F437027

General Info

Members Datasets Scaffolds Average Seq Length
409 200 818 325

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10120229|Ga0307405_101202291
Length 353
Sequence VTATSGWELGRRSVGALWQAGRTMAGTPHVRAADVLGRVTLVTGKEEFLNERTVVAVRRAVREYDGDAELAETSASDLTLATLGEMSAASLFSSIRCVVVRGLENLPDETVDGLLAYAAAPVDDVALVLVHGGGQKGSGVLTKLRKLGPVTESKSGELKASEFAGFVAAEVRSHGSTIDQEAAGFLVQAVGQDLRSLAAAADQLTNDFPAQPLSVEKVKQYFGGRAEAKSFAVADAAFWGRPEVALEELRWALDAGTPAVLVTSAFAGGARGLARYKGAPRGMRDADLAREVGVPPWKLRTIRDQSRSWSDAGISRAIRSIARADADIKGAASDASYTLERLVLTVTGLRDQR

Samples

Sample ID Description Type Environment
1 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
88 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
89 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
90 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
91 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
94 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
95 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
96 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
97 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
98 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
101 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
102 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
103 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
104 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
105 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
106 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
107 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
108 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
109 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
112 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
113 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
114 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
115 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
116 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
117 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
118 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
119 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
120 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
121 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
122 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
123 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
124 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
125 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
126 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
127 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
128 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
143 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
144 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
145 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
146 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
147 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
148 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
149 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
150 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
151 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
152 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
153 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
154 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
155 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
156 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
157 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
158 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
161 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
162 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
163 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
164 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
165 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
166 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
167 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
170 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
171 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
172 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
173 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
174 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
175 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
176 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
177 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
178 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
