F437019

General Info

Members Datasets Scaffolds Average Seq Length
409 272 818 167

Family's Representative Sequence

Representative Sequence 3300026142|Ga0207698_10584466|Ga0207698_105844662
Length 202
Sequence MSAPEPHGPAAPPLSVSHWFNTDVALSLAQLRGRVVLLHAFQMLCPACVSHGLPQAVKVHRAFPRSEVVVVGLHSVFEHHEAMAPHALQAFLGEYRIPFPVAVDLPSPRGPIADPVPTTLQAYGLRGTPSLLLIDQRGIIRLQHFGLIEDLQLGVMLGRLVAELAPRQEETSRSSASDGGNDGAPGAVDGSGCTPLQCPVIR

Samples

Sample ID Description Type Environment
1 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
99 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
105 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
106 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
108 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
113 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
115 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
166 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
173 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
174 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
175 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
180 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
181 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
182 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
183 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
184 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
185 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
186 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
187 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
201 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
202 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
203 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
204 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
205 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
206 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
207 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
208 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
222 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
223 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
224 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
225 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
226 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
227 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
228 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
229 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
230 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
231 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
234 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
235 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
236 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
237 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
238 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
239 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
240 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
241 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
242 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
243 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
244 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
245 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
246 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
247 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
248 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
249 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
250 2738541277 Variovorax sp. GV051 Isolate Unclassified
251 2738541307 Variovorax sp. GV008 Isolate Unclassified
252 2738543019 Variovorax sp. GV040 Isolate Unclassified
253 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
254 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
255 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
256 2849560528 Caulobacter zeae 410 Isolate Unclassified
257 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
258 2851153111 Caulobacter radicis 736 Isolate Unclassified
259 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
260 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
261 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
262 2904699407
263 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
264 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
