1532_1861 109
397 3300050496 nmdc:mga07m45_107715_c1 nmdc:mga07m45_107715_c1_1077_1406 109
398 3300050510 nmdc:mga06r32_268944_c1 nmdc:mga06r32_268944_c1_874_1203 109
399 3300050511 nmdc:mga08y16_52455_c1 nmdc:mga08y16_52455_c1_1556_1885 109
400 3300050512 nmdc:mga0n895_86152_c1 nmdc:mga0n895_86152_c1_1318_1647 109
401 3300053077 Ga0495601_1082343 Ga0495601_1082343_60_389 109
402 3300053083 Ga0495655_0045272 Ga0495655_0045272_138_467 109
403 3300053096 Ga0500641_0224080 Ga0500641_0224080_153_482 109
404 3300053139 Ga0500568_0019849 Ga0500568_0019849_2370_2699 109
405 3300053139 Ga0500568_0043769 Ga0500568_0043769_845_1174 109
406 3300053140 Ga0500573_0036446 Ga0500573_0036446_374_703 109
407 3300053153 Ga0500616_0000018 Ga0500616_0000018_291771_292100 109
408 3300053153 Ga0500616_0078974 Ga0500616_0078974_1274_1603 109
409 3300053730 Ga0500645_006434 Ga0500645_006434_835_1173 109
410 3300061734 Ga0530510_1065411 Ga0530510_1065411_233_562 109

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kv4-assembly1.cif.gz_A structure of phf8 in complex with histone h3 0.8781 40 107
6u4l-assembly1.cif.gz_A cysteine dioxygenase variant - c93e 0.8679 28 108
6vzy-assembly1.cif.gz_B crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 with a diiron(ii) central domain cofactor 0.8677 40 108
8f8z-assembly2.cif.gz_B phf2 (phd+jmj) in complex with h3 histone n-terminal peptide 0.8668 40 107
8f8z-assembly1.cif.gz_A phf2 (phd+jmj) in complex with h3 histone n-terminal peptide 0.866 40 107
ID Description Score Start End Superfamily
af_Q5RHD1_1_363_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.8826 40 107 2.60.120.650
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8658 30 108 2.60.120.10
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8581 28 108 2.60.120.10
3elnA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8544 28 108 2.60.120.10
af_O86372_11_115_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8543 28 108 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A8B6KSK9-F1-model_v4 deleted 1.003 44 109
AF-F4MYE7-F1-model_v4 Cupin 2 conserved barrel domain-containing protein 1.002 17 109
AF-A0A127Q2B0-F1-model_v4 Cupin domain protein 0.9986 4 109
AF-A0A4Q5TGD2-F1-model_v4 ChrR-like cupin domain-containing protein 0.9972 5 109
AF-A0A327VKD3-F1-model_v4 ChrR-like protein with cupin domain 0.9948 6 109

Feature Viewer

pLDDT pTM Quality
96.73 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map