metagRoot

F436994

General Info

Members	Datasets	Scaffolds	Average Seq Length
409	258	375	350

Family's Representative Sequence

Representative Sequence	3300013308\|Ga0157375_10061321\|Ga0157375_100613212
Length	370
Sequence	MSSFQGAGAKGPGGRKLHTPLTELVGIEHPVVQTGMGWVAGARLVSATSNAGGLGILASATMTLEELQTAVTKVKATTDKPFGINMRADAGDAGDRVDLLIREGVKVASFALAPKPELIAKLKDAGVVVIPSVGAAKHAKKVAGWGADAVIVQGGEGGGHTGPVATTLLLPSVLDAVADTGMPVIAAGGFFDGRGLAAALSYGAAGVAMGTRFLLTSDSTVPDAVKQRYLDAALDGTVVSKRVDGMPHRVLRTGLVEKLESGSRARGFSAAIGNAQKFKKMSGMTWASMLKDGMAMRHGKELTWSQVVMAANTPMLLKAGLVEGNIEAGVLASGQVAGIIDDLPSCAELIDSIVAEAVKQLQAASGFIES

Samples

	Sample ID	Description	Type	Environment
1	2523231044	Gordonia rhizosphera NBRC 16068	Isolate	Rhizosphere
2	2551306166	Nocardia tenerifensis NBRC 101015	Isolate	Rhizosphere
3	2565956761	Rhodococcus qingshengii BKS 20-40	Isolate	Rhizosphere
4	2643221687	Mycobacterium sp. Root135	Isolate	Unclassified
5	2643221692	Nocardia sp. Root136	Isolate	Unclassified
6	2643221715	Mycobacterium sp. Root265	Isolate	Unclassified
7	2643221961	Aeromicrobium sp. Root236	Isolate	Unclassified
8	2643221962	Aeromicrobium sp. Root344	Isolate	Unclassified
9	2738541264	Mycobacterium sp. OK889	Isolate	Unclassified
10	2738541308	Rhodococcus sp. OK551	Isolate	Unclassified
11	2738541356	Mycobacterium sp. OK887	Isolate	Unclassified
12	2738543005	Rhodococcus sp. OK519	Isolate	Unclassified
13	2738543011	Rhodococcus sp. OK611	Isolate	Unclassified
14	2744054611	Aldersonia kunmingensis DSM 45001	Isolate	Rhizosphere
15	2751185725	Microbispora sp. NRRL B-24597	Isolate	Unclassified
16	2751185792	Kitasatospora arboriphila NRRL B-24581	Isolate	Unclassified
17	2791354901	Actinophytocola xanthii 11-183	Isolate	Rhizosphere
18	2842134933	Mycolicibacterium obuense SEMIA 442	Isolate	Nodule
19	2889300758	Rhodococcus sp. PvR099	Isolate	Rhizosphere
20	2891395885	Microbispora catharanthi CR1-09	Isolate	Unclassified
21	2899359706	Amycolatopsis anabasis EGI 650086	Isolate	Unclassified
22	2902792274	Mycolicibacterium sp. P9-64	Isolate	Unclassified
23	2902810491	Mycolicibacterium sp. P9-22	Isolate	Unclassified
24	2902837492	Mycolicibacterium sp. P1-18	Isolate	Unclassified
25	2904535858	Rhodococcus erythropolis 2017	Isolate	Unclassified
26	2917736166	Amycolatopsis dendrobii DR6-1	Isolate	Unclassified
27	2919713450	Nocardia kruczakiae 4272	Isolate	Rhizosphere
28	2922554459	Rhodococcus sp. 66b	Isolate	Unclassified
29	2928142448	Prescottella equi DPS 2018	Isolate	Unclassified
30	2932398195	Dietzia sp. 2505	Isolate	Rhizosphere
31	2939582691	Mycolicibacterium sp. 624	Isolate	Rhizosphere
32	2939743619	Rhodococcus sp. PvR044	Isolate	Rhizosphere
33	3002998708	Actinomadura barringtoniae GKU 128	Isolate	Unclassified
34	3300001977	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5	Metagenome	Rhizosphere
35	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
36	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
37	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
38	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
39	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
40	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
41	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
42	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
43	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
44	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
45	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
46	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
47	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
48	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
49	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
50	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
51	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
52	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
53	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
54	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
55	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
56	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
57	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
58	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
59	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
60	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
61	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
62	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
63	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
64	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
65	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
66	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
67	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
68	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
69	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
70	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
71	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
72	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
73	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
74	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
75	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
76	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
77	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
78	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
79	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
80	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
81	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
82	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
83	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
84	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
85	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
86	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
87	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
88	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
89	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
90	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
91	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
92	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
93	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
94	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
95	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
96	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
97	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
98	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
99	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
100	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
101	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
102	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
103	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
104	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
105	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
106	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
107	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
108	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
109	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
110	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
111	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
112	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
113	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
151	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
152	3300030731	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3	Metagenome	Rhizosphere
153	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
154	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
155	3300031838	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM	Metagenome	Unclassified
156	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
157	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
158	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
159	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
160	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
161	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
162	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
163	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
164	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
165	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
166	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
167	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
168	3300041443	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG	Metagenome	Rhizoplane
169	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
170	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
171	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
172	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
173	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
174	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
175	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
176	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
177	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
178	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
179	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
180	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
181	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
182	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
183	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
184	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
185	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
186	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
187	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
188	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
189	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
190	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
191	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
192	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
193	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
194	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
195	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
196	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
197	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
198	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
199	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
200	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
201	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
202	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
203	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
204	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
205	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
206	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
207	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
208	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
209	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
210	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
211	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
212	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
213	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
214	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
215	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
216	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
217	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
218	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
219	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
220	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
221	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
222	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
223	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
224	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
225	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
226	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
227	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
228	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
229	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
230	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
231	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
232	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
233	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
234	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
235	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
236	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
237	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
238	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
239	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
240	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
241	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
242	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
243	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
244	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
245	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
246	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
247	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
248	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
249	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
250	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
251	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
252	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
253	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
254	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
255	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
256	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
257	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
258	8055172936	Sphaerisporangium perillae NEAU-ZS1	Isolate	Unclassified

Type Distribution

Type	Percentage (%)
Metagenomes	91.69
Metatranscriptomes	0
Isolates	8.31

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	6.6
Nodule	0.24
Rhizoplane	11.98
Rhizosphere	65.77
Stem	0
Stem Tuber	0
Unclassified	15.4