179 2643221561 Nocardioides sp. Root151 Isolate Unclassified
180 2643221576 Nocardioides sp. Root614 Isolate Unclassified
181 2643221590 Nocardioides sp. Root682 Isolate Unclassified
182 2643221604 Nocardioides sp. Root190 Isolate Unclassified
183 2643221615 Nocardioides sp. Root224 Isolate Unclassified
184 2643221617 Nocardioides sp. Root79 Isolate Unclassified
185 2643221620 Nocardioides sp. Root240 Isolate Unclassified
186 2643221641 Nocardioides sp. Root122 Isolate Unclassified
187 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
188 2643221696 Nocardioides sp. Root140 Isolate Unclassified
189 2738541305 Nocardioides sp. CF167 Isolate Unclassified
190 2739367898 Nocardioides sp. CF479 Isolate Unclassified
191 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
192 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
193 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
194 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
195 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
196 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
197 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
198 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
199 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
200 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.13
Metatranscriptomes 0.24
Isolates 5.62

Biome Distribution

Category Percentage (%)
Aerial Root 0.49
Bulb 0
Endosphere 12.96
Nodule 0.24
Rhizoplane 8.56
Rhizosphere 73.11
Stem 0
Stem Tuber 0
Unclassified 0.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307405_10120229 3300031731 Bacteria 1796
2 JGI24737J22298_10004892 3300001990 Bacteria 4645
3 JGI25406J46586_10024561 3300003203 Bacteria 2359
4 rootH1_10107614 3300003316 Bacteria 4774
5 Ga0070658_10043877 3300005327 Bacteria 3613
6 Ga0070658_10139391 3300005327 Bacteria 2025
7 Ga0070683_100001719 3300005329 Bacteria 17020
8 Ga0070683_100015085 3300005329 Bacteria 6780
9 Ga0070683_100044807 3300005329 Bacteria 4081
10 Ga0068869_100295341 3300005334 Bacteria 1307
11 Ga0070680_100066537 3300005336 Bacteria 2955
12 Ga0070680_100321286 3300005336 Bacteria 1314
13 Ga0070682_100002180 3300005337 Bacteria 10849
14 Ga0070682_100119954 3300005337 Bacteria 1764
15 Ga0070682_100155681 3300005337 Bacteria 1573
16 Ga0070660_100214225 3300005339 Bacteria 1564
17 Ga0070687_100094843 3300005343 Bacteria 1658
18 Ga0070668_100295938 3300005347 Bacteria 1356
19 Ga0070668_100336718 3300005347 Bacteria 1274
20 Ga0070659_100241629 3300005366 Bacteria 1495
21 Ga0070714_100041297 3300005435 Bacteria 3891
22 Ga0070700_100247271 3300005441 Bacteria 1277
23 Ga0070678_100174825 3300005456 Bacteria 1753
24 Ga0070707_100048541 3300005468 Bacteria 4066
25 Ga0070698_100016704 3300005471 Bacteria 7744
26 Ga0070679_100006058 3300005530 Bacteria 11249
27 Ga0070684_100007443 3300005535 Bacteria 8513
28 Ga0070672_100049862 3300005543 Bacteria 3259
29 Ga0070686_100171631 3300005544 Bacteria 1534
30 Ga0070665_100000922 3300005548 Bacteria 37641
31 Ga0068857_100014967 3300005577 Bacteria 6766
32 Ga0068856_100207218 3300005614 Bacteria 1975
33 Ga0068864_100330378 3300005618 Bacteria 1434
34 Ga0068870_10105429 3300005840 Bacteria 1601
35 Ga0068858_100027330 3300005842 Bacteria 5302
36 Ga0081455_10002138 3300005937 Bacteria 23555
37 Ga0081539_10000170 3300005985 Bacteria 152854
38 Ga0075365_10004701 3300006038 Bacteria 7279
39 Ga0075365_10004710 3300006038 Bacteria 7274
40 Ga0075365_10015792 3300006038 Bacteria 4574
41 Ga0075365_10018223 3300006038 Bacteria 4313
42 Ga0075365_10020381 3300006038 Bacteria 4110
43 Ga0075365_10049186 3300006038 Bacteria 2777
44 Ga0075365_10051716 3300006038 Bacteria 2715
45 Ga0075365_10055892 3300006038 Bacteria 2622
46 Ga0075365_10068594 3300006038 Bacteria 2383
47 Ga0075365_10103466 3300006038 Bacteria 1951
48 Ga0075365_10169120 3300006038 Bacteria 1525
49 Ga0075365_10178464 3300006038 Bacteria 1484
50 Ga0075363_100000549 3300006048 Bacteria 12213
51 Ga0075363_100006120 3300006048 Bacteria 5433
52 Ga0075363_100011456 3300006048 Bacteria 4246
53 Ga0075363_100023485 3300006048 Bacteria 3126
54 Ga0075364_10026687 3300006051 Bacteria 3686
55 Ga0075367_10000780 3300006178 Bacteria 12516
56 Ga0075367_10006696 3300006178 Bacteria 5846
57 Ga0075367_10027650 3300006178 Bacteria 3229
58 Ga0075367_10061894 3300006178 Bacteria 2234
59 Ga0075369_10026159 3300006186 Bacteria 2431
60 Ga0075370_10008445 3300006353 Bacteria 5300
61 Ga0075370_10012033 3300006353 Bacteria 4562
62 Ga0075370_10182374 3300006353 Bacteria 1236
63 Ga0068871_100327226 3300006358 Bacteria 1351
