F437177

General Info

Members Datasets Scaffolds Average Seq Length
410 195 820 206

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100197179|Ga0070708_1001971791
Length 212
Sequence MPSRLAGLTKLTLETTPSVCHECIWWQSRGRRELDKDRWMERVELDFGAFGTVYYDGDGKVLGSMQYGPSGAFPRAYELPAGPPSEDAILVTCAYLVEESSPWVLQSLFLAAIGEARDRGARGLEAFSYRYPEGESSYERFRVHKTVFPQNFLADFGFQVMRASGRVGLSRLELGGLQPVTEGTREKVLRVVKDAFGVPEGVPAPRPQTPGV

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
48 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
83 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
84 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
85 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
86 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
87 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
88 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
89 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
90 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
91 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
92 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
95 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
96 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
99 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
100 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
101 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
102 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
103 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
105 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
116 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
117 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
118 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
119 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
120 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
121 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
122 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
123 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
124 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
125 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
126 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
127 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
130 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
131 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
132 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
133 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
134 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
135 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
136 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
137 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
138 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
139 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
140 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
141 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
142 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
143 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
144 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
145 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
146 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
147 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
148 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
149 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
150 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
151 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
152 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
153 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
154 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
155 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
156 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
157 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
158 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
159 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
160 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
161 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
162 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
163 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
164 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
165 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
166 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
167 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