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24746J21847_1000601	3300001977	Bacteria	5460
2	JGI24744J21845_10004851	3300002077	Bacteria	2781
3	JGI24742J22300_10000733	3300002244	Bacteria	4997
4	Ga0055540_1000129	3300003792	Bacteria	76241
5	Ga0055540_1001998	3300003792	Bacteria	11401
6	Ga0055540_1002512	3300003792	Bacteria	9594
7	Ga0055540_1017508	3300003792	Bacteria	1998
8	Ga0070676_10008874	3300005328	Bacteria	5432
9	Ga0070683_100072149	3300005329	Bacteria	3222
10	Ga0070690_100019899	3300005330	Bacteria	4083
11	Ga0068869_100080287	3300005334	Bacteria	2433
12	Ga0070682_100008483	3300005337	Bacteria	5799
13	Ga0068868_100001428	3300005338	Bacteria	16479
14	Ga0070689_100002503	3300005340	Bacteria	12019
15	Ga0070691_10006777	3300005341	Bacteria	5240
16	Ga0070668_100000668	3300005347	Bacteria	23244
17	Ga0070668_100003548	3300005347	Bacteria	11507
18	Ga0070669_100002437	3300005353	Bacteria	13471
19	Ga0070669_100004338	3300005353	Bacteria	10248
20	Ga0070671_100177876	3300005355	Bacteria	1801
21	Ga0070674_100000670	3300005356	Bacteria	17325
22	Ga0070673_100265357	3300005364	Bacteria	1501
23	Ga0070688_100039632	3300005365	Bacteria	2884
24	Ga0070688_100064896	3300005365	Bacteria	2318
25	Ga0070667_100000220	3300005367	Bacteria	65980
26	Ga0070667_100000519	3300005367	Bacteria	38707
27	Ga0070667_100004829	3300005367	Bacteria	11293
28	Ga0070667_100007327	3300005367	Bacteria	9169
29	Ga0070667_100318743	3300005367	Bacteria	1402
30	Ga0070709_10019651	3300005434	Bacteria	3909
31	Ga0070710_10000214	3300005437	Bacteria	27065
32	Ga0070710_10001043	3300005437	Bacteria	13171
33	Ga0070701_10005140	3300005438	Bacteria	5375
34	Ga0070711_100000314	3300005439	Bacteria	25098
35	Ga0070705_100028014	3300005440	Bacteria	3081
36	Ga0070700_100016736	3300005441	Bacteria	4181
37	Ga0070694_100005396	3300005444	Bacteria	7739
38	Ga0070663_100002510	3300005455	Bacteria	10353
39	Ga0070663_100016385	3300005455	Bacteria	4812
40	Ga0070663_100169801	3300005455	Bacteria	1685
41	Ga0070678_100004753	3300005456	Bacteria	7745
42	Ga0070678_100035587	3300005456	Bacteria	3478
43	Ga0070662_100006341	3300005457	Bacteria	7620
44	Ga0068867_100000498	3300005459	Bacteria	26212
45	Ga0070684_100381226	3300005535	Bacteria	1299
46	Ga0068853_100023230	3300005539	Bacteria	5188
47	Ga0068853_100048970	3300005539	Bacteria	3630
48	Ga0070686_100024473	3300005544	Bacteria	3619
49	Ga0070695_100000790	3300005545	Bacteria	17051
50	Ga0070696_100004334	3300005546	Bacteria	9460
51	Ga0070665_100003091	3300005548	Bacteria	17919
52	Ga0070665_100112618	3300005548	Bacteria	2724
53	Ga0070704_100006780	3300005549	Bacteria	6780
54	Ga0068854_100029966	3300005578	Bacteria	3772
55	Ga0070702_100000125	3300005615	Bacteria	23573
56	Ga0070702_100110443	3300005615	Bacteria	1704
57	Ga0068859_100001001	3300005617	Bacteria	28962
58	Ga0068859_100007468	3300005617	Bacteria	11096
59	Ga0068866_10001456	3300005718	Bacteria	10124
60	Ga0068861_100002824	3300005719	Bacteria	11419
61	Ga0068861_100062555	3300005719	Bacteria	2860
62	Ga0068863_100000442	3300005841	Bacteria	42019
63	Ga0068858_100368047	3300005842	Bacteria	1378
64	Ga0068860_100000150	3300005843	Bacteria	113021
65	Ga0068860_100001829	3300005843	Bacteria	22655
66	Ga0068862_100000078	3300005844	Bacteria	114008
67	Ga0068862_100001560	3300005844	Bacteria	20916
68	Ga0068862_100151100	3300005844	Bacteria	2067
69	Ga0081455_10000174	3300005937	Bacteria	80174
70	Ga0081538_10045927	3300005981	Bacteria	2701
71	Ga0075363_100008338	3300006048	Bacteria	4820
72	Ga0075364_10048309	3300006051	Bacteria	2772
73	Ga0070716_100003562	3300006173	Bacteria	7349
74	Ga0070712_100002837	3300006175	Bacteria	10726
75	Ga0075370_10013233	3300006353	Bacteria	4379
76	Ga0075370_10024352	3300006353	Bacteria	3342
77	Ga0075370_10115980	3300006353	Bacteria	1557
78	Ga0075430_100009449	3300006846	Bacteria	8239
79	Ga0068865_100000861	3300006881	Bacteria	17226
80	Ga0097620_100001001	3300006931	Bacteria	28962
81	Ga0097620_100007468	3300006931	Bacteria	11096
82	Ga0105250_10034351	3300009092	Bacteria	2035
83	Ga0105245_10003150	3300009098	Bacteria	14763
84	Ga0105245_10211642	3300009098	Bacteria	1866
85	Ga0105247_10000074	3300009101	Bacteria	113207
86	Ga0105247_10004325	3300009101	Bacteria	9075
87	Ga0105247_10065650	3300009101	Bacteria	2258
88	Ga0105247_10067835	3300009101	Bacteria	2223
89	Ga0105247_10143749	3300009101	Bacteria	1565
90	Ga0105243_10000320	3300009148	Bacteria	52858
91	Ga0105243_10072923	3300009148	Bacteria	2780
92	Ga0105243_10073842	3300009148	Bacteria	2765
93	Ga0105241_10022687	3300009174	Bacteria	4651
94	Ga0105242_10005330	3300009176	Bacteria	9938
95	Ga0105242_10097186	3300009176	Bacteria	2489
96	Ga0105242_10129050	3300009176	Bacteria	2180
97	Ga0105248_10000077	3300009177	Bacteria	113148
98	Ga0105248_10009252	3300009177	Bacteria	10841
99	Ga0105248_10117387	3300009177	Bacteria	3001
100	Ga0105237_10005213	3300009545	Bacteria	14702
101	Ga0105237_10007916	3300009545	Bacteria	11582
102	Ga0105238_10231055	3300009551	Bacteria	1826
103	Ga0105238_10338985	3300009551	Bacteria	1491
104	Ga0105249_10000111	3300009553	Bacteria	109164
105	Ga0105249_10008768	3300009553	Bacteria	8825
106	Ga0105239_10001194	3300010375	Bacteria	35507
107	Ga0105239_10010848	3300010375	Bacteria	10179
108	Ga0157374_10015666	3300013296	Bacteria	6656
109	Ga0157378_10002099	3300013297	Bacteria	17770
110	Ga0157378_10085429	3300013297	Bacteria	2858
111	Ga0163162_10005613	3300013306	Bacteria	12127
112	Ga0163162_10296118	3300013306	Bacteria	1750
113	Ga0157372_10030688	3300013307	Bacteria	5881
114	Ga0157372_10093920	3300013307	Bacteria	3414
115	Ga0157375_10061321	3300013308	Bacteria	3734
116	Ga0157380_10003260	3300014326	Bacteria	11115
117	Ga0157377_10027920	3300014745	Bacteria	3033
118	Ga0157377_10086256	3300014745	Bacteria	1845
119	Ga0157379_10094083	3300014968	Bacteria	2689
120	Ga0157379_10136089	3300014968	Bacteria	2214
121	Ga0157376_10182379	3300014969	Bacteria	1920
122	Ga0163161_10009859	3300017792	Bacteria	6617
123	Ga0163161_10360163	3300017792	Bacteria	1158
124	Ga0213876_10012327	3300021384	Bacteria	4551
125	Ga0213876_10067332	3300021384	Bacteria	1891
126	Ga0209051_1000034	3300025303	Bacteria	371498
127	Ga0209051_1000457	3300025303	Bacteria	53817
128	Ga0209051_1001136	3300025303	Bacteria	24323
129	Ga0209051_1003245	3300025303	Bacteria	10808
130	Ga0207692_10000746	3300025898	Bacteria	11486
131	Ga0207642_10000580	3300025899	Bacteria	11275
132	Ga0207710_10000086	3300025900	Bacteria	129918
133	Ga0207688_10002851	3300025901	Bacteria	9389
134	Ga0207647_10014278	3300025904	Bacteria	5479
135	Ga0207645_10011175	3300025907	Bacteria	6143
136	Ga0207671_10027955	3300025914	Bacteria	4215
137	Ga0207693_10000698	3300025915	Bacteria	30147
138	Ga0207681_10007105	3300025923	Bacteria	6865
139	Ga0207681_10010987	3300025923	Bacteria	5562
140	Ga0207694_10090985	3300025924	Bacteria	2408
141	Ga0207687_10003241	3300025927	Bacteria	11028
142	Ga0207687_10031530	3300025927	Bacteria	3583
143	Ga0207664_10231723	3300025929	Bacteria	1605
144	Ga0207644_10113892	3300025931	Bacteria	2049
145	Ga0207644_10113996	3300025931	Bacteria	2048
146	Ga0207706_10033064	3300025933	Bacteria	4604
147	Ga0207706_10099463	3300025933	Bacteria	2559
148	Ga0207686_10017914	3300025934	Bacteria	4001
149	Ga0207709_10004939	3300025935	Bacteria	7631
150	Ga0207670_10002103	3300025936	Bacteria	10406
151	Ga0207669_10000575	3300025937	Bacteria	15983
152	Ga0207669_10212904	3300025937	Bacteria	1412
153	Ga0207704_10000279	3300025938	Bacteria	24450
154	Ga0207665_10001844	3300025939	Bacteria	14257
155	Ga0207711_10004305	3300025941	Bacteria	12163
156	Ga0207711_10067931	3300025941	Bacteria	3086
157	Ga0207711_10090735	3300025941	Bacteria	2687
158	Ga0207689_10019727	3300025942	Bacteria	5680
159	Ga0207689_10097930	3300025942	Bacteria	2409
160	Ga0207661_10201711	3300025944	Bacteria	1749
161	Ga0207712_10000359	3300025961	Bacteria	40273
162	Ga0207668_10000917	3300025972	Bacteria	17754
163	Ga0207668_10001144	3300025972	Bacteria	15788
164	Ga0207640_10049575	3300025981	Bacteria	2720
165	Ga0207658_10000314	3300025986	Bacteria	48821
166	Ga0207658_10000774	3300025986	Bacteria	27330
167	Ga0207658_10057394	3300025986	Bacteria	2893
168	Ga0207703_10011878	3300026035	Bacteria	6780
169	Ga0207703_10027328	3300026035	Bacteria	4493
170	Ga0207703_10104845	3300026035	Bacteria	2403
171	Ga0207639_10037551	3300026041	Bacteria	3598
172	Ga0207678_10000441	3300026067	Bacteria	37760
173	Ga0207678_10003805	3300026067	Bacteria	13575
174	Ga0207678_10380187	3300026067	Bacteria	1221
175	Ga0207641_10001022	3300026088	Bacteria	28402
176	Ga0207648_10004702	3300026089	Bacteria	13957
177	Ga0207675_100001052	3300026118	Bacteria	27348
178	Ga0207675_100065890	3300026118	Bacteria	3385
179	Ga0207683_10001365	3300026121	Bacteria	22077
180	Ga0268266_10006489	3300028379	Bacteria	10708
181	Ga0268266_10074257	3300028379	Bacteria	2953
182	Ga0268265_10000012	3300028380	Bacteria	343132
183	Ga0268264_10000104	3300028381	Bacteria	217837
184	Ga0268264_10188821	3300028381	Bacteria	1877
185	Ga0265338_10047765	3300028800	Bacteria	3905
186	Ga0307511_10003945	3300030521	Bacteria	15158