64 Ga0075428_100001295 3300006844 Bacteria 26560
65 Ga0075429_100071251 3300006880 Bacteria 3026
66 Ga0068865_100467938 3300006881 Bacteria 1045
67 Ga0111539_10159318 3300009094 Bacteria 2640
68 Ga0105245_10004476 3300009098 Bacteria 12354
69 Ga0105245_10298507 3300009098 Bacteria 1580
70 Ga0114129_10002694 3300009147 Bacteria 24719
71 Ga0105243_10052815 3300009148 Bacteria 3221
72 Ga0105243_10248825 3300009148 Bacteria 1586
73 Ga0105243_10268401 3300009148 Bacteria 1531
74 Ga0105243_10282243 3300009148 Bacteria 1496
75 Ga0105243_10659033 3300009148 Bacteria 1015
76 Ga0105238_10167404 3300009551 Bacteria 2174
77 Ga0105238_10239163 3300009551 Bacteria 1793
78 Ga0105239_10014214 3300010375 Bacteria 8835
79 Ga0105246_10009895 3300011119 Bacteria 5881
80 Ga0105246_10093861 3300011119 Bacteria 2169
81 Ga0157374_10246693 3300013296 Bacteria 1757
82 Ga0163162_10066777 3300013306 Bacteria 3646
83 Ga0157372_10052431 3300013307 Bacteria 4542
84 Ga0157372_10062589 3300013307 Bacteria 4170
85 Ga0157372_10098273 3300013307 Bacteria 3340
86 Ga0157375_10074482 3300013308 Bacteria 3416
87 Ga0157375_10120859 3300013308 Bacteria 2729
88 Ga0157375_10162290 3300013308 Bacteria 2377
89 Ga0157375_10579407 3300013308 Bacteria 1282
90 Ga0163163_10018595 3300014325 Bacteria 6510
91 Ga0163163_10066683 3300014325 Bacteria 3576
92 Ga0163163_10239749 3300014325 Bacteria 1863
93 Ga0163163_10294864 3300014325 Bacteria 1674
94 Ga0157377_10196457 3300014745 Bacteria 1278
95 Ga0157379_10127175 3300014968 Bacteria 2293
96 Ga0157376_10305261 3300014969 Bacteria 1508
97 Ga0206353_11167678 3300020082 Bacteria 1138
98 Ga0207642_10016096 3300025899 Bacteria 2807
99 Ga0207688_10076587 3300025901 Bacteria 1905
100 Ga0207647_10031434 3300025904 Bacteria 3416
101 Ga0207647_10054365 3300025904 Bacteria 2463
102 Ga0207643_10100833 3300025908 Bacteria 1693
103 Ga0207643_10188856 3300025908 Bacteria 1250
104 Ga0207705_10093617 3300025909 Bacteria 2203
105 Ga0207705_10210681 3300025909 Bacteria 1474
106 Ga0207654_10170079 3300025911 Bacteria 1414
107 Ga0207660_10052057 3300025917 Bacteria 2913
108 Ga0207662_10082659 3300025918 Bacteria 1962
109 Ga0207657_10074372 3300025919 Bacteria 2869
110 Ga0207646_10487207 3300025922 Bacteria 1112
111 Ga0207687_10108715 3300025927 Bacteria 2054
112 Ga0207664_10011549 3300025929 Bacteria 6286
113 Ga0207709_10117330 3300025935 Bacteria 1791
114 Ga0207689_10149488 3300025942 Bacteria 1925
115 Ga0207661_10010020 3300025944 Bacteria 6810
116 Ga0207661_10037584 3300025944 Bacteria 3788
117 Ga0207679_10023076 3300025945 Bacteria 4248
118 Ga0207651_10124652 3300025960 Bacteria 1961
119 Ga0207712_10198521 3300025961 Bacteria 1589
120 Ga0207668_10340398 3300025972 Bacteria 1251
121 Ga0207658_10070479 3300025986 Bacteria 2645
122 Ga0207703_10060066 3300026035 Bacteria 3107
123 Ga0207708_10047275 3300026075 Bacteria 3277
124 Ga0207708_10090454 3300026075 Bacteria 2359
125 Ga0207648_10189460 3300026089 Bacteria 1822
126 Ga0207676_10131588 3300026095 Bacteria 2128
127 Ga0207674_10024041 3300026116 Bacteria 6516
128 Ga0207674_10079664 3300026116 Bacteria 3279
129 Ga0207674_10412357 3300026116 Bacteria 1305
130 Ga0207683_10129820 3300026121 Bacteria 2266
131 Ga0207698_10177552 3300026142 Bacteria 1882
132 Ga0209813_10013680 3300027866 Bacteria 2171
133 Ga0268266_10024492 3300028379 Bacteria 5132
134 Ga0268264_10001706 3300028381 Bacteria 20248
135 Ga0307408_100268756 3300031548 Bacteria 1415
136 Ga0307405_10140100 3300031731 Bacteria 1685
137 Ga0307410_10029295 3300031852 Bacteria 3505
138 Ga0307406_10032289 3300031901 Bacteria 3195
139 Ga0307412_10099961 3300031911 Bacteria 2049
140 Ga0307409_100044376 3300031995 Bacteria 3348
141 Ga0307409_100071572 3300031995 Bacteria 2758
142 Ga0307409_100099670 3300031995 Bacteria 2406
143 Ga0307409_100121597 3300031995 Bacteria 2212
144 Ga0307409_100193478 3300031995 Bacteria 1813
145 Ga0307416_100049567 3300032002 Bacteria 3340
146 Ga0307416_100688177 3300032002 Bacteria 1111
147 Ga0307414_10078979 3300032004 Bacteria 2400
148 Ga0307411_10077474 3300032005 Bacteria 2276
149 Ga0307415_100053575 3300032126 Bacteria 2749
150 Ga0395899_0079604 3300037312 Bacteria 2386
151 Ga0395900_0367596 3300037418 Bacteria 1409
152 Ga0395898_0052882 3300037466 Bacteria 3967
153 Ga0395898_0266459 3300037466 Bacteria 1634
154 Ga0395901_0390051 3300038443 Bacteria 1432
155 Ga0395901_0416766 3300038443 Bacteria 1378
156 Ga0439434_0008569 3300042435 Bacteria 3001
157 Ga0466969_0073434 3300044656 Bacteria 1642
158 Ga0466965_0023124 3300044683 Bacteria 2999
159 Ga0466965_0073731 3300044683 Bacteria 1719