265 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
266 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
267 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
268 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
269 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
270 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
271 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
272 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.89
Metatranscriptomes 0.74
Isolates 6.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.25
Nodule 1.71
Rhizoplane 4.65
Rhizosphere 73.35
Stem 0
Stem Tuber 0
Unclassified 2.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207698_10584466 3300026142 Bacteria 1099
2 JGI25152J39213_1004268 3300002773 Bacteria 4561
3 JGI25159J45721_1013124 3300002987 Bacteria 1935
4 JGI25151J46595_10001401 3300003187 Bacteria 16575
5 rootH2_10278479 3300003320 Bacteria 1037
6 rootH1_10086838 3300003323 Bacteria 4146
7 JGI25160J50197_1012928 3300003354 Bacteria 2869
8 Ga0055526_1053402 3300003771 Bacteria 905
9 Ga0055534_1027074 3300003784 Bacteria 907
10 Ga0055528_1000442 3300003790 Bacteria 33264
11 Ga0055540_1000916 3300003792 Bacteria 19242
12 Ga0065165_1010121 3300005262 Bacteria 4127
13 Ga0070658_11115489 3300005327 Bacteria 686
14 Ga0070690_100171559 3300005330 Bacteria 1493
15 Ga0070670_100242372 3300005331 Bacteria 1570
16 Ga0068869_100035183 3300005334 Bacteria 3548
17 Ga0070666_10498377 3300005335 Bacteria 883
18 Ga0070680_100011594 3300005336 Bacteria 6828
19 Ga0070680_100085187 3300005336 Bacteria 2611
20 Ga0070680_100524735 3300005336 Bacteria 1014
21 Ga0070682_100008453 3300005337 Bacteria 5810
22 Ga0068868_100036090 3300005338 Bacteria 3824
23 Ga0070660_100015902 3300005339 Bacteria 5447
24 Ga0070660_100109766 3300005339 Bacteria 2193
25 Ga0070689_100297927 3300005340 Bacteria 1342
26 Ga0070687_100051242 3300005343 Bacteria 2136
27 Ga0070661_100300639 3300005344 Bacteria 1249
28 Ga0070668_100008656 3300005347 Bacteria 7556
29 Ga0070669_100429225 3300005353 Bacteria 1086
30 Ga0070671_100263557 3300005355 Bacteria 1465
31 Ga0070674_100091328 3300005356 Bacteria 2199
32 Ga0070674_100249236 3300005356 Bacteria 1394
33 Ga0070673_101517948 3300005364 Bacteria 632
34 Ga0070659_100270956 3300005366 Bacteria 1411
35 Ga0070667_100383106 3300005367 Bacteria 1278
36 Ga0070705_100244503 3300005440 Bacteria 1256
37 Ga0070700_100696715 3300005441 Unclassified 807
38 Ga0070700_100744010 3300005441 Bacteria 784
39 Ga0070663_100033722 3300005455 Bacteria 3539
40 Ga0070663_100067918 3300005455 Bacteria 2587
41 Ga0070663_100200227 3300005455 Unclassified 1558
42 Ga0070678_100750176 3300005456 Bacteria 883
43 Ga0070662_100236260 3300005457 Bacteria 1464
44 Ga0070662_100312796 3300005457 Unclassified 1279
45 Ga0070681_10004974 3300005458 Bacteria 12787
46 Ga0070681_10351688 3300005458 Bacteria 1384
47 Ga0068867_100476381 3300005459 Unclassified 1069
48 Ga0070685_10168793 3300005466 Bacteria 1401
49 Ga0070679_100012817 3300005530 Bacteria 8021
50 Ga0070679_100035299 3300005530 Bacteria 4960
51 Ga0070684_100278022 3300005535 Bacteria 1534
52 Ga0068853_100033313 3300005539 Bacteria 4370
53 Ga0068853_100101214 3300005539 Bacteria 2548
54 Ga0070686_100261374 3300005544 Bacteria 1269
55 Ga0070696_100204950 3300005546 Bacteria 1474
56 Ga0070693_100032921 3300005547 Bacteria 2856
57 Ga0070665_100050703 3300005548 Bacteria 4165
58 Ga0070665_100547330 3300005548 Bacteria 1169
59 Ga0070704_101160768 3300005549 Bacteria 703
60 Ga0068855_100049665 3300005563 Bacteria 4946
61 Ga0068855_101399173 3300005563 Bacteria 721
62 Ga0070664_100205459 3300005564 Bacteria 1759
63 Ga0068857_100109510 3300005577 Bacteria 2482
64 Ga0068857_100258124 3300005577 Bacteria 1599
65 Ga0068857_100950007 3300005577 Bacteria 826
66 Ga0068856_100000434 3300005614 Bacteria 45889
67 Ga0068856_100058905 3300005614 Bacteria 3793
68 Ga0068852_100043077 3300005616 Bacteria 3826
69 Ga0068852_100046876 3300005616 Bacteria 3684
70 Ga0068859_100386053 3300005617 Bacteria 1496
71 Ga0068864_100026150 3300005618 Bacteria 4920
72 Ga0068861_100020607 3300005719 Bacteria 4726
73 Ga0068851_10293383 3300005834 Bacteria 933
74 Ga0068870_10027338 3300005840 Bacteria 2852
75 Ga0068863_100137670 3300005841 Bacteria 2333
76 Ga0068858_100009865 3300005842 Bacteria 9074
77 Ga0068860_100038242 3300005843 Bacteria 4590
78 Ga0068862_101176202 3300005844 Bacteria 765