187	Ga0316177_1037610	3300030731	Bacteria	1646
188	Ga0265327_10000001	3300031251	Bacteria	894475
189	Ga0265327_10000274	3300031251	Bacteria	101723
190	Ga0265327_10001643	3300031251	Bacteria	26969
191	Ga0307508_10010804	3300031616	Bacteria	8349
192	Ga0307518_10095209	3300031838	Bacteria	2138
193	Ga0307410_10024772	3300031852	Bacteria	3754
194	Ga0307406_10106523	3300031901	Bacteria	1920
195	Ga0307407_10096980	3300031903	Bacteria	1821
196	Ga0373923_0024722	3300035111	Bacteria	2373
197	Ga0373955_0224494	3300035172	Bacteria	1123
198	Ga0373931_0010172	3300035691	Bacteria	4517
199	Ga0436364_0725327	3300037853	Bacteria	2980
200	Ga0436365_1364630	3300039437	Bacteria	13859
201	Ga0436365_1859525	3300039437	Bacteria	29940
202	Ga0436365_1870027	3300039437	Bacteria	50519
203	Ga0436363_1136138	3300039450	Bacteria	9533
204	Ga0439461_0001259	3300041410	Bacteria	3882
205	Ga0439461_0016616	3300041410	Bacteria	1423
206	Ga0439466_0006239	3300041411	Bacteria	4535
207	Ga0439465_0025750	3300041413	Bacteria	1857
208	Ga0451789_1085169	3300041443	Bacteria	2524
209	Ga0451793_0339146	3300041452	Bacteria	2737
210	Ga0451802_0170405	3300041460	Bacteria	1687
211	Ga0439431_0001139	3300041997	Bacteria	5790
212	Ga0439445_0001532	3300042004	Bacteria	5025
213	Ga0439448_0004237	3300042005	Bacteria	4043
214	Ga0439434_0003652	3300042435	Bacteria	4500
215	Ga0466972_0028722	3300044658	Bacteria	2741
216	Ga0466972_0036784	3300044658	Bacteria	2393
217	Ga0466972_0052615	3300044658	Bacteria	1962
218	Ga0466972_0121589	3300044658	Bacteria	1231
219	Ga0466965_0021902	3300044683	Bacteria	3079
220	Ga0466963_0054839	3300044694	Bacteria	2650
221	Ga0466971_0013359	3300044719	Bacteria	3606
222	Ga0466968_0002598	3300044735	Bacteria	6637
223	Ga0466957_0015987	3300044842	Bacteria	4385
224	Ga0466957_0061655	3300044842	Bacteria	2302
225	Ga0466960_0001982	3300044901	Bacteria	7586
226	Ga0466960_0002449	3300044901	Bacteria	6992
227	Ga0466960_0004306	3300044901	Bacteria	5548
228	Ga0466960_0005485	3300044901	Bacteria	5029
229	Ga0466960_0165037	3300044901	Bacteria	1191
230	Ga0466959_0001402	3300045049	Bacteria	14734
231	Ga0466967_0002358	3300045976	Bacteria	11691
232	Ga0466967_0029875	3300045976	Bacteria	4567
233	Ga0466967_0032950	3300045976	Bacteria	4381
234	Ga0466967_0109852	3300045976	Bacteria	2532
235	Ga0466967_0225876	3300045976	Bacteria	1781
236	Ga0466967_0231600	3300045976	Bacteria	1759
237	Ga0495638_0007060	3300046460	Bacteria	8102
238	Ga0495651_0001547	3300046462	Bacteria	17782
239	Ga0495607_0011189	3300046501	Bacteria	5989
240	Ga0495606_0058453	3300046507	Bacteria	2478
241	Ga0495628_0005893	3300046516	Bacteria	10725
242	Ga0495652_0001194	3300046529	Bacteria	29170
243	Ga0495665_0037169	3300046531	Bacteria	2599
244	Ga0495668_0012237	3300046616	Bacteria	5097
245	Ga0495611_0049832	3300046648	Bacteria	1885
246	Ga0495625_0118238	3300046660	Bacteria	1806
247	Ga0495671_0134937	3300046692	Bacteria	1203
248	Ga0495600_0003385	3300046809	Bacteria	9383
249	Ga0495581_0029410	3300047315	Bacteria	3185
250	Ga0495674_0226826	3300047319	Bacteria	1543
251	Ga0495672_0007635	3300047320	Bacteria	8114
252	Ga0495673_0000867	3300047469	Bacteria	28018
253	Ga0495686_0003063	3300047472	Bacteria	14817
254	Ga0496100_0000169	3300048903	Bacteria	36139
255	Ga0496100_0000369	3300048903	Bacteria	21896
256	Ga0496100_0010907	3300048903	Bacteria	5159
257	Ga0496100_0011599	3300048903	Bacteria	5021
258	Ga0496100_0041150	3300048903	Bacteria	2944
259	Ga0496101_0000037	3300048904	Bacteria	166198
260	Ga0496101_0000059	3300048904	Bacteria	130521
261	Ga0496101_0000155	3300048904	Bacteria	58347
262	Ga0496101_0020571	3300048904	Bacteria	4520
263	Ga0496102_0000083	3300048905	Bacteria	138102
264	Ga0496102_0000621	3300048905	Bacteria	36593
265	Ga0496102_0009847	3300048905	Bacteria	8218
266	Ga0496102_0025541	3300048905	Bacteria	5260
267	Ga0496102_0087495	3300048905	Bacteria	2878
268	Ga0496102_0090559	3300048905	Bacteria	2831
269	Ga0496102_0099538	3300048905	Bacteria	2699
270	Ga0496103_0000060	3300048906	Bacteria	138526
271	Ga0496103_0001930	3300048906	Bacteria	13433
272	Ga0496103_0002331	3300048906	Bacteria	12000
273	Ga0496103_0003166	3300048906	Bacteria	10114
274	Ga0496104_0301767	3300048907	Bacteria	1514
275	Ga0496104_0647216	3300048907	Bacteria	966
276	Ga0496105_0133837	3300048908	Bacteria	2043
277	Ga0496106_0001929	3300048909	Bacteria	15553
278	Ga0496106_0004582	3300048909	Bacteria	10253
279	Ga0496106_0005101	3300048909	Bacteria	9726
280	Ga0496107_0001369	3300048910	Bacteria	15001
281	Ga0496107_0001598	3300048910	Bacteria	14103
282	Ga0496107_0004097	3300048910	Bacteria	9817
283	Ga0496107_0028656	3300048910	Bacteria	3958
284	Ga0496107_0123758	3300048910	Bacteria	1906
285	Ga0496108_0009796	3300048911	Bacteria	7762
286	Ga0496108_0098011	3300048911	Bacteria	2498
287	Ga0496108_0511820	3300048911	Bacteria	1048
288	Ga0496109_0000940	3300048912	Bacteria	24106
289	Ga0496109_0004787	3300048912	Bacteria	11300
290	Ga0496109_0052589	3300048912	Bacteria	3713
291	Ga0496110_0008744	3300048913	Bacteria	8155
292	Ga0496111_0026904	3300048914	Bacteria	4065
293	Ga0496112_0052544	3300048915	Bacteria	3999
294	Ga0496112_0127917	3300048915	Bacteria	2511
295	Ga0496113_0009446	3300048916	Bacteria	6398
296	Ga0496113_0169837	3300048916	Bacteria	1727
297	Ga0496114_0001313	3300048917	Bacteria	18833
298	Ga0496114_0001501	3300048917	Bacteria	17714
299	Ga0496115_0003099	3300048918	Bacteria	11941
300	Ga0496116_0000159	3300048919	Bacteria	138102
301	Ga0496116_0020426	3300048919	Bacteria	5029
302	Ga0496116_0041738	3300048919	Bacteria	3144
303	Ga0496117_0000167	3300048920	Bacteria	138102
304	Ga0496117_0001789	3300048920	Bacteria	29284
305	Ga0496117_0091423	3300048920	Bacteria	1957
306	Ga0496118_0000121	3300048921	Bacteria	138102
307	Ga0496118_0000160	3300048921	Bacteria	120349
308	Ga0496118_0000331	3300048921	Bacteria	80747
309	Ga0496118_0005336	3300048921	Bacteria	14641
310	Ga0496119_0002318	3300048922	Bacteria	20995
311	Ga0496119_0031408	3300048922	Bacteria	3562
312	Ga0496119_0031896	3300048922	Bacteria	3521
313	Ga0496120_0071189	3300048923	Bacteria	1909
314	Ga0496121_0000002	3300048924	Bacteria	1494588
315	Ga0496121_0000690	3300048924	Bacteria	62907
316	Ga0496121_0018860	3300048924	Bacteria	6924
317	Ga0496122_0001116	3300048925	Bacteria	46294
318	Ga0496122_0067843	3300048925	Bacteria	2565
319	Ga0496123_0005418	3300048926	Bacteria	12854
320	Ga0496123_0089104	3300048926	Bacteria	1839
321	Ga0496124_0000002	3300048927	Bacteria	1494588
322	Ga0496124_0086930	3300048927	Bacteria	2557
323	Ga0496125_0000002	3300048928	Bacteria	1480920
324	Ga0496126_0000009	3300048929	Bacteria	750350
325	Ga0496126_0003503	3300048929	Bacteria	19786
326	Ga0496126_0036014	3300048929	Bacteria	4632
327	Ga0496126_0147710	3300048929	Bacteria	2017
328	Ga0496126_0197428	3300048929	Bacteria	1701
329	Ga0496126_0234249	3300048929	Bacteria	1537
330	Ga0501031_0112784	3300049568	Bacteria	1776
331	Ga0501032_0003151	3300049569	Bacteria	12685
332	Ga0501032_0056122	3300049569	Bacteria	2648
333	Ga0501034_0001780	3300049571	Bacteria	27513
334	Ga0501034_0003891	3300049571	Bacteria	16796
335	Ga0501034_0287815	3300049571	Bacteria	1582
336	Ga0501036_0014164	3300049572	Bacteria	6633
337	Ga0501037_0001486	3300049573	Bacteria	17153
338	Ga0501037_0009879	3300049573	Bacteria	7000
339	Ga0501038_0030138	3300049574	Bacteria	4803
340	Ga0501043_0006114	3300049579	Bacteria	9668
341	Ga0501046_0001237	3300049580	Bacteria	24708
342	Ga0501046_0134208	3300049580	Bacteria	1876
343	Ga0501047_0013624	3300049581	Bacteria	7714
344	Ga0501047_0060043	3300049581	Bacteria	3671
345	Ga0501047_0115723	3300049581	Bacteria	2563
346	Ga0501047_0303059	3300049581	Bacteria	1440
347	Ga0501048_0037417	3300049582	Bacteria	3484
348	Ga0501067_0071528	3300049583	Bacteria	1921
349	Ga0501068_0078766	3300049584	Bacteria	2020
350	Ga0501069_0035791	3300049585	Bacteria	2736
351	Ga0501070_0000143	3300049586	Bacteria	65562
352	Ga0501070_0000864	3300049586	Bacteria	27564
353	Ga0501070_0224439	3300049586	Bacteria	1540
354	Ga0501077_0056897	3300049593	Bacteria	2483
355	Ga0501035_0004222	3300049822	Bacteria	13655
356	Ga0501044_0000719	3300049823	Bacteria	39936
357	Ga0501044_0070762	3300049823	Bacteria	3548
358	Ga0501044_0252772	3300049823	Bacteria	1703
359	nmdc:mga03n38_1142_c1	3300050490	Bacteria	7354
360	nmdc:mga00v17_224001_c1	3300050491	Bacteria	1218
361	nmdc:mga00v17_24001_c1	3300050491	Bacteria	3533
362	nmdc:mga00v17_42348_c1	3300050491	Bacteria	2738
363	nmdc:mga00v17_78754_c1	3300050491	Bacteria	2054
364	nmdc:mga07m45_14627_c1	3300050496	Bacteria	4184
365	nmdc:mga07m45_51270_c1	3300050496	Bacteria	2327
366	nmdc:mga0qj67_5055_c1	3300050509	Bacteria	9594
367	nmdc:mga08y16_503530_c1	3300050511	Bacteria	1230
368	Ga0500610_0005072	3300053079	Bacteria	5349
369	Ga0500635_0002003	3300053080	Bacteria	4973
370	Ga0500643_003902	3300053087	Bacteria	6926
371	Ga0500641_0002171	3300053096	Bacteria	6951
372	Ga0500556_0004251	3300053104	Bacteria	4091
373	Ga0500562_001035	3300053108	Bacteria	6812
374	Ga0500616_0021646	3300053153	Bacteria	3601
375	Ga0466962_0003766	3300061719	Bacteria	7245