160 Ga0466965_0125058 3300044683 Bacteria 1330
161 Ga0466966_0016422 3300044684 Bacteria 4892
162 Ga0466966_0205527 3300044684 Bacteria 1191
163 Ga0466961_0228864 3300044693 Bacteria 1144
164 Ga0466963_0115304 3300044694 Bacteria 1846
165 Ga0466963_0209071 3300044694 Bacteria 1365
166 Ga0466963_0220957 3300044694 Bacteria 1327
167 Ga0466964_0007169 3300044706 Bacteria 4168
168 Ga0466970_0031051 3300044765 Bacteria 2820
169 Ga0466970_0075444 3300044765 Bacteria 1816
170 Ga0466957_0019784 3300044842 Bacteria 3962
171 Ga0466960_0000481 3300044901 Bacteria 13630
172 Ga0466960_0199485 3300044901 Bacteria 1092
173 Ga0466967_0028353 3300045976 Bacteria 4673
174 Ga0466967_0180190 3300045976 Bacteria 1992
175 Ga0466967_0224714 3300045976 Bacteria 1785
176 Ga0466967_0229775 3300045976 Bacteria 1766
177 Ga0466967_0418141 3300045976 Bacteria 1306
178 Ga0466967_0451806 3300045976 Bacteria 1256
179 Ga0495653_0010419 3300046463 Bacteria 7605
180 Ga0495582_0151215 3300046473 Bacteria 1318
181 Ga0495581_0039328 3300047315 Bacteria 2738
182 Ga0496100_0084380 3300048903 Bacteria 2153
183 Ga0496101_0029925 3300048904 Bacteria 3812
184 Ga0496102_0010263 3300048905 Bacteria 8053
185 Ga0496102_0246410 3300048905 Bacteria 1685
186 Ga0496102_0329179 3300048905 Bacteria 1439
187 Ga0496103_0142242 3300048906 Bacteria 1535
188 Ga0496104_0002599 3300048907 Bacteria 15570
189 Ga0496104_0286134 3300048907 Bacteria 1561
190 Ga0496105_0004121 3300048908 Bacteria 10895
191 Ga0496105_0068258 3300048908 Bacteria 2937
192 Ga0496107_0006778 3300048910 Bacteria 7884
193 Ga0496107_0024960 3300048910 Bacteria 4230
194 Ga0496107_0042917 3300048910 Bacteria 3249
195 Ga0496107_0284389 3300048910 Bacteria 1231
196 Ga0496108_0030398 3300048911 Bacteria 4476
197 Ga0496108_0032456 3300048911 Bacteria 4337
198 Ga0496108_0133249 3300048911 Bacteria 2136
199 Ga0496109_0010827 3300048912 Bacteria 7808
200 Ga0496109_0030680 3300048912 Bacteria 4819
201 Ga0496109_0037914 3300048912 Bacteria 4356
202 Ga0496109_0080768 3300048912 Bacteria 2996
203 Ga0496109_0090216 3300048912 Bacteria 2834
204 Ga0496109_0458897 3300048912 Bacteria 1203
205 Ga0496110_0034025 3300048913 Bacteria 4411
206 Ga0496110_0320971 3300048913 Bacteria 1411
207 Ga0496111_0031010 3300048914 Bacteria 3805
208 Ga0496111_0077656 3300048914 Bacteria 2421
209 Ga0496111_0149845 3300048914 Bacteria 1730
210 Ga0496113_0042397 3300048916 Bacteria 3363
211 Ga0496114_0005773 3300048917 Bacteria 9720
212 Ga0496114_0226848 3300048917 Bacteria 1641
213 Ga0496114_0332704 3300048917 Bacteria 1343
214 Ga0496114_0337456 3300048917 Bacteria 1332
215 Ga0496115_0003224 3300048918 Bacteria 11714
216 Ga0496115_0106196 3300048918 Bacteria 2305
217 Ga0501031_0007640 3300049568 Bacteria 7035
218 Ga0501031_0015452 3300049568 Bacteria 4956
219 Ga0501031_0078243 3300049568 Bacteria 2155
220 Ga0501031_0115751 3300049568 Bacteria 1751
221 Ga0501032_0005756 3300049569 Bacteria 9169
222 Ga0501032_0013472 3300049569 Bacteria 5815
223 Ga0501032_0141689 3300049569 Bacteria 1583
224 Ga0501032_0167779 3300049569 Bacteria 1440
225 Ga0501033_0001183 3300049570 Bacteria 23565
226 Ga0501034_0025216 3300049571 Bacteria 6052
227 Ga0501036_0000447 3300049572 Bacteria 29436
228 Ga0501036_0009418 3300049572 Bacteria 8032
229 Ga0501036_0066737 3300049572 Bacteria 3044
230 Ga0501036_0184251 3300049572 Bacteria 1757
231 Ga0501036_0324325 3300049572 Bacteria 1287
232 Ga0501037_0036522 3300049573 Bacteria 3621
233 Ga0501037_0038996 3300049573 Bacteria 3498
234 Ga0501037_0054506 3300049573 Bacteria 2924
235 Ga0501037_0116308 3300049573 Bacteria 1924
236 Ga0501037_0240839 3300049573 Bacteria 1268
237 Ga0501038_0007019 3300049574 Bacteria 10402
238 Ga0501038_0043083 3300049574 Bacteria 3927
239 Ga0501038_0044354 3300049574 Bacteria 3864
240 Ga0501038_0175725 3300049574 Bacteria 1731
241 Ga0501039_0004397 3300049575 Bacteria 10627
242 Ga0501039_0013140 3300049575 Bacteria 6329
243 Ga0501039_0032548 3300049575 Bacteria 4021
244 Ga0501039_0052908 3300049575 Bacteria 3141
245 Ga0501039_0054157 3300049575 Bacteria 3105
246 Ga0501039_0072337 3300049575 Bacteria 2679
247 Ga0501039_0376620 3300049575 Bacteria 1115
248 Ga0501040_0015289 3300049576 Bacteria 5073
249 Ga0501040_0018317 3300049576 Bacteria 4648
250 Ga0501040_0049208 3300049576 Bacteria 2882
251 Ga0501040_0085040 3300049576 Bacteria 2195
252 Ga0501040_0136705 3300049576 Bacteria 1726
253 Ga0501040_0142431 3300049576 Bacteria 1689
254 Ga0501040_0239617 3300049576 Bacteria 1293
255 Ga0501041_0033746 3300049577 Bacteria 3097
256 Ga0501041_0251319 3300049577 Bacteria 1111