168 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
169 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
185 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
187 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
191 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
192 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
193 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
194 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
195 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.05
Metatranscriptomes 1.95
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.54
Rhizosphere 90.73
Stem 0
Stem Tuber 0
Unclassified 10.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100197179 3300005445 Bacteria 1884
2 Ga0070658_10340178 3300005327 Unclassified 1283
3 Ga0070658_10732593 3300005327 Bacteria 859
4 Ga0070683_100006231 3300005329 Bacteria 10005
5 Ga0070683_100052589 3300005329 Bacteria 3774
6 Ga0070683_100086151 3300005329 Bacteria 2945
7 Ga0070683_100089379 3300005329 Bacteria 2891
8 Ga0070683_100517190 3300005329 Bacteria 1140
9 Ga0070683_100793408 3300005329 Bacteria 908
10 Ga0070680_100002965 3300005336 Bacteria 12617
11 Ga0070680_100032672 3300005336 Bacteria 4189
12 Ga0070680_100085769 3300005336 Bacteria 2602
13 Ga0070682_100271760 3300005337 Bacteria 1232
14 Ga0070660_100001406 3300005339 Bacteria 16411
15 Ga0070660_100026224 3300005339 Bacteria 4337
16 Ga0070660_100043662 3300005339 Bacteria 3427
17 Ga0070660_100262462 3300005339 Bacteria 1411
18 Ga0070660_100477627 3300005339 Bacteria 1036
19 Ga0070660_100496066 3300005339 Bacteria 1015
20 Ga0070660_100577016 3300005339 Bacteria 939
21 Ga0070661_100047401 3300005344 Bacteria 3144
22 Ga0070661_100371502 3300005344 Unclassified 1126
23 Ga0070674_100318452 3300005356 Bacteria 1246
24 Ga0070673_100704905 3300005364 Bacteria 927
25 Ga0070659_100020630 3300005366 Bacteria 5009
26 Ga0070659_100268203 3300005366 Bacteria 1418
27 Ga0070667_100024822 3300005367 Bacteria 4981
28 Ga0070709_10360949 3300005434 Bacteria 1076
29 Ga0070714_100656699 3300005435 Bacteria 1010
30 Ga0070714_101415526 3300005435 Bacteria 679
31 Ga0070713_100045005 3300005436 Bacteria 3615
32 Ga0070713_100358656 3300005436 Bacteria 1354
33 Ga0070711_100527617 3300005439 Unclassified 977
34 Ga0070694_100241734 3300005444 Unclassified 1362
35 Ga0070708_100029264 3300005445 Bacteria 4749
36 Ga0070681_10007722 3300005458 Bacteria 10513
37 Ga0070681_10010837 3300005458 Bacteria 9009
38 Ga0070681_10056604 3300005458 Bacteria 3902
39 Ga0070681_10189970 3300005458 Bacteria 1973
40 Ga0068867_100649760 3300005459 Bacteria 925
41 Ga0070699_100254722 3300005518 Bacteria 1569
42 Ga0070679_100002527 3300005530 Bacteria 16579
43 Ga0070679_100034422 3300005530 Bacteria 5020
44 Ga0070679_100084620 3300005530 Bacteria 3160
45 Ga0070679_100084771 3300005530 Bacteria 3156
46 Ga0070679_100203902 3300005530 Bacteria 1943
47 Ga0070684_100001220 3300005535 Bacteria 18471
48 Ga0070684_100021833 3300005535 Bacteria 5333
49 Ga0070684_100033782 3300005535 Bacteria 4370
50 Ga0070684_100228535 3300005535 Bacteria 1699
51 Ga0070684_100364795 3300005535 Bacteria 1329
52 Ga0070696_100134215 3300005546 Unclassified 1804
53 Ga0070696_100142518 3300005546 Bacteria 1753
54 Ga0070665_100111106 3300005548 Bacteria 2743
55 Ga0068855_100006830 3300005563 Bacteria 13844
56 Ga0068855_100027629 3300005563 Bacteria 6787
57 Ga0068855_100098422 3300005563 Bacteria 3369
58 Ga0068855_100142664 3300005563 Bacteria 2728
59 Ga0068855_100316378 3300005563 Bacteria 1726
60 Ga0068855_100465558 3300005563 Bacteria 1378
61 Ga0070664_100057770 3300005564 Bacteria 3299
62 Ga0068857_100044631 3300005577 Bacteria 3932
63 Ga0068857_100092636 3300005577 Bacteria 2706
64 Ga0068857_100355688 3300005577 Bacteria 1357
65 Ga0068856_100061915 3300005614 Bacteria 3696
66 Ga0068856_100557998 3300005614 Unclassified 1166
67 Ga0068852_100028819 3300005616 Bacteria 4549
68 Ga0068852_100122576 3300005616 Bacteria 2383
69 Ga0068866_10262304 3300005718 Bacteria 1062
70 Ga0068851_10482707 3300005834 Unclassified 741
71 Ga0081455_10077150 3300005937 Bacteria 2742
72 Ga0070715_10205020 3300006163 Unclassified 1004
73 Ga0105240_10054872 3300009093 Bacteria 4991
74 Ga0105240_10098649 3300009093 Bacteria 3557
75 Ga0105240_10298155 3300009093 Bacteria 1845
76 Ga0105245_10421300 3300009098 Unclassified 1338
77 Ga0105245_10736249 3300009098 Bacteria 1021