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300047319	Ga0495674_0226826	Ga0495674_0226826_19_939	276
2	3300031616	Ga0307508_10010804	Ga0307508_100108048	280
3	3300005535	Ga0070684_100381226	Ga0070684_1003812263	283
4	3300048907	Ga0496104_0647216	Ga0496104_0647216_18_947	285
5	3300048910	Ga0496107_0004097	Ga0496107_0004097_8847_9773	285
6	3300048911	Ga0496108_0511820	Ga0496108_0511820_107_1024	285
7	3300048929	Ga0496126_0234249	Ga0496126_0234249_598_1518	285
8	3300050511	nmdc:mga08y16_503530_c1	nmdc:mga08y16_503530_c1_271_1188	285
9	3300050491	nmdc:mga00v17_224001_c1	nmdc:mga00v17_224001_c1_186_1199	301
10	3300048929	Ga0496126_0197428	Ga0496126_0197428_13_984	302
11	3300044658	Ga0466972_0052615	Ga0466972_0052615_846_1931	304
12	iso_pu_bacteria	2917736166	2917744561	307
13	3300003792	Ga0055540_1002512	Ga0055540_10025126	308
14	3300025303	Ga0209051_1001136	Ga0209051_100113618	308
15	3300048907	Ga0496104_0301767	Ga0496104_0301767_105_1154	310
16	3300035172	Ga0373955_0224494	Ga0373955_0224494_77_1087	311
17	3300026067	Ga0207678_10003805	Ga0207678_100038057	313
18	3300048905	Ga0496102_0099538	Ga0496102_0099538_550_1635	315
19	3300048921	Ga0496118_0000160	Ga0496118_0000160_19741_20826	315
20	3300039450	Ga0436363_1136138	Ga0436363_1136138_831_1928	316
21	3300002077	JGI24744J21845_10004851	JGI24744J21845_100048512	318
22	3300002244	JGI24742J22300_10000733	JGI24742J22300_100007336	318
23	3300005328	Ga0070676_10008874	Ga0070676_100088742	318
24	3300005330	Ga0070690_100019899	Ga0070690_1000198994	318
25	3300005334	Ga0068869_100080287	Ga0068869_1000802872	318
26	3300005338	Ga0068868_100001428	Ga0068868_1000014289	318
27	3300005340	Ga0070689_100002503	Ga0070689_1000025036	318
28	3300005341	Ga0070691_10006777	Ga0070691_100067776	318
29	3300005347	Ga0070668_100000668	Ga0070668_1000006688	318
30	3300005353	Ga0070669_100004338	Ga0070669_10000433811	318
31	3300005356	Ga0070674_100000670	Ga0070674_1000006705	318
32	3300005365	Ga0070688_100039632	Ga0070688_1000396322	318
33	3300005367	Ga0070667_100004829	Ga0070667_1000048297	318
34	3300005434	Ga0070709_10019651	Ga0070709_100196515	318
35	3300005437	Ga0070710_10001043	Ga0070710_100010437	318
36	3300005438	Ga0070701_10005140	Ga0070701_100051406	318
37	3300005439	Ga0070711_100000314	Ga0070711_10000031418	318
38	3300005440	Ga0070705_100028014	Ga0070705_1000280143	318
39	3300005441	Ga0070700_100016736	Ga0070700_1000167362	318
40	3300005444	Ga0070694_100005396	Ga0070694_1000053964	318
41	3300005455	Ga0070663_100016385	Ga0070663_1000163856	318
42	3300005456	Ga0070678_100004753	Ga0070678_1000047533	318
43	3300005457	Ga0070662_100006341	Ga0070662_1000063417	318
44	3300005459	Ga0068867_100000498	Ga0068867_10000049820	318
45	3300005544	Ga0070686_100024473	Ga0070686_1000244732	318
46	3300005545	Ga0070695_100000790	Ga0070695_10000079015	318
47	3300005546	Ga0070696_100004334	Ga0070696_1000043347	318
48	3300005549	Ga0070704_100006780	Ga0070704_1000067807	318
49	3300005578	Ga0068854_100029966	Ga0068854_1000299665	318
50	3300005615	Ga0070702_100000125	Ga0070702_10000012518	318
51	3300005617	Ga0068859_100007468	Ga0068859_1000074683	318
52	3300005718	Ga0068866_10001456	Ga0068866_100014567	318
53	3300005719	Ga0068861_100002824	Ga0068861_1000028247	318
54	3300005843	Ga0068860_100001829	Ga0068860_10000182911	318
55	3300005844	Ga0068862_100001560	Ga0068862_1000015606	318
56	3300006173	Ga0070716_100003562	Ga0070716_1000035623	318
57	3300006175	Ga0070712_100002837	Ga0070712_1000028377	318
58	3300006881	Ga0068865_100000861	Ga0068865_1000008616	318
59	3300006931	Ga0097620_100007468	Ga0097620_1000074683	318
60	3300009098	Ga0105245_10003150	Ga0105245_100031507	318
61	3300009101	Ga0105247_10004325	Ga0105247_100043257	318
62	3300009148	Ga0105243_10072923	Ga0105243_100729233	318
63	3300009174	Ga0105241_10022687	Ga0105241_100226874	318
64	3300009176	Ga0105242_10005330	Ga0105242_1000533011	318
65	3300009177	Ga0105248_10009252	Ga0105248_100092527	318
66	3300009551	Ga0105238_10231055	Ga0105238_102310551	318
67	3300009553	Ga0105249_10008768	Ga0105249_100087687	318
68	3300010375	Ga0105239_10010848	Ga0105239_100108482	318
69	3300013297	Ga0157378_10002099	Ga0157378_1000209910	318
70	3300013306	Ga0163162_10005613	Ga0163162_100056138	318
71	3300013307	Ga0157372_10093920	Ga0157372_100939202	318
72	3300014326	Ga0157380_10003260	Ga0157380_100032604	318
73	3300014745	Ga0157377_10086256	Ga0157377_100862562	318
74	3300014968	Ga0157379_10136089	Ga0157379_101360892	318
75	3300017792	Ga0163161_10009859	Ga0163161_100098597	318
76	3300025899	Ga0207642_10000580	Ga0207642_100005807	318
77	3300025901	Ga0207688_10002851	Ga0207688_100028514	318
78	3300025907	Ga0207645_10011175	Ga0207645_100111753	318
79	3300025915	Ga0207693_10000698	Ga0207693_1000069811	318
80	3300025923	Ga0207681_10010987	Ga0207681_100109874	318
81	3300025927	Ga0207687_10003241	Ga0207687_100032417	318
82	3300025933	Ga0207706_10033064	Ga0207706_100330644	318
83	3300025934	Ga0207686_10017914	Ga0207686_100179143	318
84	3300025936	Ga0207670_10002103	Ga0207670_100021036	318
85	3300025937	Ga0207669_10000575	Ga0207669_100005759	318
86	3300025938	Ga0207704_10000279	Ga0207704_1000027910	318
87	3300025939	Ga0207665_10001844	Ga0207665_100018446	318
88	3300025941	Ga0207711_10067931	Ga0207711_100679312	318
89	3300025942	Ga0207689_10097930	Ga0207689_100979302	318
90	3300025972	Ga0207668_10000917	Ga0207668_100009174	318
91	3300025981	Ga0207640_10049575	Ga0207640_100495752	318
92	3300026035	Ga0207703_10011878	Ga0207703_100118787	318
93	3300026089	Ga0207648_10004702	Ga0207648_100047027	318
94	3300026118	Ga0207675_100001052	Ga0207675_10000105210	318
95	3300026121	Ga0207683_10001365	Ga0207683_1000136511	318
96	3300035691	Ga0373931_0010172	Ga0373931_0010172_90_1160	318
97	3300048903	Ga0496100_0011599	Ga0496100_0011599_3401_4471	318
98	3300048905	Ga0496102_0009847	Ga0496102_0009847_2966_4036	318
99	3300048906	Ga0496103_0002331	Ga0496103_0002331_5531_6601	318
100	3300048909	Ga0496106_0001929	Ga0496106_0001929_12726_13796	318
101	3300048910	Ga0496107_0001369	Ga0496107_0001369_5580_6650	318
102	3300048917	Ga0496114_0001501	Ga0496114_0001501_5358_6428	318
103	3300026067	Ga0207678_10380187	Ga0207678_103801871	321
104	3300044694	Ga0466963_0054839	Ga0466963_0054839_1284_2363	322