79 Ga0075365_10017083 3300006038 Bacteria 4429
80 Ga0075368_10025004 3300006042 Bacteria 2290
81 Ga0075364_10075796 3300006051 Bacteria 2219
82 Ga0075362_10000661 3300006177 Bacteria 10159
83 Ga0075367_10076857 3300006178 Bacteria 2015
84 Ga0075369_10017853 3300006186 Bacteria 2882
85 Ga0075369_10170849 3300006186 Bacteria 998
86 Ga0075366_10504919 3300006195 Bacteria 748
87 Ga0075370_10288722 3300006353 Bacteria 975
88 Ga0068871_100111836 3300006358 Bacteria 2298
89 Ga0075428_102364220 3300006844 Bacteria 546
90 Ga0068865_100358868 3300006881 Unclassified 1183
91 Ga0097620_100386088 3300006931 Bacteria 1496
92 Ga0075435_100126793 3300007076 Bacteria 2134
93 Ga0105240_10026676 3300009093 Bacteria 7579
94 Ga0105240_10150810 3300009093 Bacteria 2769
95 Ga0105240_10395623 3300009093 Bacteria 1557
96 Ga0105245_10015142 3300009098 Bacteria 6718
97 Ga0105247_10076693 3300009101 Bacteria 2099
98 Ga0105241_10002458 3300009174 Bacteria 13919
99 Ga0105241_10045051 3300009174 Bacteria 3345
100 Ga0105242_10518595 3300009176 Bacteria 1137
101 Ga0105248_10042929 3300009177 Bacteria 5070
102 Ga0105237_10388355 3300009545 Bacteria 1401
103 Ga0105237_10441666 3300009545 Bacteria 1307
104 Ga0105237_11016680 3300009545 Bacteria 836
105 Ga0105238_10019967 3300009551 Bacteria 6821
106 Ga0105238_10084691 3300009551 Bacteria 3160
107 Ga0105238_10307542 3300009551 Bacteria 1570
108 Ga0105033_103344 3300009986 Bacteria 1348
109 Ga0105239_10034160 3300010375 Bacteria 5583
110 Ga0105239_10410662 3300010375 Bacteria 1533
111 Ga0105246_10653357 3300011119 Bacteria 916
112 Ga0157370_10032002 3300013104 Bacteria 5140
113 Ga0157369_10076245 3300013105 Bacteria 3594
114 Ga0157369_10080586 3300013105 Bacteria 3485
115 Ga0171463_1016 3300013249 Bacteria 62129
116 Ga0157374_10040645 3300013296 Bacteria 4284
117 Ga0157378_10692395 3300013297 Bacteria 1038
118 Ga0163162_11367682 3300013306 Bacteria 805
119 Ga0157372_10013953 3300013307 Bacteria 8585
120 Ga0157372_10624655 3300013307 Bacteria 1255
121 Ga0157375_10022710 3300013308 Bacteria 5776
122 Ga0163163_10051524 3300014325 Bacteria 4059
123 Ga0157377_10141939 3300014745 Bacteria 1477
124 Ga0157379_10567256 3300014968 Bacteria 1057
125 Ga0157376_10240859 3300014969 Bacteria 1685
126 Ga0183365_11095 3300015684 Bacteria 968
127 Ga0183363_1252 3300015690 Bacteria 8938
128 Ga0163161_10331761 3300017792 Bacteria 1205
129 Ga0206354_10631390 3300020081 Unclassified 1120
130 Ga0206353_11895052 3300020082 Bacteria 2374
131 Ga0154015_1492416 3300020610 Bacteria 1780
132 Ga0207425_1016230 3300025245 Bacteria 1656
133 Ga0209129_1000078 3300025258 Bacteria 192880
134 Ga0209673_1000015 3300025273 Bacteria 530618
135 Ga0209130_1007340 3300025284 Bacteria 3415
136 Ga0209675_1008255 3300025291 Bacteria 3854
137 Ga0209676_1048700 3300025292 Bacteria 1130
138 Ga0209025_1000038 3300025294 Bacteria 380508
139 Ga0209025_1001137 3300025294 Bacteria 38011
140 Ga0209564_1004318 3300025295 Bacteria 8779
141 Ga0209758_1044014 3300025297 Bacteria 1638
142 Ga0209256_1010750 3300025299 Bacteria 3777
143 Ga0209256_1032207 3300025299 Bacteria 1424
144 Ga0207426_1008441 3300025302 Bacteria 4159
145 Ga0209051_1000355 3300025303 Bacteria 67873
146 Ga0209051_1093270 3300025303 Bacteria 830
147 Ga0209257_1019079 3300025304 Bacteria 2601
148 Ga0207656_10411371 3300025321 Bacteria 681
149 Ga0207642_10080024 3300025899 Unclassified 1584
150 Ga0207710_10032066 3300025900 Bacteria 2301
151 Ga0207688_10027472 3300025901 Bacteria 3131
152 Ga0207680_10491599 3300025903 Bacteria 873
153 Ga0207643_10014595 3300025908 Bacteria 4270
154 Ga0207705_10004343 3300025909 Bacteria 10725
155 Ga0207705_10133657 3300025909 Bacteria 1848
156 Ga0207705_11110519 3300025909 Bacteria 609
157 Ga0207654_10076735 3300025911 Bacteria 2001
158 Ga0207654_10425200 3300025911 Bacteria 928
159 Ga0207707_10050994 3300025912 Bacteria 3603
160 Ga0207695_10085605 3300025913 Bacteria 3181
161 Ga0207695_10106560 3300025913 Bacteria 2789
162 Ga0207695_10211305 3300025913 Bacteria 1851
163 Ga0207695_10875511 3300025913 Bacteria 778
164 Ga0207671_10163422 3300025914 Bacteria 1725
165 Ga0207660_10052970 3300025917 Bacteria 2890
166 Ga0207657_10016649 3300025919 Bacteria 7083
167 Ga0207649_10858779 3300025920 Bacteria 710
168 Ga0207652_10016878 3300025921 Bacteria 5969
169 Ga0207652_10026770 3300025921 Bacteria 4806
170 Ga0207652_10053050 3300025921 Bacteria 3482