78 Ga0105245_11066463 3300009098 Bacteria 854
79 Ga0105242_10076065 3300009176 Bacteria 2798
80 Ga0105242_10605151 3300009176 Unclassified 1059
81 Ga0105248_11733430 3300009177 Unclassified 708
82 Ga0105237_10064168 3300009545 Bacteria 3669
83 Ga0105237_10076912 3300009545 Bacteria 3328
84 Ga0105238_10481647 3300009551 Unclassified 1240
85 Ga0105239_10180111 3300010375 Bacteria 2364
86 Ga0157373_10066697 3300013100 Bacteria 2545
87 Ga0157370_10095255 3300013104 Bacteria 2793
88 Ga0157370_10162111 3300013104 Bacteria 2080
89 Ga0157370_10278246 3300013104 Unclassified 1546
90 Ga0157370_10347123 3300013104 Bacteria 1368
91 Ga0157369_10070924 3300013105 Bacteria 3742
92 Ga0157369_10100048 3300013105 Bacteria 3090
93 Ga0157369_10133719 3300013105 Bacteria 2627
94 Ga0157369_10400039 3300013105 Bacteria 1425
95 Ga0157369_10812268 3300013105 Bacteria 960
96 Ga0157374_10095945 3300013296 Bacteria 2836
97 Ga0157374_10529019 3300013296 Bacteria 1185
98 Ga0157374_11068720 3300013296 Bacteria 827
99 Ga0157378_10853045 3300013297 Bacteria 939
100 Ga0157372_10015478 3300013307 Bacteria 8176
101 Ga0157372_10731473 3300013307 Bacteria 1151
102 Ga0163163_10895144 3300014325 Unclassified 951
103 Ga0182007_10049470 3300015262 Unclassified 1389
104 Ga0197907_11052110 3300020069 Bacteria 1836
105 Ga0206356_11256080 3300020070 Bacteria 1350
106 Ga0206356_11678481 3300020070 Bacteria 2272
107 Ga0206352_11276596 3300020078 Bacteria 923
108 Ga0206354_10420670 3300020081 Bacteria 1106
109 Ga0206353_10332968 3300020082 Bacteria 5024
110 Ga0206353_11294919 3300020082 Bacteria 2159
111 Ga0224712_10118943 3300022467 Bacteria 1142
112 Ga0207692_10161572 3300025898 Unclassified 1291
113 Ga0207685_10282458 3300025905 Unclassified 815
114 Ga0207699_10548031 3300025906 Bacteria 839
115 Ga0207705_10123573 3300025909 Bacteria 1922
116 Ga0207705_10151431 3300025909 Bacteria 1738
117 Ga0207705_10197358 3300025909 Bacteria 1524
118 Ga0207707_10004915 3300025912 Bacteria 11749
119 Ga0207707_10020828 3300025912 Bacteria 5728
120 Ga0207707_10089451 3300025912 Bacteria 2691
121 Ga0207707_10098802 3300025912 Bacteria 2551
122 Ga0207707_10139835 3300025912 Bacteria 2117
123 Ga0207707_10186423 3300025912 Bacteria 1811
124 Ga0207707_10528278 3300025912 Unclassified 1004
125 Ga0207695_10635231 3300025913 Bacteria 949
126 Ga0207693_10080318 3300025915 Bacteria 2553
127 Ga0207660_10029344 3300025917 Bacteria 3772
128 Ga0207660_10061083 3300025917 Bacteria 2711
129 Ga0207660_10075865 3300025917 Bacteria 2457
130 Ga0207657_10000397 3300025919 Bacteria 46007
131 Ga0207657_10012919 3300025919 Bacteria 8210
132 Ga0207657_10023872 3300025919 Bacteria 5681
133 Ga0207657_10027395 3300025919 Bacteria 5220
134 Ga0207657_10193489 3300025919 Bacteria 1639
135 Ga0207657_10333095 3300025919 Bacteria 1198
136 Ga0207657_10593431 3300025919 Bacteria 865
137 Ga0207649_10271102 3300025920 Unclassified 1230
138 Ga0207652_10069749 3300025921 Bacteria 3052
139 Ga0207652_10109486 3300025921 Bacteria 2449
140 Ga0207652_10173867 3300025921 Bacteria 1933
141 Ga0207652_10272946 3300025921 Bacteria 1525
142 Ga0207652_10369436 3300025921 Unclassified 1295
143 Ga0207652_10586496 3300025921 Bacteria 1000
144 Ga0207646_10696491 3300025922 Unclassified 908
145 Ga0207687_10684869 3300025927 Bacteria 869
146 Ga0207687_10747370 3300025927 Unclassified 832
147 Ga0207700_10048706 3300025928 Bacteria 3148
148 Ga0207700_10087610 3300025928 Bacteria 2449
149 Ga0207664_10638287 3300025929 Bacteria 957
150 Ga0207644_10394376 3300025931 Bacteria 1130
151 Ga0207690_10304387 3300025932 Bacteria 1248
152 Ga0207665_10092561 3300025939 Bacteria 2097
153 Ga0207661_10009294 3300025944 Bacteria 7045
154 Ga0207661_10052739 3300025944 Bacteria 3251
155 Ga0207661_10431680 3300025944 Bacteria 1198
156 Ga0207661_10585119 3300025944 Bacteria 1024
157 Ga0207679_10229275 3300025945 Bacteria 1567
158 Ga0207667_10074634 3300025949 Bacteria 3522
159 Ga0207667_10187248 3300025949 Bacteria 2124
160 Ga0207667_10231344 3300025949 Bacteria 1893
161 Ga0207667_10354426 3300025949 Bacteria 1496
162 Ga0207667_10400070 3300025949 Bacteria 1398
163 Ga0207667_10580920 3300025949 Bacteria 1131
164 Ga0207667_11081104 3300025949 Unclassified 786
165 Ga0207651_10645569 3300025960 Bacteria 929
166 Ga0207658_10033480 3300025986 Unclassified 3666
167 Ga0207639_10767839 3300026041 Bacteria 897
168 Ga0207702_10290096 3300026078 Bacteria 1550
169 Ga0207702_10305958 3300026078 Bacteria 1510