105	3300044842	Ga0466957_0015987	Ga0466957_0015987_790_1869	322
106	3300044901	Ga0466960_0005485	Ga0466960_0005485_1457_2536	322
107	3300045976	Ga0466967_0002358	Ga0466967_0002358_2441_3520	322
108	3300045976	Ga0466967_0032950	Ga0466967_0032950_983_2056	322
109	3300005937	Ga0081455_10000174	Ga0081455_1000017476	323
110	3300009098	Ga0105245_10211642	Ga0105245_102116422	323
111	3300009101	Ga0105247_10067835	Ga0105247_100678353	326
112	3300009148	Ga0105243_10073842	Ga0105243_100738423	326
113	3300013296	Ga0157374_10015666	Ga0157374_100156664	326
114	3300013297	Ga0157378_10085429	Ga0157378_100854293	326
115	3300014745	Ga0157377_10027920	Ga0157377_100279203	326
116	3300046531	Ga0495665_0037169	Ga0495665_0037169_1512_2552	326
117	3300047315	Ga0495581_0029410	Ga0495581_0029410_1013_2053	326
118	3300048908	Ga0496105_0133837	Ga0496105_0133837_919_1959	326
119	3300048911	Ga0496108_0009796	Ga0496108_0009796_1850_2890	326
120	3300048912	Ga0496109_0004787	Ga0496109_0004787_8704_9744	326
121	3300048915	Ga0496112_0127917	Ga0496112_0127917_866_1906	326
122	3300048916	Ga0496113_0169837	Ga0496113_0169837_547_1587	326
123	iso_pu_bacteria	2791354901	2791910504	326
124	3300044901	Ga0466960_0165037	Ga0466960_0165037_97_1158	327
125	3300046462	Ga0495651_0001547	Ga0495651_0001547_5464_6540	327
126	3300046516	Ga0495628_0005893	Ga0495628_0005893_2509_3585	327
127	3300046529	Ga0495652_0001194	Ga0495652_0001194_16061_17137	327
128	3300046809	Ga0495600_0003385	Ga0495600_0003385_708_1784	327
129	3300048910	Ga0496107_0123758	Ga0496107_0123758_272_1318	328
130	iso_pu_bacteria	2899359706	2899367091	328
131	3300005437	Ga0070710_10000214	Ga0070710_100002149	329
132	3300025898	Ga0207692_10000746	Ga0207692_1000074610	329
133	3300030731	Ga0316177_1037610	Ga0316177_10376101	329
134	3300044658	Ga0466972_0036784	Ga0466972_0036784_627_1676	329
135	3300044901	Ga0466960_0001982	Ga0466960_0001982_2624_3673	329
136	iso_pu_bacteria	2551306166	2552105371	329
137	iso_pu_bacteria	2565956761	2566996053	329
138	iso_pu_bacteria	2643221687	2644491393	329
139	iso_pu_bacteria	2643221715	2644639702	329
140	iso_pu_bacteria	2738541264	2738669231	329
141	iso_pu_bacteria	2738541308	2738893318	329
142	iso_pu_bacteria	2738541356	2739148327	329
143	iso_pu_bacteria	2744054611	2744953627	329
144	iso_pu_bacteria	2842134933	2842136525	329
145	iso_pu_bacteria	2891395885	2891398391	329
146	iso_pu_bacteria	2902792274	2902795691	329
147	iso_pu_bacteria	2902810491	2902814356	329
148	iso_pu_bacteria	2902837492	2902842566	329
149	iso_pu_bacteria	2904535858	2904540688	329
150	iso_pu_bacteria	2919713450	2919717978	329
151	iso_pu_bacteria	2922554459	2922554777	329
152	iso_pu_bacteria	2939582691	2939584087	329
153	iso_pu_bacteria	3002998708	3003008786	329
154	iso_pu_bacteria	8055172936	8055177785	329
155	3300005455	Ga0070663_100002510	Ga0070663_1000025108	330
156	3300009176	Ga0105242_10097186	Ga0105242_100971863	330
157	3300013307	Ga0157372_10030688	Ga0157372_100306882	330
158	3300014969	Ga0157376_10182379	Ga0157376_101823792	330
159	3300026067	Ga0207678_10000441	Ga0207678_100004414	330
160	3300044901	Ga0466960_0002449	Ga0466960_0002449_3590_4651	330
161	3300049581	Ga0501047_0303059	Ga0501047_0303059_65_1123	330
162	3300049823	Ga0501044_0070762	Ga0501044_0070762_2476_3534	330
163	iso_pu_bacteria	2643221692	2644515685	330
164	iso_pu_bacteria	2643221962	2645724276	330
165	iso_pu_bacteria	2738543005	2739204712	330
166	iso_pu_bacteria	2738543011	2739240480	330
167	iso_pu_bacteria	2889300758	2889303754	330
168	iso_pu_bacteria	2928142448	2928147372	330
169	iso_pu_bacteria	2939743619	2939747539	330
170	3300005539	Ga0068853_100023230	Ga0068853_1000232305	331
171	3300030521	Ga0307511_10003945	Ga0307511_1000394514	331
172	3300031838	Ga0307518_10095209	Ga0307518_100952092	331
173	3300035111	Ga0373923_0024722	Ga0373923_0024722_1281_2351	331
174	iso_pu_bacteria	2643221961	2645721777	331
175	iso_pu_bacteria	2932398195	2932401669	331
176	3300005329	Ga0070683_100072149	Ga0070683_1000721491	332
177	3300006051	Ga0075364_10048309	Ga0075364_100483092	332
178	3300021384	Ga0213876_10012327	Ga0213876_100123273	332
179	3300021384	Ga0213876_10067332	Ga0213876_100673322	332
180	3300025944	Ga0207661_10201711	Ga0207661_102017111	332
181	3300039437	Ga0436365_1364630	Ga0436365_1364630_4263_5330	332
182	3300039437	Ga0436365_1859525	Ga0436365_1859525_19046_20116	332
183	3300039437	Ga0436365_1870027	Ga0436365_1870027_47981_49051	332
184	3300044658	Ga0466972_0121589	Ga0466972_0121589_135_1214	332
185	3300044719	Ga0466971_0013359	Ga0466971_0013359_339_1409	332
186	3300048929	Ga0496126_0036014	Ga0496126_0036014_109_1176	332
187	3300049568	Ga0501031_0112784	Ga0501031_0112784_597_1670	332
188	3300049569	Ga0501032_0056122	Ga0501032_0056122_597_1670	332
189	3300049571	Ga0501034_0003891	Ga0501034_0003891_9603_10676	332
190	3300049573	Ga0501037_0009879	Ga0501037_0009879_730_1803	332
191	3300049580	Ga0501046_0001237	Ga0501046_0001237_15155_16228	332
192	3300049580	Ga0501046_0134208	Ga0501046_0134208_605_1672	332
193	3300049581	Ga0501047_0013624	Ga0501047_0013624_3275_4348	332
194	3300049582	Ga0501048_0037417	Ga0501048_0037417_1294_2367	332
195	3300049585	Ga0501069_0035791	Ga0501069_0035791_146_1219	332
196	3300049586	Ga0501070_0000864	Ga0501070_0000864_11210_12283	332
197	3300049822	Ga0501035_0004222	Ga0501035_0004222_4536_5609	332
198	3300049823	Ga0501044_0000719	Ga0501044_0000719_38124_39197	332
199	3300049823	Ga0501044_0252772	Ga0501044_0252772_235_1296	332
200	3300050496	nmdc:mga07m45_51270_c1	nmdc:mga07m45_51270_c1_328_1395	332
201	3300061719	Ga0466962_0003766	Ga0466962_0003766_2371_3441	332
202	3300003792	Ga0055540_1000129	Ga0055540_100012911	333
203	3300003792	Ga0055540_1001998	Ga0055540_10019983	333
204	3300003792	Ga0055540_1017508	Ga0055540_10175082	333
205	3300005347	Ga0070668_100003548	Ga0070668_1000035483	333
206	3300005353	Ga0070669_100002437	Ga0070669_1000024372	333
207	3300005364	Ga0070673_100265357	Ga0070673_1002653572	333
208	3300005367	Ga0070667_100000220	Ga0070667_10000022027	333
209	3300005367	Ga0070667_100000519	Ga0070667_10000051916	333
210	3300005367	Ga0070667_100007327	Ga0070667_1000073272	333
211	3300005367	Ga0070667_100318743	Ga0070667_1003187431	333