171 Ga0207681_10158995 3300025923 Bacteria 1701
172 Ga0207681_10631621 3300025923 Bacteria 887
173 Ga0207694_10044617 3300025924 Bacteria 3423
174 Ga0207650_10201524 3300025925 Bacteria 1594
175 Ga0207687_10081523 3300025927 Bacteria 2338
176 Ga0207644_10043299 3300025931 Bacteria 3194
177 Ga0207706_10055232 3300025933 Bacteria 3503
178 Ga0207706_10178190 3300025933 Bacteria 1867
179 Ga0207670_10287904 3300025936 Bacteria 1282
180 Ga0207669_10069995 3300025937 Bacteria 2198
181 Ga0207711_10164945 3300025941 Bacteria 2007
182 Ga0207689_10061064 3300025942 Bacteria 3099
183 Ga0207679_10082687 3300025945 Bacteria 2459
184 Ga0207667_10101955 3300025949 Bacteria 2961
185 Ga0207651_11055232 3300025960 Bacteria 727
186 Ga0207668_10026304 3300025972 Bacteria 3776
187 Ga0207640_10097023 3300025981 Bacteria 2057
188 Ga0207658_10124064 3300025986 Bacteria 2064
189 Ga0207677_10027435 3300026023 Bacteria 3586
190 Ga0207703_10012749 3300026035 Bacteria 6555
191 Ga0207639_10029321 3300026041 Bacteria 4027
192 Ga0207639_10048855 3300026041 Bacteria 3204
193 Ga0207678_10020529 3300026067 Bacteria 5791
194 Ga0207678_10032601 3300026067 Bacteria 4540
195 Ga0207678_10229546 3300026067 Unclassified 1589
196 Ga0207702_10000041 3300026078 Bacteria 150754
197 Ga0207702_10083482 3300026078 Bacteria 2780
198 Ga0207641_10055233 3300026088 Bacteria 3372
199 Ga0207648_10405193 3300026089 Bacteria 1236
200 Ga0207676_10021787 3300026095 Bacteria 4705
201 Ga0207674_10036975 3300026116 Bacteria 5081
202 Ga0207674_10212408 3300026116 Bacteria 1884
203 Ga0207674_10673690 3300026116 Bacteria 999
204 Ga0207675_100045087 3300026118 Bacteria 4120
205 Ga0207683_10045001 3300026121 Bacteria 3859
206 Ga0207698_10136945 3300026142 Bacteria 2102
207 Ga0209813_10077424 3300027866 Bacteria 1093
208 Ga0268266_10031309 3300028379 Bacteria 4516
209 Ga0268265_10393711 3300028380 Bacteria 1278
210 Ga0268264_10049226 3300028381 Bacteria 3506
211 Ga0307408_100359844 3300031548 Bacteria 1237
212 Ga0307405_11037606 3300031731 Bacteria 701
213 Ga0307413_10204963 3300031824 Bacteria 1427
214 Ga0307410_10014423 3300031852 Bacteria 4649
215 Ga0307410_10602876 3300031852 Bacteria 916
216 Ga0307406_10013112 3300031901 Bacteria 4740
217 Ga0307406_10461385 3300031901 Bacteria 1021
218 Ga0307407_10363873 3300031903 Bacteria 1028
219 Ga0307412_10112718 3300031911 Bacteria 1945
220 Ga0307412_10403568 3300031911 Bacteria 1113
221 Ga0307409_100076215 3300031995 Bacteria 2688
222 Ga0307416_100019745 3300032002 Bacteria 4787
223 Ga0307414_10032917 3300032004 Bacteria 3419
224 Ga0307414_10749381 3300032004 Bacteria 887
225 Ga0307411_10014292 3300032005 Bacteria 4411
226 Ga0307415_100075194 3300032126 Bacteria 2390
227 Ga0395899_0052286 3300037312 Bacteria 3029
228 Ga0395899_0285868 3300037312 Bacteria 1120
229 Ga0395900_0064914 3300037418 Bacteria 3750
230 Ga0395898_0020537 3300037466 Bacteria 6708
231 Ga0395901_0319322 3300038443 Bacteria 1607
232 Ga0395901_0355060 3300038443 Bacteria 1512
233 Ga0439465_0044193 3300041413 Bacteria 1447
234 Ga0451800_0169498 3300041459 Bacteria 746
235 Ga0451802_0097151 3300041460 Bacteria 789
236 Ga0439445_0114317 3300042004 Bacteria 772
237 Ga0439448_0050468 3300042005 Bacteria 1361
238 Ga0439449_0010754 3300042007 Bacteria 3454
239 Ga0439462_0080102 3300042015 Bacteria 892
240 Ga0466966_0286858 3300044684 Bacteria 990
241 Ga0466967_0152812 3300045976 Bacteria 2159
242 Ga0496101_0033760 3300048904 Bacteria 3611
243 Ga0496101_0070422 3300048904 Bacteria 2561
244 Ga0496101_1248951 3300048904 Bacteria 581
245 Ga0496102_0114072 3300048905 Bacteria 2521
246 Ga0496102_0168144 3300048905 Bacteria 2064
247 Ga0496103_0055767 3300048906 Bacteria 2451
248 Ga0496104_0069226 3300048907 Bacteria 3354
249 Ga0496105_0062382 3300048908 Bacteria 3076
250 Ga0496106_0510400 3300048909 Bacteria 965
251 Ga0496107_0201515 3300048910 Bacteria 1479
252 Ga0496108_1095372 3300048911 Bacteria 677
253 Ga0496109_0019276 3300048912 Bacteria 6012
254 Ga0496109_0052421 3300048912 Bacteria 3718
255 Ga0496111_0080210 3300048914 Bacteria 2381
256 Ga0496112_0075750 3300048915 Bacteria 3327
257 Ga0496114_0077622 3300048917 Bacteria 2800
258 Ga0496116_0057157 3300048919 Bacteria 2552
259 Ga0496117_0007860 3300048920 Bacteria 10261
260 Ga0496121_0006799 3300048924 Bacteria 14014
261 Ga0496121_0080328 3300048924 Bacteria 2585
262 Ga0496121_0102236 3300048924 Bacteria 2208