170 Ga0207674_10035299 3300026116 Bacteria 5220
171 Ga0207674_10047762 3300026116 Bacteria 4386
172 Ga0207674_10272871 3300026116 Bacteria 1639
173 Ga0207698_10079626 3300026142 Bacteria 2636
174 Ga0268266_10054022 3300028379 Bacteria 3452
175 Ga0265326_10013904 3300028558 Bacteria 2347
176 Ga0265319_1023807 3300028563 Bacteria 2214
177 Ga0265318_10053333 3300028577 Bacteria 1516
178 Ga0265318_10062289 3300028577 Bacteria 1389
179 Ga0265318_10091273 3300028577 Unclassified 1122
180 Ga0265322_10001626 3300028654 Bacteria 7177
181 Ga0265336_10040367 3300028666 Bacteria 1429
182 Ga0265338_10007766 3300028800 Bacteria 13196
183 Ga0265338_10076422 3300028800 Unclassified 2837
184 Ga0265330_10092114 3300031235 Bacteria 1301
185 Ga0265329_10011048 3300031242 Bacteria 3292
186 Ga0265339_10051625 3300031249 Bacteria 2243
187 Ga0265327_10025308 3300031251 Bacteria 3464
188 Ga0265327_10027730 3300031251 Bacteria 3253
189 Ga0265327_10031227 3300031251 Bacteria 2996
190 Ga0265316_10011096 3300031344 Bacteria 8160
191 Ga0307408_100115938 3300031548 Bacteria 2067
192 Ga0307408_100706314 3300031548 Unclassified 907
193 Ga0265313_10007900 3300031595 Bacteria 7160
194 Ga0265314_10005549 3300031711 Bacteria 11347
195 Ga0265342_10149551 3300031712 Bacteria 1297
196 Ga0307416_100039319 3300032002 Bacteria 3661
197 Ga0307415_100494858 3300032126 Bacteria 1067
198 Ga0373944_0041362 3300035089 Bacteria 1426
199 Ga0373936_0056325 3300035113 Bacteria 1598
200 Ga0373957_0092623 3300035120 Bacteria 1203
201 Ga0373946_0038093 3300035171 Bacteria 1957
202 Ga0373935_0234985 3300035692 Bacteria 1278
203 Ga0373927_0047431 3300035695 Bacteria 2779
204 Ga0373947_0017919 3300035725 Bacteria 4076
205 Ga0373937_0316035 3300036401 Bacteria 1477
206 Ga0373925_0544196 3300037068 Bacteria 954
207 Ga0373925_0901512 3300037068 Unclassified 729
208 Ga0395899_0028212 3300037312 Bacteria 4227
209 Ga0395899_0241184 3300037312 Bacteria 1244
210 Ga0395899_0293025 3300037312 Bacteria 1103
211 Ga0395900_0016114 3300037418 Bacteria 7614
212 Ga0395900_0237961 3300037418 Unclassified 1828
213 Ga0395900_0468464 3300037418 Bacteria 1213
214 Ga0395900_0555167 3300037418 Unclassified 1093
215 Ga0395898_0012802 3300037466 Bacteria 8659
216 Ga0395898_0017446 3300037466 Bacteria 7330
217 Ga0395898_0017985 3300037466 Bacteria 7211
218 Ga0395898_0180216 3300037466 Bacteria 2019
219 Ga0395905_0040690 3300037471 Bacteria 4360
220 Ga0395905_0420314 3300037471 Bacteria 1233
221 Ga0436364_0672928 3300037853 Bacteria 1511
222 Ga0395901_0001415 3300038443 Bacteria 25052
223 Ga0395901_0014592 3300038443 Bacteria 7986
224 Ga0395901_0017655 3300038443 Bacteria 7284
225 Ga0395901_0026789 3300038443 Bacteria 5919
226 Ga0395901_0032601 3300038443 Bacteria 5374
227 Ga0395901_0173923 3300038443 Bacteria 2259
228 Ga0395901_0554194 3300038443 Bacteria 1165
229 Ga0436365_1402972 3300039437 Bacteria 3486
230 Ga0436360_0347673 3300039438 Bacteria 5369
231 Ga0436363_1282441 3300039450 Bacteria 1203
232 Ga0436362_0985476 3300039453 Bacteria 1530
233 Ga0466969_0009470 3300044656 Bacteria 5165
234 Ga0466966_0003226 3300044684 Bacteria 10750
235 Ga0466966_0176976 3300044684 Bacteria 1295
236 Ga0466966_0264208 3300044684 Unclassified 1036
237 Ga0466961_0018801 3300044693 Bacteria 4446
238 Ga0466961_0018936 3300044693 Bacteria 4430
239 Ga0466961_0046601 3300044693 Bacteria 2772
240 Ga0466963_0000205 3300044694 Bacteria 25099
241 Ga0466963_0001591 3300044694 Bacteria 12328
242 Ga0466963_0009776 3300044694 Bacteria 5787
243 Ga0466963_0036580 3300044694 Bacteria 3203
244 Ga0466963_0095433 3300044694 Bacteria 2030
245 Ga0466963_0895867 3300044694 Unclassified 625
246 Ga0466964_0004317 3300044706 Bacteria 5238
247 Ga0466964_0012983 3300044706 Bacteria 3155
248 Ga0466964_0022673 3300044706 Unclassified 2438
249 Ga0466971_0043719 3300044719 Bacteria 2012
250 Ga0466971_0188184 3300044719 Bacteria 972
251 Ga0466968_0012723 3300044735 Bacteria 3300
252 Ga0466968_0332163 3300044735 Bacteria 736
253 Ga0466957_0111184 3300044842 Bacteria 1737
254 Ga0466957_0133184 3300044842 Bacteria 1595
255 Ga0466959_0006265 3300045049 Bacteria 8221
256 Ga0466959_0020055 3300045049 Bacteria 4921
257 Ga0466959_0037603 3300045049 Bacteria 3577
258 Ga0466959_0049998 3300045049 Bacteria 3071
259 Ga0466959_0072408 3300045049 Bacteria 2494
260 Ga0466958_0005452 3300045836 Bacteria 6850
261 Ga0466958_0028007 3300045836 Bacteria 3338
262 Ga0466958_0282499 3300045836 Bacteria 1064