212	3300005539	Ga0068853_100048970	Ga0068853_1000489703	333
213	3300005548	Ga0070665_100003091	Ga0070665_10000309115	333
214	3300005617	Ga0068859_100001001	Ga0068859_1000010013	333
215	3300005719	Ga0068861_100062555	Ga0068861_1000625552	333
216	3300005841	Ga0068863_100000442	Ga0068863_10000044223	333
217	3300005842	Ga0068858_100368047	Ga0068858_1003680472	333
218	3300005843	Ga0068860_100000150	Ga0068860_10000015028	333
219	3300005844	Ga0068862_100000078	Ga0068862_10000007892	333
220	3300005844	Ga0068862_100151100	Ga0068862_1001511003	333
221	3300005981	Ga0081538_10045927	Ga0081538_100459272	333
222	3300006048	Ga0075363_100008338	Ga0075363_1000083384	333
223	3300006353	Ga0075370_10013233	Ga0075370_100132334	333
224	3300006353	Ga0075370_10024352	Ga0075370_100243522	333
225	3300006353	Ga0075370_10115980	Ga0075370_101159802	333
226	3300006846	Ga0075430_100009449	Ga0075430_1000094493	333
227	3300006931	Ga0097620_100001001	Ga0097620_1000010013	333
228	3300009092	Ga0105250_10034351	Ga0105250_100343512	333
229	3300009101	Ga0105247_10000074	Ga0105247_1000007488	333
230	3300009101	Ga0105247_10065650	Ga0105247_100656502	333
231	3300009177	Ga0105248_10000077	Ga0105248_1000007727	333
232	3300009545	Ga0105237_10005213	Ga0105237_100052139	333
233	3300009545	Ga0105237_10007916	Ga0105237_1000791610	333
234	3300009551	Ga0105238_10338985	Ga0105238_103389852	333
235	3300009553	Ga0105249_10000111	Ga0105249_1000011127	333
236	3300010375	Ga0105239_10001194	Ga0105239_100011944	333
237	3300013306	Ga0163162_10296118	Ga0163162_102961182	333
238	3300014968	Ga0157379_10094083	Ga0157379_100940832	333
239	3300017792	Ga0163161_10360163	Ga0163161_103601631	333
240	3300025303	Ga0209051_1000034	Ga0209051_100003412	333
241	3300025303	Ga0209051_1000457	Ga0209051_100045745	333
242	3300025303	Ga0209051_1003245	Ga0209051_10032453	333
243	3300025900	Ga0207710_10000086	Ga0207710_1000008689	333
244	3300025914	Ga0207671_10027955	Ga0207671_100279555	333
245	3300025923	Ga0207681_10007105	Ga0207681_100071057	333
246	3300025924	Ga0207694_10090985	Ga0207694_100909853	333
247	3300025929	Ga0207664_10231723	Ga0207664_102317232	333
248	3300025931	Ga0207644_10113892	Ga0207644_101138922	333
249	3300025941	Ga0207711_10004305	Ga0207711_100043055	333
250	3300025961	Ga0207712_10000359	Ga0207712_1000035916	333
251	3300025972	Ga0207668_10001144	Ga0207668_1000114411	333
252	3300025986	Ga0207658_10000314	Ga0207658_1000031438	333
253	3300025986	Ga0207658_10000774	Ga0207658_1000077413	333
254	3300025986	Ga0207658_10057394	Ga0207658_100573944	333
255	3300026035	Ga0207703_10027328	Ga0207703_100273282	333
256	3300026041	Ga0207639_10037551	Ga0207639_100375512	333
257	3300026088	Ga0207641_10001022	Ga0207641_100010227	333
258	3300028379	Ga0268266_10006489	Ga0268266_100064897	333
259	3300028379	Ga0268266_10074257	Ga0268266_100742572	333
260	3300028380	Ga0268265_10000012	Ga0268265_1000001227	333
261	3300028381	Ga0268264_10000104	Ga0268264_10000104190	333
262	3300028381	Ga0268264_10188821	Ga0268264_101888213	333
263	3300031251	Ga0265327_10000001	Ga0265327_10000001700	333
264	3300031251	Ga0265327_10001643	Ga0265327_1000164315	333
265	3300031852	Ga0307410_10024772	Ga0307410_100247724	333
266	3300031901	Ga0307406_10106523	Ga0307406_101065232	333
267	3300031903	Ga0307407_10096980	Ga0307407_100969802	333
268	3300041410	Ga0439461_0001259	Ga0439461_0001259_2758_3831	333
269	3300041411	Ga0439466_0006239	Ga0439466_0006239_1462_2535	333
270	3300041413	Ga0439465_0025750	Ga0439465_0025750_433_1506	333
271	3300041443	Ga0451789_1085169	Ga0451789_1085169_559_1620	333
272	3300041452	Ga0451793_0339146	Ga0451793_0339146_35_1099	333
273	3300041460	Ga0451802_0170405	Ga0451802_0170405_350_1414	333
274	3300041997	Ga0439431_0001139	Ga0439431_0001139_3093_4166	333
275	3300042004	Ga0439445_0001532	Ga0439445_0001532_1119_2192	333
276	3300042005	Ga0439448_0004237	Ga0439448_0004237_608_1678	333
277	3300042435	Ga0439434_0003652	Ga0439434_0003652_1798_2871	333
278	3300044658	Ga0466972_0028722	Ga0466972_0028722_982_2055	333
279	3300044683	Ga0466965_0021902	Ga0466965_0021902_581_1654	333
280	3300044735	Ga0466968_0002598	Ga0466968_0002598_4626_5699	333
281	3300044842	Ga0466957_0061655	Ga0466957_0061655_1219_2292	333
282	3300044901	Ga0466960_0004306	Ga0466960_0004306_3508_4581	333
283	3300045049	Ga0466959_0001402	Ga0466959_0001402_1035_2108	333
284	3300045976	Ga0466967_0029875	Ga0466967_0029875_1456_2529	333
285	3300046460	Ga0495638_0007060	Ga0495638_0007060_2133_3203	333
286	3300046507	Ga0495606_0058453	Ga0495606_0058453_1102_2166	333
287	3300046616	Ga0495668_0012237	Ga0495668_0012237_186_1247	333
288	3300046648	Ga0495611_0049832	Ga0495611_0049832_197_1261	333
289	3300046660	Ga0495625_0118238	Ga0495625_0118238_663_1733	333
290	3300046692	Ga0495671_0134937	Ga0495671_0134937_86_1150	333
291	3300047320	Ga0495672_0007635	Ga0495672_0007635_4773_5837	333
292	3300047469	Ga0495673_0000867	Ga0495673_0000867_8595_9659	333
293	3300047472	Ga0495686_0003063	Ga0495686_0003063_7699_8763	333
294	3300048903	Ga0496100_0000169	Ga0496100_0000169_32654_33724	333
295	3300048903	Ga0496100_0010907	Ga0496100_0010907_3101_4171	333
296	3300048903	Ga0496100_0041150	Ga0496100_0041150_1033_2106	333
297	3300048904	Ga0496101_0000037	Ga0496101_0000037_32841_33905	333
298	3300048904	Ga0496101_0000059	Ga0496101_0000059_61754_62824	333
299	3300048904	Ga0496101_0020571	Ga0496101_0020571_691_1764	333
300	3300048905	Ga0496102_0000083	Ga0496102_0000083_51380_52444	333
301	3300048905	Ga0496102_0000621	Ga0496102_0000621_23799_24869	333
302	3300048905	Ga0496102_0087495	Ga0496102_0087495_408_1478	333
303	3300048905	Ga0496102_0090559	Ga0496102_0090559_864_1937	333
304	3300048906	Ga0496103_0000060	Ga0496103_0000060_51804_52868	333
305	3300048906	Ga0496103_0001930	Ga0496103_0001930_10046_11116	333
306	3300048906	Ga0496103_0003166	Ga0496103_0003166_3674_4744	333
307	3300048909	Ga0496106_0004582	Ga0496106_0004582_7318_8388	333
308	3300048909	Ga0496106_0005101	Ga0496106_0005101_8419_9483	333
309	3300048910	Ga0496107_0001598	Ga0496107_0001598_12784_13854	333
310	3300048910	Ga0496107_0028656	Ga0496107_0028656_2286_3350	333
311	3300048911	Ga0496108_0098011	Ga0496108_0098011_342_1403	333
312	3300048912	Ga0496109_0000940	Ga0496109_0000940_20848_21918	333