263 Ga0496121_0506022 3300048924 Bacteria 765
264 Ga0496122_0027524 3300048925 Bacteria 4857
265 Ga0496123_0031077 3300048926 Bacteria 3893
266 Ga0496123_0051448 3300048926 Bacteria 2743
267 Ga0496123_0114256 3300048926 Bacteria 1535
268 Ga0496124_0113378 3300048927 Bacteria 2179
269 Ga0496124_0462345 3300048927 Bacteria 862
270 Ga0496125_0200329 3300048928 Bacteria 1308
271 Ga0496125_0233762 3300048928 Bacteria 1173
272 Ga0496126_0078190 3300048929 Bacteria 2932
273 Ga0496126_0224208 3300048929 Bacteria 1577
274 Ga0496126_0298153 3300048929 Bacteria 1331
275 Ga0496126_0370937 3300048929 Bacteria 1167
276 Ga0496126_0400743 3300048929 Bacteria 1113
277 Ga0501031_0150881 3300049568 Bacteria 1518
278 Ga0501032_0008876 3300049569 Bacteria 7309
279 Ga0501032_0014053 3300049569 Bacteria 5679
280 Ga0501032_0016999 3300049569 Bacteria 5111
281 Ga0501032_0017348 3300049569 Bacteria 5055
282 Ga0501032_0492621 3300049569 Unclassified 784
283 Ga0501033_0000205 3300049570 Bacteria 56697
284 Ga0501033_0244664 3300049570 Bacteria 1272
285 Ga0501033_0356261 3300049570 Bacteria 1024
286 Ga0501033_0487770 3300049570 Bacteria 853
287 Ga0501034_0015387 3300049571 Bacteria 7863
288 Ga0501034_0821679 3300049571 Bacteria 821
289 Ga0501034_0978999 3300049571 Bacteria 730
290 Ga0501034_1239625 3300049571 Bacteria 624
291 Ga0501034_1340804 3300049571 Bacteria 591
292 Ga0501036_0012817 3300049572 Bacteria 6956
293 Ga0501036_0035657 3300049572 Bacteria 4208
294 Ga0501036_0454155 3300049572 Bacteria 1067
295 Ga0501036_0516550 3300049572 Bacteria 993
296 Ga0501036_1014274 3300049572 Bacteria 679
297 Ga0501037_0001379 3300049573 Bacteria 17807
298 Ga0501037_0003658 3300049573 Bacteria 11155
299 Ga0501037_0008534 3300049573 Bacteria 7514
300 Ga0501037_0320576 3300049573 Bacteria 1073
301 Ga0501037_0463036 3300049573 Bacteria 864
302 Ga0501037_0538089 3300049573 Bacteria 789
303 Ga0501038_0001244 3300049574 Bacteria 23089
304 Ga0501038_0052038 3300049574 Bacteria 3531
305 Ga0501038_0108105 3300049574 Bacteria 2306
306 Ga0501038_0178028 3300049574 Bacteria 1717
307 Ga0501038_0375618 3300049574 Bacteria 1103
308 Ga0501039_0007875 3300049575 Bacteria 8123
309 Ga0501039_0018184 3300049575 Bacteria 5394
310 Ga0501039_0507003 3300049575 Bacteria 947
311 Ga0501042_0050878 3300049578 Bacteria 2955
312 Ga0501042_0182930 3300049578 Bacteria 1512
313 Ga0501043_0026232 3300049579 Bacteria 4571
314 Ga0501043_0110505 3300049579 Bacteria 2158
315 Ga0501043_0345662 3300049579 Bacteria 1131
316 Ga0501043_0440888 3300049579 Bacteria 980
317 Ga0501043_0902623 3300049579 Bacteria 634
318 Ga0501046_0001976 3300049580 Bacteria 19482
319 Ga0501046_0042272 3300049580 Bacteria 3634
320 Ga0501046_0052601 3300049580 Bacteria 3209
321 Ga0501046_0147030 3300049580 Bacteria 1779
322 Ga0501047_0000089 3300049581 Bacteria 117033
323 Ga0501047_0009531 3300049581 Bacteria 9179
324 Ga0501047_0038160 3300049581 Bacteria 4646
325 Ga0501048_0012972 3300049582 Bacteria 6188
326 Ga0501048_0195143 3300049582 Bacteria 1435
327 Ga0501067_0002976 3300049583 Bacteria 9349
328 Ga0501067_0009704 3300049583 Bacteria 5328
329 Ga0501068_0019387 3300049584 Bacteria 3949
330 Ga0501068_0176216 3300049584 Bacteria 1351
331 Ga0501068_0666168 3300049584 Bacteria 680
332 Ga0501069_0078507 3300049585 Bacteria 1857
333 Ga0501070_0029738 3300049586 Bacteria 4578
334 Ga0501070_0064369 3300049586 Bacteria 3037
335 Ga0501070_0113952 3300049586 Bacteria 2234
336 Ga0501070_0197286 3300049586 Bacteria 1653
337 Ga0501070_0327395 3300049586 Bacteria 1246
338 Ga0501071_0015008 3300049587 Bacteria 5309
339 Ga0501073_0007935 3300049589 Bacteria 7875
340 Ga0501073_0014828 3300049589 Bacteria 5656
341 Ga0501073_0853209 3300049589 Bacteria 627
342 Ga0501075_0566433 3300049591 Bacteria 867
343 Ga0501076_0901580 3300049592 Bacteria 729
344 Ga0501080_0025228 3300049742 Bacteria 5517
345 Ga0501080_0039243 3300049742 Bacteria 4419
346 Ga0501080_0099944 3300049742 Bacteria 2692
347 Ga0501080_0230986 3300049742 Bacteria 1691
348 Ga0501080_0331974 3300049742 Bacteria 1375
349 Ga0501080_0516466 3300049742 Bacteria 1066
350 Ga0501083_0003756 3300049744 Bacteria 10661
351 Ga0501083_0048010 3300049744 Bacteria 2883
352 Ga0501083_0121670 3300049744 Bacteria 1712
353 Ga0501035_0017821 3300049822 Bacteria 6550
354 Ga0501035_0356775 3300049822 Bacteria 1222
355 Ga0501035_0427682 3300049822 Bacteria 1098
356 Ga0501035_0499772 3300049822 Bacteria 1001