263 Ga0466958_0426991 3300045836 Unclassified 857
264 Ga0466967_0000577 3300045976 Bacteria 18063
265 Ga0466967_0042369 3300045976 Bacteria 3933
266 Ga0466967_0076381 3300045976 Bacteria 3013
267 Ga0466967_0085285 3300045976 Bacteria 2859
268 Ga0466967_0108399 3300045976 Bacteria 2548
269 Ga0466967_0112502 3300045976 Unclassified 2503
270 Ga0466967_0169201 3300045976 Bacteria 2055
271 Ga0466967_0305029 3300045976 Bacteria 1532
272 Ga0466967_0348775 3300045976 Unclassified 1432
273 Ga0466967_0375555 3300045976 Bacteria 1379
274 Ga0466967_0388158 3300045976 Bacteria 1357
275 Ga0466967_0401707 3300045976 Bacteria 1333
276 Ga0466967_0411786 3300045976 Bacteria 1316
277 Ga0466967_0847760 3300045976 Bacteria 908
278 Ga0466967_1040170 3300045976 Bacteria 815
279 Ga0495590_0257596 3300046457 Unclassified 650
280 Ga0495641_0020206 3300046461 Bacteria 3384
281 Ga0495641_0058613 3300046461 Bacteria 1742
282 Ga0495641_0169811 3300046461 Bacteria 976
283 Ga0495651_0001012 3300046462 Bacteria 21756
284 Ga0495651_0292572 3300046462 Bacteria 1095
285 Ga0495653_0051464 3300046463 Bacteria 3162
286 Ga0495580_0251952 3300046472 Bacteria 1209
287 Ga0495580_0283804 3300046472 Bacteria 1129
288 Ga0495605_0359241 3300046474 Unclassified 610
289 Ga0495639_0073090 3300046475 Bacteria 1587
290 Ga0495662_0255543 3300046476 Unclassified 863
291 Ga0495664_0023805 3300046477 Bacteria 3555
292 Ga0495664_0331319 3300046477 Bacteria 918
293 Ga0495596_0123303 3300046500 Bacteria 1006
294 Ga0495608_0023352 3300046511 Bacteria 4238
295 Ga0495608_0042632 3300046511 Bacteria 3034
296 Ga0495608_0196341 3300046511 Bacteria 1273
297 Ga0495628_0035138 3300046516 Bacteria 4029
298 Ga0495628_0196676 3300046516 Bacteria 1521
299 Ga0495630_0136209 3300046517 Bacteria 1866
300 Ga0495630_0167907 3300046517 Bacteria 1671
301 Ga0495630_0671826 3300046517 Bacteria 793
302 Ga0495663_0057204 3300046525 Bacteria 1220
303 Ga0495642_0095455 3300046528 Bacteria 1262
304 Ga0495652_0014234 3300046529 Bacteria 7144
305 Ga0495665_0021208 3300046531 Bacteria 3490
306 Ga0495640_0007078 3300046533 Bacteria 8831
307 Ga0495640_0045046 3300046533 Bacteria 3063
308 Ga0495640_0204207 3300046533 Bacteria 1251
309 Ga0495586_0015445 3300046535 Bacteria 4062
310 Ga0495586_0226891 3300046535 Bacteria 1062
311 Ga0495587_0026910 3300046536 Bacteria 3503
312 Ga0495645_0329887 3300046543 Bacteria 988
313 Ga0495667_0002615 3300046559 Bacteria 12024
314 Ga0495667_0013954 3300046559 Bacteria 5424
315 Ga0495667_0039244 3300046559 Bacteria 3149
316 Ga0495634_0091171 3300046642 Bacteria 1979
317 Ga0495634_0104291 3300046642 Bacteria 1829
318 Ga0495635_0299177 3300046663 Bacteria 1079
319 Ga0495657_0063345 3300046675 Bacteria 2439
320 Ga0495599_0107544 3300046678 Bacteria 1738
321 Ga0495599_0178558 3300046678 Bacteria 1309
322 Ga0495646_0093801 3300046680 Bacteria 1729
323 Ga0495647_0044354 3300046681 Bacteria 1705
324 Ga0495647_0112904 3300046681 Bacteria 1136
325 Ga0495658_0004715 3300046683 Bacteria 6701
326 Ga0495658_0139270 3300046683 Bacteria 1483
327 Ga0495613_0016591 3300046689 Bacteria 5483
328 Ga0495613_0060697 3300046689 Bacteria 2769
329 Ga0495613_0088505 3300046689 Bacteria 2244
330 Ga0495613_0130478 3300046689 Bacteria 1800
331 Ga0495624_0029403 3300046690 Bacteria 3585
332 Ga0495624_0061080 3300046690 Bacteria 2362
333 Ga0495581_0000257 3300047315 Bacteria 25389
334 Ga0495581_0057398 3300047315 Bacteria 2247
335 Ga0495604_0010858 3300047317 Bacteria 7234
336 Ga0495604_0102787 3300047317 Bacteria 2097
337 Ga0495604_0253359 3300047317 Bacteria 1199
338 Ga0495674_0001118 3300047319 Bacteria 25782
339 Ga0495674_0183884 3300047319 Bacteria 1739
340 Ga0495676_0020396 3300047321 Bacteria 5815
341 Ga0495680_0007620 3300047322 Bacteria 9890
342 Ga0495680_0049906 3300047322 Bacteria 3274
343 Ga0495680_0507052 3300047322 Bacteria 818
344 Ga0495675_0134034 3300047444 Bacteria 1539
345 Ga0495684_0108825 3300047471 Bacteria 2093
346 Ga0495593_0190823 3300047673 Bacteria 1031
347 Ga0495602_0134301 3300048088 Bacteria 1968
348 Ga0495602_0144398 3300048088 Bacteria 1880
349 Ga0495602_0218701 3300048088 Bacteria 1440
350 Ga0495602_0281606 3300048088 Bacteria 1224
351 Ga0496100_0046850 3300048903 Bacteria 2783
352 Ga0496100_0049012 3300048903 Bacteria 2728
353 Ga0496100_0183819 3300048903 Bacteria 1513
354 Ga0496101_0004739 3300048904 Bacteria 8621
355 Ga0496101_0017057 3300048904 Bacteria 4917
356 Ga0496101_0026331 3300048904 Bacteria 4043