313	3300048913	Ga0496110_0008744	Ga0496110_0008744_2152_3222	333
314	3300048914	Ga0496111_0026904	Ga0496111_0026904_2650_3720	333
315	3300048915	Ga0496112_0052544	Ga0496112_0052544_133_1206	333
316	3300048916	Ga0496113_0009446	Ga0496113_0009446_3300_4373	333
317	3300048917	Ga0496114_0001313	Ga0496114_0001313_15481_16551	333
318	3300048919	Ga0496116_0000159	Ga0496116_0000159_85659_86723	333
319	3300048919	Ga0496116_0020426	Ga0496116_0020426_657_1727	333
320	3300048919	Ga0496116_0041738	Ga0496116_0041738_613_1683	333
321	3300048920	Ga0496117_0000167	Ga0496117_0000167_51380_52444	333
322	3300048920	Ga0496117_0001789	Ga0496117_0001789_9012_10082	333
323	3300048920	Ga0496117_0091423	Ga0496117_0091423_536_1606	333
324	3300048921	Ga0496118_0000121	Ga0496118_0000121_85659_86723	333
325	3300048921	Ga0496118_0000331	Ga0496118_0000331_950_2020	333
326	3300048921	Ga0496118_0005336	Ga0496118_0005336_11811_12881	333
327	3300048922	Ga0496119_0002318	Ga0496119_0002318_1931_3001	333
328	3300048922	Ga0496119_0031408	Ga0496119_0031408_252_1316	333
329	3300048922	Ga0496119_0031896	Ga0496119_0031896_1847_2917	333
330	3300048923	Ga0496120_0071189	Ga0496120_0071189_771_1835	333
331	3300048924	Ga0496121_0000002	Ga0496121_0000002_324011_325081	333
332	3300048924	Ga0496121_0000690	Ga0496121_0000690_10467_11531	333
333	3300048924	Ga0496121_0018860	Ga0496121_0018860_3368_4438	333
334	3300048925	Ga0496122_0001116	Ga0496122_0001116_43032_44102	333
335	3300048925	Ga0496122_0067843	Ga0496122_0067843_879_1952	333
336	3300048926	Ga0496123_0005418	Ga0496123_0005418_3173_4246	333
337	3300048926	Ga0496123_0089104	Ga0496123_0089104_173_1243	333
338	3300048927	Ga0496124_0000002	Ga0496124_0000002_1169508_1170578	333
339	3300048927	Ga0496124_0086930	Ga0496124_0086930_1358_2428	333
340	3300048928	Ga0496125_0000002	Ga0496125_0000002_324011_325081	333
341	3300048929	Ga0496126_0000009	Ga0496126_0000009_425270_426340	333
342	3300048929	Ga0496126_0003503	Ga0496126_0003503_12744_13808	333
343	3300048929	Ga0496126_0147710	Ga0496126_0147710_129_1202	333
344	3300049569	Ga0501032_0003151	Ga0501032_0003151_5608_6678	333
345	3300049571	Ga0501034_0001780	Ga0501034_0001780_25974_27044	333
346	3300049572	Ga0501036_0014164	Ga0501036_0014164_915_1985	333
347	3300049573	Ga0501037_0001486	Ga0501037_0001486_8877_9947	333
348	3300049574	Ga0501038_0030138	Ga0501038_0030138_1575_2645	333
349	3300049579	Ga0501043_0006114	Ga0501043_0006114_3809_4879	333
350	3300049581	Ga0501047_0060043	Ga0501047_0060043_1065_2141	333
351	3300049583	Ga0501067_0071528	Ga0501067_0071528_328_1398	333
352	3300049584	Ga0501068_0078766	Ga0501068_0078766_285_1355	333
353	3300049586	Ga0501070_0000143	Ga0501070_0000143_3988_5058	333
354	3300049593	Ga0501077_0056897	Ga0501077_0056897_222_1292	333
355	3300050490	nmdc:mga03n38_1142_c1	nmdc:mga03n38_1142_c1_4215_5285	333
356	3300050491	nmdc:mga00v17_24001_c1	nmdc:mga00v17_24001_c1_306_1406	333
357	3300050491	nmdc:mga00v17_42348_c1	nmdc:mga00v17_42348_c1_1445_2515	333
358	3300050491	nmdc:mga00v17_78754_c1	nmdc:mga00v17_78754_c1_510_1583	333
359	3300050496	nmdc:mga07m45_14627_c1	nmdc:mga07m45_14627_c1_1175_2236	333
360	3300050509	nmdc:mga0qj67_5055_c1	nmdc:mga0qj67_5055_c1_6050_7111	333
361	3300053079	Ga0500610_0005072	Ga0500610_0005072_691_1761	333
362	3300053080	Ga0500635_0002003	Ga0500635_0002003_2081_3154	333
363	3300053087	Ga0500643_003902	Ga0500643_003902_1353_2417	333
364	3300053104	Ga0500556_0004251	Ga0500556_0004251_1325_2395	333
365	3300053108	Ga0500562_001035	Ga0500562_001035_1129_2199	333
366	3300053153	Ga0500616_0021646	Ga0500616_0021646_479_1549	333
367	iso_pu_bacteria	2523231044	2523384914	333
368	3300009148	Ga0105243_10000320	Ga0105243_1000032046	334
369	3300025935	Ga0207709_10004939	Ga0207709_100049394	334
370	3300028800	Ga0265338_10047765	Ga0265338_100477654	334
371	3300045976	Ga0466967_0231600	Ga0466967_0231600_454_1530	334
372	3300049571	Ga0501034_0287815	Ga0501034_0287815_381_1454	334
373	3300049581	Ga0501047_0115723	Ga0501047_0115723_918_1991	334
374	3300049586	Ga0501070_0224439	Ga0501070_0224439_291_1364	334
375	3300005455	Ga0070663_100169801	Ga0070663_1001698012	335
376	3300009101	Ga0105247_10143749	Ga0105247_101437492	335
377	3300025937	Ga0207669_10212904	Ga0207669_102129042	335
378	3300031251	Ga0265327_10000274	Ga0265327_1000027449	335
379	3300037853	Ga0436364_0725327	Ga0436364_0725327_1137_2228	335
380	3300041410	Ga0439461_0016616	Ga0439461_0016616_102_1181	335
381	3300045976	Ga0466967_0109852	Ga0466967_0109852_730_1821	335
382	3300045976	Ga0466967_0225876	Ga0466967_0225876_70_1152	335
383	3300046501	Ga0495607_0011189	Ga0495607_0011189_2814_3911	335
384	3300053096	Ga0500641_0002171	Ga0500641_0002171_1395_2462	335
385	iso_pu_bacteria	2751185725	2753038537	335
386	iso_pu_bacteria	2751185792	2753326998	335
387	3300001977	JGI24746J21847_1000601	JGI24746J21847_10006014	336
388	3300005337	Ga0070682_100008483	Ga0070682_1000084837	336
389	3300005355	Ga0070671_100177876	Ga0070671_1001778762	336
390	3300005365	Ga0070688_100064896	Ga0070688_1000648961	336
391	3300005456	Ga0070678_100035587	Ga0070678_1000355875	336
392	3300005548	Ga0070665_100112618	Ga0070665_1001126182	336
393	3300005615	Ga0070702_100110443	Ga0070702_1001104432	336
394	3300009176	Ga0105242_10129050	Ga0105242_101290502	336
395	3300009177	Ga0105248_10117387	Ga0105248_101173872	336
396	3300013308	Ga0157375_10061321	Ga0157375_100613212	336
397	3300025904	Ga0207647_10014278	Ga0207647_100142787	336
398	3300025927	Ga0207687_10031530	Ga0207687_100315303	336
399	3300025931	Ga0207644_10113996	Ga0207644_101139961	336
400	3300025933	Ga0207706_10099463	Ga0207706_100994633	336
401	3300025941	Ga0207711_10090735	Ga0207711_100907352	336
402	3300025942	Ga0207689_10019727	Ga0207689_100197276	336
403	3300026035	Ga0207703_10104845	Ga0207703_101048453	336
404	3300026118	Ga0207675_100065890	Ga0207675_1000658904	336
405	3300048903	Ga0496100_0000369	Ga0496100_0000369_7625_8734	336
406	3300048904	Ga0496101_0000155	Ga0496101_0000155_15070_16179	336
407	3300048905	Ga0496102_0025541	Ga0496102_0025541_3146_4228	336
408	3300048912	Ga0496109_0052589	Ga0496109_0052589_180_1262	336
409	3300048918	Ga0496115_0003099	Ga0496115_0003099_2894_4003	336