357 Ga0501035_1214824 3300049822 Bacteria 584
358 Ga0501044_0006324 3300049823 Bacteria 13095
359 Ga0501044_0011450 3300049823 Bacteria 9608
360 Ga0501044_0030416 3300049823 Bacteria 5691
361 Ga0501044_0079886 3300049823 Bacteria 3313
362 Ga0501044_0210382 3300049823 Bacteria 1899
363 Ga0501044_0417974 3300049823 Bacteria 1251
364 Ga0501044_0630202 3300049823 Bacteria 963
365 Ga0501044_1051834 3300049823 Bacteria 684
366 Ga0501045_0051579 3300049824 Bacteria 3002
367 nmdc:mga03683_264_c2 3300050489 Bacteria 3470
368 nmdc:mga03n38_138424_c1 3300050490 Bacteria 1214
369 nmdc:mga03n38_290383_c1 3300050490 Bacteria 875
370 nmdc:mga00v17_96429_c1 3300050491 Bacteria 1863
371 nmdc:mga0yw44_177224_c1 3300050492 Bacteria 1402
372 nmdc:mga0k408_358827_c1 3300050493 Bacteria 869
373 nmdc:mga06z11_198324_c1 3300050494 Bacteria 1165
374 nmdc:mga04h51_34818_c1 3300050495 Bacteria 1611
375 nmdc:mga07m45_51606_c1 3300050496 Bacteria 2320
376 nmdc:mga0rr50_464158_c1 3300050513 Bacteria 1074
377 nmdc:mga0a205_400403_c1 3300050515 Bacteria 1236
378 nmdc:mga0sz30_175024_c1 3300050516 Bacteria 952
379 nmdc:mga0sz30_18873_c1 3300050516 Bacteria 2764
380 Ga0501082_0115743 3300060353 Bacteria 2322
381 Ga0501082_0207358 3300060353 Bacteria 1705
382 Ga0501082_1099938 3300060353 Bacteria 695
383 2513656233 2513237096 Bacteria 8722461
384 2513917588 2513237145 Bacteria 8979722
385 2600197109 2599185352 Bacteria 7228948
386 2644242686 2643221643 Bacteria 5749658
387 2738720972 2738541277 Bacteria 7458140
388 2738886230 2738541307 Bacteria 8606193
389 2739280171 2738543019 Bacteria 7459457
390 2792461791 2791355048 Bacteria 5832535
391 2793070492 2791355197 Bacteria 8420563
392 2843745847 2843744320 Bacteria 5659202
393 2849562240 2849560528 Bacteria 5393480
394 2849577161 2849573788 Bacteria 5421256
395 2851156899 2851153111 Bacteria 5542585
396 2885383304 2885374607 Bacteria 8927485
397 2898331171 2898329390 Bacteria 5168154
398 2904453718 2904449895 Bacteria 6927402
399 2904709508
400 2906640594 2906635258 Bacteria 8601019
401 2906663182 2906660503 Bacteria 8595048
402 2920826362 2920822456 Bacteria 6897201
403 2929167628 2929160207 Bacteria 9075316
404 2945910827 2945909444 Bacteria 7065066
405 3005482838 3005474847 Bacteria 9259049
406 8006935146 8006933436 Bacteria 10410654
407 8006975114 8006973647 Bacteria 10679141
408 8019563554 8019555841 Bacteria 9642137
409 8019573626 8019565922 Bacteria 9639779
410 Ga0207698_10584466
411 JGI25152J39213_1004268
412 JGI25159J45721_1013124
413 JGI25151J46595_10001401
414 rootH2_10278479
415 rootH1_10086838
416 JGI25160J50197_1012928
417 Ga0055526_1053402
418 Ga0055534_1027074
419 Ga0055528_1000442
420 Ga0055540_1000916
421 Ga0065165_1010121
422 Ga0070658_11115489
423 Ga0070690_100171559
424 Ga0070670_100242372
425 Ga0068869_100035183
426 Ga0070666_10498377
427 Ga0070680_100011594
428 Ga0070680_100085187
429 Ga0070680_100524735
430 Ga0070682_100008453
431 Ga0068868_100036090
432 Ga0070660_100015902
433 Ga0070660_100109766
434 Ga0070689_100297927
435 Ga0070687_100051242
436 Ga0070661_100300639
437 Ga0070668_100008656
438 Ga0070669_100429225
439 Ga0070671_100263557
440 Ga0070674_100091328
441 Ga0070674_100249236
442 Ga0070673_101517948
443 Ga0070659_100270956
444 Ga0070667_100383106
445 Ga0070705_100244503
446 Ga0070700_100696715
447 Ga0070700_100744010
448 Ga0070663_100033722
449 Ga0070663_100067918
450 Ga0070663_100200227
451 Ga0070678_100750176
452 Ga0070662_100236260
453 Ga0070662_100312796
454 Ga0070681_10004974
455 Ga0070681_10351688
456 Ga0068867_100476381
457 Ga0070685_10168793
458 Ga0070679_100012817
459 Ga0070679_100035299
460 Ga0070684_100278022
461 Ga0068853_100033313
462 Ga0068853_100101214
463 Ga0070686_100261374
464 Ga0070696_100204950
465 Ga0070693_100032921
466 Ga0070665_100050703
467 Ga0070665_100547330
468 Ga0070704_101160768
469 Ga0068855_100049665
470 Ga0068855_101399173
471 Ga0070664_100205459
472 Ga0068857_100109510
473 Ga0068857_100258124
474 Ga0068857_100950007
475 Ga0068856_100000434
476 Ga0068856_100058905
477 Ga0068852_100043077
478 Ga0068852_100046876
479 Ga0068859_100386053
480 Ga0068864_100026150
481 Ga0068861_100020607
482 Ga0068851_10293383
483 Ga0068870_10027338
484 Ga0068863_100137670
485 Ga0068858_100009865
486 Ga0068860_100038242
487 Ga0068862_101176202
488 Ga0075365_10017083
489 Ga0075368_10025004
490 Ga0075364_10075796
491 Ga0075362_10000661
492 Ga0075367_10076857