357 Ga0496101_0323815 3300048904 Bacteria 1209
358 Ga0496102_0005853 3300048905 Bacteria 10464
359 Ga0496102_0081874 3300048905 Bacteria 2977
360 Ga0496102_0101084 3300048905 Bacteria 2678
361 Ga0496102_0340404 3300048905 Bacteria 1413
362 Ga0496103_0103886 3300048906 Bacteria 1800
363 Ga0496104_0359600 3300048907 Unclassified 1368
364 Ga0496105_0061497 3300048908 Bacteria 3099
365 Ga0496105_0522772 3300048908 Unclassified 929
366 Ga0496106_0003866 3300048909 Bacteria 11165
367 Ga0496106_0024495 3300048909 Bacteria 4487
368 Ga0496107_0010781 3300048910 Bacteria 6356
369 Ga0496107_0047598 3300048910 Bacteria 3088
370 Ga0496107_0389890 3300048910 Bacteria 1036
371 Ga0496108_0012678 3300048911 Bacteria 6868
372 Ga0496111_0077333 3300048914 Bacteria 2426
373 Ga0496111_0141780 3300048914 Bacteria 1781
374 Ga0496112_0033576 3300048915 Bacteria 4989
375 Ga0496112_0044766 3300048915 Bacteria 4337
376 Ga0496112_0177615 3300048915 Bacteria 2094
377 Ga0496112_0535871 3300048915 Bacteria 1105
378 Ga0496112_0719592 3300048915 Bacteria 926
379 Ga0496112_1092754 3300048915 Bacteria 716
380 Ga0496113_0079123 3300048916 Unclassified 2516
381 Ga0496114_0025112 3300048917 Bacteria 4868
382 Ga0496114_0207073 3300048917 Bacteria 1719
383 Ga0496114_0988348 3300048917 Unclassified 724
384 Ga0496115_0015705 3300048918 Bacteria 5750
385 Ga0496115_0077959 3300048918 Bacteria 2695
386 Ga0501047_0050187 3300049581 Bacteria 4029
387 Ga0501047_0145645 3300049581 Bacteria 2246
388 Ga0501067_0023247 3300049583 Bacteria 3434
389 Ga0501067_0285794 3300049583 Bacteria 918
390 Ga0501069_0045740 3300049585 Bacteria 2425
391 Ga0501069_0046292 3300049585 Bacteria 2413
392 Ga0501069_0369943 3300049585 Bacteria 846
393 Ga0501070_0008299 3300049586 Bacteria 8778
394 Ga0501070_0386385 3300049586 Bacteria 1133
395 Ga0501070_0393244 3300049586 Bacteria 1122
396 Ga0501073_0062616 3300049589 Bacteria 2595
397 Ga0501080_0084225 3300049742 Bacteria 2954
398 Ga0501080_0451077 3300049742 Bacteria 1153
399 Ga0501044_0148928 3300049823 Bacteria 2324
400 nmdc:mga0a205_141933_c1 3300050515 Unclassified 2302
401 Ga0495601_0078580 3300053077 Bacteria 2114
402 Ga0495601_0096663 3300053077 Bacteria 1905
403 Ga0495601_0351533 3300053077 Bacteria 958
404 Ga0495655_0004757 3300053083 Bacteria 2349
405 Ga0495619_0021899 3300053085 Bacteria 4085
406 Ga0495619_0180481 3300053085 Bacteria 1460
407 Ga0495619_0359390 3300053085 Bacteria 1007
408 Ga0501084_0899766 3300054114 Bacteria 744
409 Ga0530510_0046713 3300061734 Bacteria 3128
410 Ga0530510_0615418 3300061734 Bacteria 826
411 Ga0070708_100197179
412 Ga0070658_10340178
413 Ga0070658_10732593
414 Ga0070683_100006231
415 Ga0070683_100052589
416 Ga0070683_100086151
417 Ga0070683_100089379
418 Ga0070683_100517190
419 Ga0070683_100793408
420 Ga0070680_100002965
421 Ga0070680_100032672
422 Ga0070680_100085769
423 Ga0070682_100271760
424 Ga0070660_100001406
425 Ga0070660_100026224
426 Ga0070660_100043662
427 Ga0070660_100262462
428 Ga0070660_100477627
429 Ga0070660_100496066
430 Ga0070660_100577016
431 Ga0070661_100047401
432 Ga0070661_100371502
433 Ga0070674_100318452
434 Ga0070673_100704905
435 Ga0070659_100020630
436 Ga0070659_100268203
437 Ga0070667_100024822
438 Ga0070709_10360949
439 Ga0070714_100656699
440 Ga0070714_101415526
441 Ga0070713_100045005
442 Ga0070713_100358656
443 Ga0070711_100527617
444 Ga0070694_100241734
445 Ga0070708_100029264
446 Ga0070681_10007722
447 Ga0070681_10010837
448 Ga0070681_10056604
449 Ga0070681_10189970
450 Ga0068867_100649760
451 Ga0070699_100254722
452 Ga0070679_100002527
453 Ga0070679_100034422
454 Ga0070679_100084620
455 Ga0070679_100084771
456 Ga0070679_100203902
457 Ga0070684_100001220
458 Ga0070684_100021833
459 Ga0070684_100033782
460 Ga0070684_100228535
461 Ga0070684_100364795
462 Ga0070696_100134215
463 Ga0070696_100142518
464 Ga0070665_100111106
465 Ga0068855_100006830
466 Ga0068855_100027629
467 Ga0068855_100098422
468 Ga0068855_100142664
469 Ga0068855_100316378
470 Ga0068855_100465558
471 Ga0070664_100057770
472 Ga0068857_100044631
473 Ga0068857_100092636
474 Ga0068857_100355688
475 Ga0068856_100061915
476 Ga0068856_100557998
477 Ga0068852_100028819
478 Ga0068852_100122576
479 Ga0068866_10262304
480 Ga0068851_10482707
481 Ga0081455_10077150
482 Ga0070715_10205020
483 Ga0105240_10054872
484 Ga0105240_10098649
485 Ga0105240_10298155
486 Ga0105245_10421300
487 Ga0105245_10736249
488 Ga0105245_11066463
489 Ga0105242_10076065