257 Ga0501042_0002654 3300049578 Bacteria 11005
258 Ga0501042_0031485 3300049578 Bacteria 3752
259 Ga0501042_0046562 3300049578 Bacteria 3092
260 Ga0501042_0116893 3300049578 Bacteria 1920
261 Ga0501042_0135906 3300049578 Bacteria 1772
262 Ga0501043_0000447 3300049579 Bacteria 37128
263 Ga0501043_0093557 3300049579 Bacteria 2363
264 Ga0501043_0357846 3300049579 Bacteria 1108
265 Ga0501046_0000142 3300049580 Bacteria 74959
266 Ga0501046_0023229 3300049580 Bacteria 5103
267 Ga0501048_0000463 3300049582 Bacteria 28472
268 Ga0501048_0009033 3300049582 Bacteria 7503
269 Ga0501048_0026651 3300049582 Bacteria 4207
270 Ga0501048_0080335 3300049582 Bacteria 2301
271 Ga0501048_0089532 3300049582 Bacteria 2171
272 Ga0501048_0112155 3300049582 Bacteria 1926
273 Ga0501067_0000383 3300049583 Bacteria 24079
274 Ga0501067_0007994 3300049583 Bacteria 5873
275 Ga0501067_0024158 3300049583 Bacteria 3369
276 Ga0501067_0062639 3300049583 Bacteria 2059
277 Ga0501068_0006418 3300049584 Bacteria 6482
278 Ga0501068_0012925 3300049584 Bacteria 4744
279 Ga0501068_0138926 3300049584 Bacteria 1522
280 Ga0501069_0001296 3300049585 Bacteria 12265
281 Ga0501069_0023982 3300049585 Bacteria 3327
282 Ga0501069_0025512 3300049585 Bacteria 3232
283 Ga0501069_0055183 3300049585 Bacteria 2213
284 Ga0501069_0097423 3300049585 Bacteria 1667
285 Ga0501069_0138749 3300049585 Bacteria 1394
286 Ga0501070_0000147 3300049586 Bacteria 64876
287 Ga0501070_0001834 3300049586 Bacteria 18730
288 Ga0501070_0031713 3300049586 Bacteria 4428
289 Ga0501070_0065359 3300049586 Bacteria 3011
290 Ga0501070_0252813 3300049586 Bacteria 1441
291 Ga0501071_0001313 3300049587 Bacteria 14179
292 Ga0501071_0059323 3300049587 Bacteria 2769
293 Ga0501071_0157050 3300049587 Bacteria 1699
294 Ga0501072_0003237 3300049588 Bacteria 12225
295 Ga0501072_0018909 3300049588 Bacteria 5316
296 Ga0501072_0040817 3300049588 Bacteria 3644
297 Ga0501072_0071466 3300049588 Bacteria 2742
298 Ga0501072_0129920 3300049588 Bacteria 2007
299 Ga0501072_0186145 3300049588 Bacteria 1656
300 Ga0501072_0193176 3300049588 Bacteria 1623
301 Ga0501072_0397827 3300049588 Bacteria 1093
302 Ga0501073_0004029 3300049589 Bacteria 11041
303 Ga0501073_0013042 3300049589 Bacteria 6061
304 Ga0501073_0026788 3300049589 Bacteria 4127
305 Ga0501073_0031932 3300049589 Bacteria 3757
306 Ga0501073_0072428 3300049589 Bacteria 2400
307 Ga0501074_0001725 3300049590 Bacteria 14925
308 Ga0501074_0002953 3300049590 Bacteria 11950
309 Ga0501074_0006285 3300049590 Bacteria 8578
310 Ga0501074_0027202 3300049590 Bacteria 4147
311 Ga0501074_0040796 3300049590 Bacteria 3360
312 Ga0501074_0085079 3300049590 Bacteria 2266
313 Ga0501074_0135546 3300049590 Bacteria 1761
314 Ga0501075_0027829 3300049591 Bacteria 4168
315 Ga0501075_0056533 3300049591 Bacteria 2954
316 Ga0501075_0118389 3300049591 Bacteria 2014
317 Ga0501075_0127746 3300049591 Bacteria 1936
318 Ga0501076_0005551 3300049592 Bacteria 9086
319 Ga0501076_0047315 3300049592 Bacteria 3400
320 Ga0501076_0104912 3300049592 Bacteria 2281
321 Ga0501076_0281643 3300049592 Bacteria 1362
322 Ga0501076_0369844 3300049592 Bacteria 1178
323 Ga0501077_0107313 3300049593 Bacteria 1769
324 Ga0501077_0176946 3300049593 Bacteria 1356
325 Ga0501233_035294 3300049668 Unclassified 1152
326 Ga0501079_0258235 3300049741 Bacteria 1362
327 Ga0501079_0267956 3300049741 Bacteria 1335
328 Ga0501080_0002069 3300049742 Bacteria 17399
329 Ga0501080_0002616 3300049742 Bacteria 15768
330 Ga0501080_0093582 3300049742 Bacteria 2791
331 Ga0501080_0202905 3300049742 Bacteria 1820
332 Ga0501081_0014130 3300049743 Bacteria 5261
333 Ga0501081_0201174 3300049743 Bacteria 1445
334 Ga0501083_0014972 3300049744 Bacteria 5428
335 Ga0501083_0026836 3300049744 Bacteria 3979
336 Ga0501083_0083672 3300049744 Bacteria 2114
337 Ga0501035_0007443 3300049822 Bacteria 10225
338 Ga0501035_0014336 3300049822 Bacteria 7317
339 Ga0501035_0185698 3300049822 Bacteria 1790
340 Ga0501035_0283145 3300049822 Bacteria 1401
341 Ga0501044_0003385 3300049823 Bacteria 17962
342 Ga0501044_0034360 3300049823 Bacteria 5317
343 Ga0501045_0032046 3300049824 Bacteria 3807
344 Ga0501045_0045232 3300049824 Bacteria 3205
345 Ga0501045_0052714 3300049824 Bacteria 2971
346 Ga0501045_0098417 3300049824 Bacteria 2164
347 Ga0501045_0135114 3300049824 Bacteria 1834
348 nmdc:mga03683_101502_c1 3300050489 Bacteria 1265
349 nmdc:mga03n38_39486_c1 3300050490 Bacteria 2047
350 nmdc:mga03n38_39595_c1 3300050490 Bacteria 2045
351 nmdc:mga03n38_45008_c1 3300050490 Bacteria 1942
352 nmdc:mga03n38_5423_c1 3300050490 Bacteria 4343