493 Ga0075369_10017853
494 Ga0075369_10170849
495 Ga0075366_10504919
496 Ga0075370_10288722
497 Ga0068871_100111836
498 Ga0075428_102364220
499 Ga0068865_100358868
500 Ga0097620_100386088
501 Ga0075435_100126793
502 Ga0105240_10026676
503 Ga0105240_10150810
504 Ga0105240_10395623
505 Ga0105245_10015142
506 Ga0105247_10076693
507 Ga0105241_10002458
508 Ga0105241_10045051
509 Ga0105242_10518595
510 Ga0105248_10042929
511 Ga0105237_10388355
512 Ga0105237_10441666
513 Ga0105237_11016680
514 Ga0105238_10019967
515 Ga0105238_10084691
516 Ga0105238_10307542
517 Ga0105033_103344
518 Ga0105239_10034160
519 Ga0105239_10410662
520 Ga0105246_10653357
521 Ga0157370_10032002
522 Ga0157369_10076245
523 Ga0157369_10080586
524 Ga0171463_1016
525 Ga0157374_10040645
526 Ga0157378_10692395
527 Ga0163162_11367682
528 Ga0157372_10013953
529 Ga0157372_10624655
530 Ga0157375_10022710
531 Ga0163163_10051524
532 Ga0157377_10141939
533 Ga0157379_10567256
534 Ga0157376_10240859
535 Ga0183365_11095
536 Ga0183363_1252
537 Ga0163161_10331761
538 Ga0206354_10631390
539 Ga0206353_11895052
540 Ga0154015_1492416
541 Ga0207425_1016230
542 Ga0209129_1000078
543 Ga0209673_1000015
544 Ga0209130_1007340
545 Ga0209675_1008255
546 Ga0209676_1048700
547 Ga0209025_1000038
548 Ga0209025_1001137
549 Ga0209564_1004318
550 Ga0209758_1044014
551 Ga0209256_1010750
552 Ga0209256_1032207
553 Ga0207426_1008441
554 Ga0209051_1000355
555 Ga0209051_1093270
556 Ga0209257_1019079
557 Ga0207656_10411371
558 Ga0207642_10080024
559 Ga0207710_10032066
560 Ga0207688_10027472
561 Ga0207680_10491599
562 Ga0207643_10014595
563 Ga0207705_10004343
564 Ga0207705_10133657
565 Ga0207705_11110519
566 Ga0207654_10076735
567 Ga0207654_10425200
568 Ga0207707_10050994
569 Ga0207695_10085605
570 Ga0207695_10106560
571 Ga0207695_10211305
572 Ga0207695_10875511
573 Ga0207671_10163422
574 Ga0207660_10052970
575 Ga0207657_10016649
576 Ga0207649_10858779
577 Ga0207652_10016878
578 Ga0207652_10026770
579 Ga0207652_10053050
580 Ga0207681_10158995
581 Ga0207681_10631621
582 Ga0207694_10044617
583 Ga0207650_10201524
584 Ga0207687_10081523
585 Ga0207644_10043299
586 Ga0207706_10055232
587 Ga0207706_10178190
588 Ga0207670_10287904
589 Ga0207669_10069995
590 Ga0207711_10164945
591 Ga0207689_10061064
592 Ga0207679_10082687
593 Ga0207667_10101955
594 Ga0207651_11055232
595 Ga0207668_10026304
596 Ga0207640_10097023
597 Ga0207658_10124064
598 Ga0207677_10027435
599 Ga0207703_10012749
600 Ga0207639_10029321
601 Ga0207639_10048855
602 Ga0207678_10020529
603 Ga0207678_10032601
604 Ga0207678_10229546
605 Ga0207702_10000041
606 Ga0207702_10083482
607 Ga0207641_10055233
608 Ga0207648_10405193
609 Ga0207676_10021787
610 Ga0207674_10036975
611 Ga0207674_10212408
612 Ga0207674_10673690
613 Ga0207675_100045087
614 Ga0207683_10045001
615 Ga0207698_10136945
616 Ga0209813_10077424
617 Ga0268266_10031309
618 Ga0268265_10393711
619 Ga0268264_10049226
620 Ga0307408_100359844
621 Ga0307405_11037606
622 Ga0307413_10204963
623 Ga0307410_10014423
624 Ga0307410_10602876
625 Ga0307406_10013112
626 Ga0307406_10461385
627 Ga0307407_10363873
628 Ga0307412_10112718
629 Ga0307412_10403568
630 Ga0307409_100076215
631 Ga0307416_100019745
632 Ga0307414_10032917
633 Ga0307414_10749381
634 Ga0307411_10014292
635 Ga0307415_100075194
636 Ga0395899_0052286
637 Ga0395899_0285868
638 Ga0395900_0064914
639 Ga0395898_0020537
640 Ga0395901_0319322
641 Ga0395901_0355060
642 Ga0439465_0044193
643 Ga0451800_0169498
644 Ga0451802_0097151
645 Ga0439445_0114317
646 Ga0439448_0050468
647 Ga0439449_0010754
648 Ga0439462_0080102
649 Ga0466966_0286858
650 Ga0466967_0152812
651 Ga0496101_0033760
652 Ga0496101_0070422
653 Ga0496101_1248951
654 Ga0496102_0114072
655 Ga0496102_0168144
656 Ga0496103_0055767
657 Ga0496104_0069226
658 Ga0496105_0062382
659 Ga0496106_0510400
660 Ga0496107_0201515
661 Ga0496108_1095372
662 Ga0496109_0019276
663 Ga0496109_0052421
664 Ga0496111_0080210
665 Ga0496112_0075750
666 Ga0496114_0077622
667 Ga0496116_0057157
668 Ga0496117_0007860
669 Ga0496121_0006799
670 Ga0496121_0080328
671 Ga0496121_0102236
672 Ga0496121_0506022
673 Ga0496122_0027524
674 Ga0496123_0031077
675 Ga0496123_0051448
676 Ga0496123_0114256
677 Ga0496124_0113378
678 Ga0496124_0462345
679 Ga0496125_0200329
680 Ga0496125_0233762
681 Ga0496126_0078190
682 Ga0496126_0224208
683 Ga0496126_0298153
684 Ga0496126_0370937
685 Ga0496126_0400743
686 Ga0501031_0150881