490 Ga0105242_10605151
491 Ga0105248_11733430
492 Ga0105237_10064168
493 Ga0105237_10076912
494 Ga0105238_10481647
495 Ga0105239_10180111
496 Ga0157373_10066697
497 Ga0157370_10095255
498 Ga0157370_10162111
499 Ga0157370_10278246
500 Ga0157370_10347123
501 Ga0157369_10070924
502 Ga0157369_10100048
503 Ga0157369_10133719
504 Ga0157369_10400039
505 Ga0157369_10812268
506 Ga0157374_10095945
507 Ga0157374_10529019
508 Ga0157374_11068720
509 Ga0157378_10853045
510 Ga0157372_10015478
511 Ga0157372_10731473
512 Ga0163163_10895144
513 Ga0182007_10049470
514 Ga0197907_11052110
515 Ga0206356_11256080
516 Ga0206356_11678481
517 Ga0206352_11276596
518 Ga0206354_10420670
519 Ga0206353_10332968
520 Ga0206353_11294919
521 Ga0224712_10118943
522 Ga0207692_10161572
523 Ga0207685_10282458
524 Ga0207699_10548031
525 Ga0207705_10123573
526 Ga0207705_10151431
527 Ga0207705_10197358
528 Ga0207707_10004915
529 Ga0207707_10020828
530 Ga0207707_10089451
531 Ga0207707_10098802
532 Ga0207707_10139835
533 Ga0207707_10186423
534 Ga0207707_10528278
535 Ga0207695_10635231
536 Ga0207693_10080318
537 Ga0207660_10029344
538 Ga0207660_10061083
539 Ga0207660_10075865
540 Ga0207657_10000397
541 Ga0207657_10012919
542 Ga0207657_10023872
543 Ga0207657_10027395
544 Ga0207657_10193489
545 Ga0207657_10333095
546 Ga0207657_10593431
547 Ga0207649_10271102
548 Ga0207652_10069749
549 Ga0207652_10109486
550 Ga0207652_10173867
551 Ga0207652_10272946
552 Ga0207652_10369436
553 Ga0207652_10586496
554 Ga0207646_10696491
555 Ga0207687_10684869
556 Ga0207687_10747370
557 Ga0207700_10048706
558 Ga0207700_10087610
559 Ga0207664_10638287
560 Ga0207644_10394376
561 Ga0207690_10304387
562 Ga0207665_10092561
563 Ga0207661_10009294
564 Ga0207661_10052739
565 Ga0207661_10431680
566 Ga0207661_10585119
567 Ga0207679_10229275
568 Ga0207667_10074634
569 Ga0207667_10187248
570 Ga0207667_10231344
571 Ga0207667_10354426
572 Ga0207667_10400070
573 Ga0207667_10580920
574 Ga0207667_11081104
575 Ga0207651_10645569
576 Ga0207658_10033480
577 Ga0207639_10767839
578 Ga0207702_10290096
579 Ga0207702_10305958
580 Ga0207674_10035299
581 Ga0207674_10047762
582 Ga0207674_10272871
583 Ga0207698_10079626
584 Ga0268266_10054022
585 Ga0265326_10013904
586 Ga0265319_1023807
587 Ga0265318_10053333
588 Ga0265318_10062289
589 Ga0265318_10091273
590 Ga0265322_10001626
591 Ga0265336_10040367
592 Ga0265338_10007766
593 Ga0265338_10076422
594 Ga0265330_10092114
595 Ga0265329_10011048
596 Ga0265339_10051625
597 Ga0265327_10025308
598 Ga0265327_10027730
599 Ga0265327_10031227
600 Ga0265316_10011096
601 Ga0307408_100115938
602 Ga0307408_100706314
603 Ga0265313_10007900
604 Ga0265314_10005549
605 Ga0265342_10149551
606 Ga0307416_100039319
607 Ga0307415_100494858
608 Ga0373944_0041362
609 Ga0373936_0056325
610 Ga0373957_0092623
611 Ga0373946_0038093
612 Ga0373935_0234985
613 Ga0373927_0047431
614 Ga0373947_0017919
615 Ga0373937_0316035
616 Ga0373925_0544196
617 Ga0373925_0901512
618 Ga0395899_0028212
619 Ga0395899_0241184
620 Ga0395899_0293025
621 Ga0395900_0016114
622 Ga0395900_0237961
623 Ga0395900_0468464
624 Ga0395900_0555167
625 Ga0395898_0012802
626 Ga0395898_0017446
627 Ga0395898_0017985
628 Ga0395898_0180216
629 Ga0395905_0040690
630 Ga0395905_0420314
631 Ga0436364_0672928
632 Ga0395901_0001415
633 Ga0395901_0014592
634 Ga0395901_0017655
635 Ga0395901_0026789
636 Ga0395901_0032601
637 Ga0395901_0173923
638 Ga0395901_0554194
639 Ga0436365_1402972
640 Ga0436360_0347673
641 Ga0436363_1282441
642 Ga0436362_0985476
643 Ga0466969_0009470
644 Ga0466966_0003226
645 Ga0466966_0176976
646 Ga0466966_0264208
647 Ga0466961_0018801
648 Ga0466961_0018936
649 Ga0466961_0046601
650 Ga0466963_0000205
651 Ga0466963_0001591
652 Ga0466963_0009776
653 Ga0466963_0036580
654 Ga0466963_0095433
655 Ga0466963_0895867
656 Ga0466964_0004317
657 Ga0466964_0012983
658 Ga0466964_0022673
659 Ga0466971_0043719
660 Ga0466971_0188184
661 Ga0466968_0012723
662 Ga0466968_0332163
663 Ga0466957_0111184
664 Ga0466957_0133184
665 Ga0466959_0006265
666 Ga0466959_0020055
667 Ga0466959_0037603
668 Ga0466959_0049998
669 Ga0466959_0072408
670 Ga0466958_0005452
671 Ga0466958_0028007
672 Ga0466958_0282499
673 Ga0466958_0426991
674 Ga0466967_0000577
675 Ga0466967_0042369
676 Ga0466967_0076381
677 Ga0466967_0085285
678 Ga0466967_0108399
679 Ga0466967_0112502
680 Ga0466967_0169201
681 Ga0466967_0305029
682 Ga0466967_0348775
683 Ga0466967_0375555
684 Ga0466967_0388158
685 Ga0466967_0401707