353 nmdc:mga00v17_11838_c1 3300050491 Bacteria 4800
354 nmdc:mga00v17_5368_c2 3300050491 Bacteria 5383
355 nmdc:mga00v17_70318_c1 3300050491 Bacteria 2167
356 nmdc:mga00v17_7139_c1 3300050491 Bacteria 5953
357 nmdc:mga0yw44_168583_c1 3300050492 Bacteria 1437
358 nmdc:mga0yw44_218150_c1 3300050492 Bacteria 1263
359 nmdc:mga0yw44_24992_c1 3300050492 Bacteria 3390
360 nmdc:mga0yw44_263312_c1 3300050492 Bacteria 1149
361 nmdc:mga0yw44_41721_c1 3300050492 Bacteria 2732
362 nmdc:mga0yw44_4791_c1 3300050492 Bacteria 6272
363 nmdc:mga0yw44_67460_c1 3300050492 Bacteria 2211
364 nmdc:mga0yw44_73282_c1 3300050492 Bacteria 2130
365 nmdc:mga0yw44_80583_c1 3300050492 Bacteria 2040
366 nmdc:mga0yw44_85104_c1 3300050492 Bacteria 1989
367 nmdc:mga06z11_24027_c1 3300050494 Bacteria 2870
368 nmdc:mga04h51_32440_c1 3300050495 Bacteria 1657
369 nmdc:mga07m45_2371_c1 3300050496 Bacteria 8826
370 nmdc:mga07m45_97758_c1 3300050496 Bacteria 1685
371 nmdc:mga08y16_70063_c1 3300050511 Bacteria 3655
372 Ga0495595_0049962 3300053084 Bacteria 1936
373 Ga0495619_0012694 3300053085 Bacteria 5303
374 Ga0500644_0000328 3300053088 Bacteria 24370
375 Ga0500641_0118999 3300053096 Bacteria 1138
376 Ga0500556_0000532 3300053104 Bacteria 26053
377 Ga0500593_000155 3300053117 Bacteria 27272
378 Ga0501084_0007880 3300054114 Bacteria 8768
379 Ga0501084_0041474 3300054114 Bacteria 3850
380 Ga0501084_0132500 3300054114 Bacteria 2098
381 Ga0501082_0053259 3300060353 Bacteria 3488
382 Ga0501082_0089914 3300060353 Bacteria 2651
383 Ga0501082_0103003 3300060353 Bacteria 2469
384 Ga0530510_0041231 3300061734 Bacteria 3333
385 Ga0530510_0048542 3300061734 Bacteria 3068
386 Ga0530510_0136618 3300061734 Bacteria 1805
387 2515853397 2515154155 Bacteria 7985436
388 2643828398 2643221561 Bacteria 4984412
389 2643893006 2643221576 Bacteria 5214352
390 2643961935 2643221590 Bacteria 5214697
391 2644034225 2643221604 Bacteria 5014917
392 2644090242 2643221615 Bacteria 5487866
393 2644102400 2643221617 Bacteria 5139111
394 2644118062 2643221620 Bacteria 5134593
395 2644230626 2643221641 Bacteria 4490190
396 2644320087 2643221657 Bacteria 5490246
397 2644535212 2643221696 Bacteria 5431823
398 2738871449 2738541305 Bacteria 4910150
399 2740167738 2739367898 Bacteria 4367674
400 2809198700 2808606439 Bacteria 5952208
401 2812333639 2811994874 Bacteria 5367947
402 2812352727 2811994878 Bacteria 5992952
403 2816424618 2816332119 Bacteria 8120218
404 2855389811 2855386786 Bacteria 4752232
405 2857486048 2857481737 Bacteria 4761446
406 2891969733 2891968417 Bacteria 5821697
407 2984576741 2984576629 Bacteria 4248407
408 2990258505 2990256926 Bacteria 4252839
409 8054613303 8054609563 Bacteria 5170090
410 Ga0307405_10120229
411 JGI24737J22298_10004892
412 JGI25406J46586_10024561
413 rootH1_10107614
414 Ga0070658_10043877
415 Ga0070658_10139391
416 Ga0070683_100001719
417 Ga0070683_100015085
418 Ga0070683_100044807
419 Ga0068869_100295341
420 Ga0070680_100066537
421 Ga0070680_100321286
422 Ga0070682_100002180
423 Ga0070682_100119954
424 Ga0070682_100155681
425 Ga0070660_100214225
426 Ga0070687_100094843
427 Ga0070668_100295938
428 Ga0070668_100336718
429 Ga0070659_100241629
430 Ga0070714_100041297
431 Ga0070700_100247271
432 Ga0070678_100174825
433 Ga0070707_100048541
434 Ga0070698_100016704
435 Ga0070679_100006058
436 Ga0070684_100007443
437 Ga0070672_100049862
438 Ga0070686_100171631
439 Ga0070665_100000922
440 Ga0068857_100014967
441 Ga0068856_100207218
442 Ga0068864_100330378
443 Ga0068870_10105429
444 Ga0068858_100027330
445 Ga0081455_10002138
446 Ga0081539_10000170
447 Ga0075365_10004701
448 Ga0075365_10004710
449 Ga0075365_10015792
450 Ga0075365_10018223
451 Ga0075365_10020381
452 Ga0075365_10049186
453 Ga0075365_10051716
454 Ga0075365_10055892
455 Ga0075365_10068594
456 Ga0075365_10103466
457 Ga0075365_10169120
458 Ga0075365_10178464
459 Ga0075363_100000549
460 Ga0075363_100006120
461 Ga0075363_100011456
462 Ga0075363_100023485
463 Ga0075364_10026687
464 Ga0075367_10000780
465 Ga0075367_10006696
466 Ga0075367_10027650
467 Ga0075367_10061894
468 Ga0075369_10026159
469 Ga0075370_10008445
470 Ga0075370_10012033
471 Ga0075370_10182374
472 Ga0068871_100327226
473 Ga0075428_100001295
474 Ga0075429_100071251
475 Ga0068865_100467938
476 Ga0111539_10159318
477 Ga0105245_10004476
478 Ga0105245_10298507
479 Ga0114129_10002694
480 Ga0105243_10052815
481 Ga0105243_10248825
482 Ga0105243_10268401
483 Ga0105243_10282243
484 Ga0105243_10659033
485 Ga0105238_10167404
486 Ga0105238_10239163
487 Ga0105239_10014214