687 Ga0501032_0008876
688 Ga0501032_0014053
689 Ga0501032_0016999
690 Ga0501032_0017348
691 Ga0501032_0492621
692 Ga0501033_0000205
693 Ga0501033_0244664
694 Ga0501033_0356261
695 Ga0501033_0487770
696 Ga0501034_0015387
697 Ga0501034_0821679
698 Ga0501034_0978999
699 Ga0501034_1239625
700 Ga0501034_1340804
701 Ga0501036_0012817
702 Ga0501036_0035657
703 Ga0501036_0454155
704 Ga0501036_0516550
705 Ga0501036_1014274
706 Ga0501037_0001379
707 Ga0501037_0003658
708 Ga0501037_0008534
709 Ga0501037_0320576
710 Ga0501037_0463036
711 Ga0501037_0538089
712 Ga0501038_0001244
713 Ga0501038_0052038
714 Ga0501038_0108105
715 Ga0501038_0178028
716 Ga0501038_0375618
717 Ga0501039_0007875
718 Ga0501039_0018184
719 Ga0501039_0507003
720 Ga0501042_0050878
721 Ga0501042_0182930
722 Ga0501043_0026232
723 Ga0501043_0110505
724 Ga0501043_0345662
725 Ga0501043_0440888
726 Ga0501043_0902623
727 Ga0501046_0001976
728 Ga0501046_0042272
729 Ga0501046_0052601
730 Ga0501046_0147030
731 Ga0501047_0000089
732 Ga0501047_0009531
733 Ga0501047_0038160
734 Ga0501048_0012972
735 Ga0501048_0195143
736 Ga0501067_0002976
737 Ga0501067_0009704
738 Ga0501068_0019387
739 Ga0501068_0176216
740 Ga0501068_0666168
741 Ga0501069_0078507
742 Ga0501070_0029738
743 Ga0501070_0064369
744 Ga0501070_0113952
745 Ga0501070_0197286
746 Ga0501070_0327395
747 Ga0501071_0015008
748 Ga0501073_0007935
749 Ga0501073_0014828
750 Ga0501073_0853209
751 Ga0501075_0566433
752 Ga0501076_0901580
753 Ga0501080_0025228
754 Ga0501080_0039243
755 Ga0501080_0099944
756 Ga0501080_0230986
757 Ga0501080_0331974
758 Ga0501080_0516466
759 Ga0501083_0003756
760 Ga0501083_0048010
761 Ga0501083_0121670
762 Ga0501035_0017821
763 Ga0501035_0356775
764 Ga0501035_0427682
765 Ga0501035_0499772
766 Ga0501035_1214824
767 Ga0501044_0006324
768 Ga0501044_0011450
769 Ga0501044_0030416
770 Ga0501044_0079886
771 Ga0501044_0210382
772 Ga0501044_0417974
773 Ga0501044_0630202
774 Ga0501044_1051834
775 Ga0501045_0051579
776 nmdc:mga03683_264_c2
777 nmdc:mga03n38_138424_c1
778 nmdc:mga03n38_290383_c1
779 nmdc:mga00v17_96429_c1
780 nmdc:mga0yw44_177224_c1
781 nmdc:mga0k408_358827_c1
782 nmdc:mga06z11_198324_c1
783 nmdc:mga04h51_34818_c1
784 nmdc:mga07m45_51606_c1
785 nmdc:mga0rr50_464158_c1
786 nmdc:mga0a205_400403_c1
787 nmdc:mga0sz30_175024_c1
788 nmdc:mga0sz30_18873_c1
789 Ga0501082_0115743
790 Ga0501082_0207358
791 Ga0501082_1099938
792 2513656233
793 2513917588
794 2600197109
795 2644242686
796 2738720972
797 2738886230
798 2739280171
799 2792461791
800 2793070492
801 2843745847
802 2849562240
803 2849577161
804 2851156899
805 2885383304
806 2898331171
807 2904453718
808 2904709508
809 2906640594
810 2906663182
811 2920826362
812 2929167628
813 2945910827
814 3005482838
815 8006935146
816 8006975114
817 8019563554
818 8019573626

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

8

143

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3eyt-assembly1.cif.gz_B crystal structure of thioredoxin-like superfamily protein spoa0173 0.9716 6 158
3eyt-assembly1.cif.gz_B crystal structure of thioredoxin-like superfamily protein spoa0173 0.9531 6 158
3lor-assembly1.cif.gz_B the crystal structure of a thiol-disulfide isomerase from corynebacterium glutamicum to 2.2a 0.9395 4 158
3lor-assembly1.cif.gz_B the crystal structure of a thiol-disulfide isomerase from corynebacterium glutamicum to 2.2a 0.9279 4 158
2hyx-assembly1.cif.gz_B structure of the c-terminal domain of dipz from mycobacterium tuberculosis 0.9178 8 155
ID Description Score Start End Superfamily
3eytD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9599 6 158 3.40.30.10
3lorC00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9433 5 158 3.40.30.10
3lorC00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9372 5 158 3.40.30.10
3eytD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9348 6 158 3.40.30.10
af_Q8VZ10_367_538_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9073 4 155 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A1C9W3S2-F1-model_v4 Redoxin domain-containing protein 0.9871 5 157 GO:0016491
AF-A0A2S5LD43-F1-model_v4 Alkyl hydroperoxide reductase 0.9855 7 159 GO:0016209
GO:0016491
AF-A0A4R2C4P5-F1-model_v4 Peroxiredoxin 0.9838 1 158 GO:0016491
AF-J7Q3B8-F1-model_v4 Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen 0.9835 7 159 GO:0016209
GO:0016491
AF-A0A1R1R1A2-F1-model_v4 deleted 0.9818 8 158

Map