686 Ga0466967_0411786
687 Ga0466967_0847760
688 Ga0466967_1040170
689 Ga0495590_0257596
690 Ga0495641_0020206
691 Ga0495641_0058613
692 Ga0495641_0169811
693 Ga0495651_0001012
694 Ga0495651_0292572
695 Ga0495653_0051464
696 Ga0495580_0251952
697 Ga0495580_0283804
698 Ga0495605_0359241
699 Ga0495639_0073090
700 Ga0495662_0255543
701 Ga0495664_0023805
702 Ga0495664_0331319
703 Ga0495596_0123303
704 Ga0495608_0023352
705 Ga0495608_0042632
706 Ga0495608_0196341
707 Ga0495628_0035138
708 Ga0495628_0196676
709 Ga0495630_0136209
710 Ga0495630_0167907
711 Ga0495630_0671826
712 Ga0495663_0057204
713 Ga0495642_0095455
714 Ga0495652_0014234
715 Ga0495665_0021208
716 Ga0495640_0007078
717 Ga0495640_0045046
718 Ga0495640_0204207
719 Ga0495586_0015445
720 Ga0495586_0226891
721 Ga0495587_0026910
722 Ga0495645_0329887
723 Ga0495667_0002615
724 Ga0495667_0013954
725 Ga0495667_0039244
726 Ga0495634_0091171
727 Ga0495634_0104291
728 Ga0495635_0299177
729 Ga0495657_0063345
730 Ga0495599_0107544
731 Ga0495599_0178558
732 Ga0495646_0093801
733 Ga0495647_0044354
734 Ga0495647_0112904
735 Ga0495658_0004715
736 Ga0495658_0139270
737 Ga0495613_0016591
738 Ga0495613_0060697
739 Ga0495613_0088505
740 Ga0495613_0130478
741 Ga0495624_0029403
742 Ga0495624_0061080
743 Ga0495581_0000257
744 Ga0495581_0057398
745 Ga0495604_0010858
746 Ga0495604_0102787
747 Ga0495604_0253359
748 Ga0495674_0001118
749 Ga0495674_0183884
750 Ga0495676_0020396
751 Ga0495680_0007620
752 Ga0495680_0049906
753 Ga0495680_0507052
754 Ga0495675_0134034
755 Ga0495684_0108825
756 Ga0495593_0190823
757 Ga0495602_0134301
758 Ga0495602_0144398
759 Ga0495602_0218701
760 Ga0495602_0281606
761 Ga0496100_0046850
762 Ga0496100_0049012
763 Ga0496100_0183819
764 Ga0496101_0004739
765 Ga0496101_0017057
766 Ga0496101_0026331
767 Ga0496101_0323815
768 Ga0496102_0005853
769 Ga0496102_0081874
770 Ga0496102_0101084
771 Ga0496102_0340404
772 Ga0496103_0103886
773 Ga0496104_0359600
774 Ga0496105_0061497
775 Ga0496105_0522772
776 Ga0496106_0003866
777 Ga0496106_0024495
778 Ga0496107_0010781
779 Ga0496107_0047598
780 Ga0496107_0389890
781 Ga0496108_0012678
782 Ga0496111_0077333
783 Ga0496111_0141780
784 Ga0496112_0033576
785 Ga0496112_0044766
786 Ga0496112_0177615
787 Ga0496112_0535871
788 Ga0496112_0719592
789 Ga0496112_1092754
790 Ga0496113_0079123
791 Ga0496114_0025112
792 Ga0496114_0207073
793 Ga0496114_0988348
794 Ga0496115_0015705
795 Ga0496115_0077959
796 Ga0501047_0050187
797 Ga0501047_0145645
798 Ga0501067_0023247
799 Ga0501067_0285794
800 Ga0501069_0045740
801 Ga0501069_0046292
802 Ga0501069_0369943
803 Ga0501070_0008299
804 Ga0501070_0386385
805 Ga0501070_0393244
806 Ga0501073_0062616
807 Ga0501080_0084225
808 Ga0501080_0451077
809 Ga0501044_0148928
810 nmdc:mga0a205_141933_c1
811 Ga0495601_0078580
812 Ga0495601_0096663
813 Ga0495601_0351533
814 Ga0495655_0004757
815 Ga0495619_0021899
816 Ga0495619_0180481
817 Ga0495619_0359390
818 Ga0501084_0899766
819 Ga0530510_0046713
820 Ga0530510_0615418

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3my2-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8053 50 65
7mhw-assembly1.cif.gz_A crystal structure of the protease inhibitor u-omp19 from brucella abortus fused to maltose-binding protein 0.7873 48 65
5e9u-assembly2.cif.gz_H crystal structure of gtfa/b complex bound to udp and glcnac 0.7265 48 98
3fxt-assembly1.cif.gz_A crystal structure of the n-terminal domain of human nudt6 0.7224 97 175
6ia6-assembly1.cif.gz_A-2 crystal structure of the bacterial dehalococcoides mccartyi elp3 with desulfo-coa 0.6875 50 174
ID Description Score Start End Superfamily
3iv8D01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.8444 49 65 2.30.40.10
af_O53594_3_209_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8293 3 175 3.40.630.30
3mswA00 Mainly Beta;Beta Barrel;Lipocalin; 0.7428 50 70 2.40.128.720
af_K7M4C3_11_92_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7295 87 174 3.40.630.30
af_Q10081_4_149_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7191 50 172 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A7W1N539-F1-model_v4 GNAT family N-acetyltransferase 0.9493 7 103
AF-A0A7W1N539-F1-model_v4 GNAT family N-acetyltransferase 0.9307 7 103
AF-A0A7V9PXJ3-F1-model_v4 GNAT family N-acetyltransferase 0.9169 1 146
AF-A0A7V9PXJ3-F1-model_v4 GNAT family N-acetyltransferase 0.905 1 146
AF-A0A538FXA3-F1-model_v4 GNAT family N-acetyltransferase 0.895 1 84

Map