488 Ga0105246_10009895
489 Ga0105246_10093861
490 Ga0157374_10246693
491 Ga0163162_10066777
492 Ga0157372_10052431
493 Ga0157372_10062589
494 Ga0157372_10098273
495 Ga0157375_10074482
496 Ga0157375_10120859
497 Ga0157375_10162290
498 Ga0157375_10579407
499 Ga0163163_10018595
500 Ga0163163_10066683
501 Ga0163163_10239749
502 Ga0163163_10294864
503 Ga0157377_10196457
504 Ga0157379_10127175
505 Ga0157376_10305261
506 Ga0206353_11167678
507 Ga0207642_10016096
508 Ga0207688_10076587
509 Ga0207647_10031434
510 Ga0207647_10054365
511 Ga0207643_10100833
512 Ga0207643_10188856
513 Ga0207705_10093617
514 Ga0207705_10210681
515 Ga0207654_10170079
516 Ga0207660_10052057
517 Ga0207662_10082659
518 Ga0207657_10074372
519 Ga0207646_10487207
520 Ga0207687_10108715
521 Ga0207664_10011549
522 Ga0207709_10117330
523 Ga0207689_10149488
524 Ga0207661_10010020
525 Ga0207661_10037584
526 Ga0207679_10023076
527 Ga0207651_10124652
528 Ga0207712_10198521
529 Ga0207668_10340398
530 Ga0207658_10070479
531 Ga0207703_10060066
532 Ga0207708_10047275
533 Ga0207708_10090454
534 Ga0207648_10189460
535 Ga0207676_10131588
536 Ga0207674_10024041
537 Ga0207674_10079664
538 Ga0207674_10412357
539 Ga0207683_10129820
540 Ga0207698_10177552
541 Ga0209813_10013680
542 Ga0268266_10024492
543 Ga0268264_10001706
544 Ga0307408_100268756
545 Ga0307405_10140100
546 Ga0307410_10029295
547 Ga0307406_10032289
548 Ga0307412_10099961
549 Ga0307409_100044376
550 Ga0307409_100071572
551 Ga0307409_100099670
552 Ga0307409_100121597
553 Ga0307409_100193478
554 Ga0307416_100049567
555 Ga0307416_100688177
556 Ga0307414_10078979
557 Ga0307411_10077474
558 Ga0307415_100053575
559 Ga0395899_0079604
560 Ga0395900_0367596
561 Ga0395898_0052882
562 Ga0395898_0266459
563 Ga0395901_0390051
564 Ga0395901_0416766
565 Ga0439434_0008569
566 Ga0466969_0073434
567 Ga0466965_0023124
568 Ga0466965_0073731
569 Ga0466965_0125058
570 Ga0466966_0016422
571 Ga0466966_0205527
572 Ga0466961_0228864
573 Ga0466963_0115304
574 Ga0466963_0209071
575 Ga0466963_0220957
576 Ga0466964_0007169
577 Ga0466970_0031051
578 Ga0466970_0075444
579 Ga0466957_0019784
580 Ga0466960_0000481
581 Ga0466960_0199485
582 Ga0466967_0028353
583 Ga0466967_0180190
584 Ga0466967_0224714
585 Ga0466967_0229775
586 Ga0466967_0418141
587 Ga0466967_0451806
588 Ga0495653_0010419
589 Ga0495582_0151215
590 Ga0495581_0039328
591 Ga0496100_0084380
592 Ga0496101_0029925
593 Ga0496102_0010263
594 Ga0496102_0246410
595 Ga0496102_0329179
596 Ga0496103_0142242
597 Ga0496104_0002599
598 Ga0496104_0286134
599 Ga0496105_0004121
600 Ga0496105_0068258
601 Ga0496107_0006778
602 Ga0496107_0024960
603 Ga0496107_0042917
604 Ga0496107_0284389
605 Ga0496108_0030398
606 Ga0496108_0032456
607 Ga0496108_0133249
608 Ga0496109_0010827
609 Ga0496109_0030680
610 Ga0496109_0037914
611 Ga0496109_0080768
612 Ga0496109_0090216
613 Ga0496109_0458897
614 Ga0496110_0034025
615 Ga0496110_0320971
616 Ga0496111_0031010
617 Ga0496111_0077656
618 Ga0496111_0149845
619 Ga0496113_0042397
620 Ga0496114_0005773
621 Ga0496114_0226848
622 Ga0496114_0332704
623 Ga0496114_0337456
624 Ga0496115_0003224
625 Ga0496115_0106196
626 Ga0501031_0007640
627 Ga0501031_0015452
628 Ga0501031_0078243
629 Ga0501031_0115751
630 Ga0501032_0005756
631 Ga0501032_0013472
632 Ga0501032_0141689
633 Ga0501032_0167779
634 Ga0501033_0001183
635 Ga0501034_0025216
636 Ga0501036_0000447
637 Ga0501036_0009418
638 Ga0501036_0066737
639 Ga0501036_0184251
640 Ga0501036_0324325
641 Ga0501037_0036522
642 Ga0501037_0038996
643 Ga0501037_0054506
644 Ga0501037_0116308
645 Ga0501037_0240839
646 Ga0501038_0007019
647 Ga0501038_0043083
648 Ga0501038_0044354
649 Ga0501038_0175725
650 Ga0501039_0004397
651 Ga0501039_0013140
652 Ga0501039_0032548
653 Ga0501039_0052908
654 Ga0501039_0054157
655 Ga0501039_0072337
656 Ga0501039_0376620
657 Ga0501040_0015289
658 Ga0501040_0018317
659 Ga0501040_0049208
660 Ga0501040_0085040
661 Ga0501040_0136705
662 Ga0501040_0142431
663 Ga0501040_0239617
664 Ga0501041_0033746
665 Ga0501041_0251319
666 Ga0501042_0002654
667 Ga0501042_0031485
668 Ga0501042_0046562
669 Ga0501042_0116893
670 Ga0501042_0135906
671 Ga0501043_0000447
672 Ga0501043_0093557
673 Ga0501043_0357846
674 Ga0501046_0000142
675 Ga0501046_0023229
676 Ga0501048_0000463
677 Ga0501048_0009033
678 Ga0501048_0026651
679 Ga0501048_0080335
680 Ga0501048_0089532
681 Ga0501048_0112155
682 Ga0501067_0000383
683 Ga0501067_0007994
684 Ga0501067_0024158
685 Ga0501067_0062639
686 Ga0501068_0006418
687 Ga0501068_0012925
688 Ga0501068_0138926
689 Ga0501069_0001296
690 Ga0501069_0023982
691 Ga0501069_0025512
692 Ga0501069_0055183
693 Ga0501069_0097423
694 Ga0501069_0138749
695 Ga0501070_0000147
696 Ga0501070_0001834
697 Ga0501070_0031713
698 Ga0501070_0065359
699 Ga0501070_0252813
700 Ga0501071_0001313
701 Ga0501071_0059323
702 Ga0501071_0157050
703 Ga0501072_0003237
704 Ga0501072_0018909
705 Ga0501072_0040817
706 Ga0501072_0071466
707 Ga0501072_0129920
708 Ga0501072_0186145
709 Ga0501072_0193176
710 Ga0501072_0397827
711 Ga0501073_0004029
712 Ga0501073_0013042
713 Ga0501073_0026788
714 Ga0501073_0031932
715 Ga0501073_0072428
716 Ga0501074_0001725
717 Ga0501074_0002953
718 Ga0501074_0006285
719 Ga0501074_0027202
720 Ga0501074_0040796
721 Ga0501074_0085079
722 Ga0501074_0135546
723 Ga0501075_0027829
724 Ga0501075_0056533
725 Ga0501075_0118389
726 Ga0501075_0127746
727 Ga0501076_0005551
728 Ga0501076_0047315
729 Ga0501076_0104912
730 Ga0501076_0281643
731 Ga0501076_0369844
732 Ga0501077_0107313
733 Ga0501077_0176946
734 Ga0501233_035294
735 Ga0501079_0258235
736 Ga0501079_0267956
737 Ga0501080_0002069
738 Ga0501080_0002616
739 Ga0501080_0093582
740 Ga0501080_0202905
741 Ga0501081_0014130
742 Ga0501081_0201174
743 Ga0501083_0014972
744 Ga0501083_0026836
745 Ga0501083_0083672
746 Ga0501035_0007443
747 Ga0501035_0014336
748 Ga0501035_0185698
749 Ga0501035_0283145
750 Ga0501044_0003385
751 Ga0501044_0034360
752 Ga0501045_0032046
753 Ga0501045_0045232
754 Ga0501045_0052714
755 Ga0501045_0098417
756 Ga0501045_0135114
757 nmdc:mga03683_101502_c1
758 nmdc:mga03n38_39486_c1
759 nmdc:mga03n38_39595_c1
760 nmdc:mga03n38_45008_c1
761 nmdc:mga03n38_5423_c1
762 nmdc:mga00v17_11838_c1
763 nmdc:mga00v17_5368_c2
764 nmdc:mga00v17_70318_c1
765 nmdc:mga00v17_7139_c1
766 nmdc:mga0yw44_168583_c1
767 nmdc:mga0yw44_218150_c1
768 nmdc:mga0yw44_24992_c1
769 nmdc:mga0yw44_263312_c1
770 nmdc:mga0yw44_41721_c1
771 nmdc:mga0yw44_4791_c1
772 nmdc:mga0yw44_67460_c1
773 nmdc:mga0yw44_73282_c1
774 nmdc:mga0yw44_80583_c1
775 nmdc:mga0yw44_85104_c1
776 nmdc:mga06z11_24027_c1
777 nmdc:mga04h51_32440_c1
778 nmdc:mga07m45_2371_c1
779 nmdc:mga07m45_97758_c1
780 nmdc:mga08y16_70063_c1
781 Ga0495595_0049962
782 Ga0495619_0012694
783 Ga0500644_0000328
784 Ga0500641_0118999
785 Ga0500556_0000532
786 Ga0500593_000155
787 Ga0501084_0007880
788 Ga0501084_0041474
789 Ga0501084_0132500
790 Ga0501082_0053259
791 Ga0501082_0089914
792 Ga0501082_0103003
793 Ga0530510_0041231
794 Ga0530510_0048542
795 Ga0530510_0136618
796 2515853397
797 2643828398
798 2643893006
799 2643961935
800 2644034225
801 2644090242
802 2644102400
803 2644118062
804 2644230626
805 2644320087
806 2644535212
807 2738871449
808 2740167738
809 2809198700
810 2812333639
811 2812352727
812 2816424618
813 2855389811
814 2857486048
815 2891969733
816 2984576741
817 2990258505
818 8054613303

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3n70-assembly3.cif.gz_D the crystal structure of the p-loop ntpase domain of the sigma-54 transport activator from e. coli to 2.8a 0.6169 2 113
7tjk-assembly1.cif.gz_B s. cerevisiae orc bound to 84 bp ars1 dna and cdc6 (state 2) with docked orc6 n-terminal domain 0.612 2 121
7tjh-assembly1.cif.gz_B s. cerevisiae orc bound to 84 bp ars1 dna and cdc6 (state 1) with flexible orc6 n-terminal domain 0.6115 2 121
6tjv-assembly1.cif.gz_N structure of the ndh-1ms complex from thermosynechococcus elongatus 0.6115 34 100
3n70-assembly2.cif.gz_C the crystal structure of the p-loop ntpase domain of the sigma-54 transport activator from e. coli to 2.8a 0.6002 2 118
ID Description Score Start End Superfamily
af_P71730_190_310_1.20.272.10 Mainly Alpha;Up-down Bundle;Zinc Finger, Delta Prime; domain 3; 0.9388 192 312 1.20.272.10
3zh9B02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9355 122 185 1.10.8.60
af_P71730_190_310_1.20.272.10 Mainly Alpha;Up-down Bundle;Zinc Finger, Delta Prime; domain 3; 0.9168 192 312 1.20.272.10
af_P71730_1_116_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.916 1 118 3.40.50.300
af_P71730_1_116_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9087 1 118 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A4Q4CPX4-F1-model_v4 DNA-directed DNA polymerase (EC 2.7.7.7) 0.9812 197 318 GO:0003677
GO:0006261
GO:0009360
AF-A0A4Q4CPX4-F1-model_v4 DNA-directed DNA polymerase (EC 2.7.7.7) 0.9656 197 318 GO:0003677
GO:0006261
GO:0009360
AF-W4UED2-F1-model_v4 deleted 0.9108 2 201
AF-A0A381Z543-F1-model_v4 Uncharacterized protein 0.8533 2 168 GO:0006261
GO:0009360
AF-A0A3D0S8R2-F1-model_v4 DNA polymerase III subunit delta (EC 2.7.7.7) 0.8354 2 187 GO:0003677
GO:0003887
GO:0006261
GO:0009360

Map