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03060

NMO

Nitronate monooxygenase

18

356

0.97 PF00478

IMPDH

IMP dehydrogenase / GMP reductase domain

9

229

0.87 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
5gvj-assembly1.cif.gz_A-2	structure of fabk (m276a) mutant from thermotoga maritima	0.8358	7	335
5gvj-assembly1.cif.gz_A-2	structure of fabk (m276a) mutant from thermotoga maritima	0.8304	7	335
5gvj-assembly2.cif.gz_B-3	structure of fabk (m276a) mutant from thermotoga maritima	0.8294	7	335
5gvj-assembly2.cif.gz_B-3	structure of fabk (m276a) mutant from thermotoga maritima	0.8267	7	335
4utu-assembly1.cif.gz_B	structural and biochemical characterization of the n- acetylmannosamine-6-phosphate 2-epimerase from clostridium perfringens	0.8204	65	177

ID	Description	Score	Start	End	Superfamily
af_P71847_8_353_3.20.20.70	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.8679	12	333	3.20.20.70
af_Q4DTU5_2_265_1.10.560.10	Mainly Alpha;Orthogonal Bundle;GROEL; domain 1;GroEL-like equatorial domain	0.8659	69	101	1.10.560.10
3l12B00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphatidylinositol (PI) phosphodiesterase	0.8372	67	122	3.20.20.190
5gvjA00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.8358	7	335	3.20.20.70
af_P71847_8_353_3.20.20.70	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I	0.8322	12	333	3.20.20.70

ID	Description	Score	Start	End	GO Terms
AF-A0A6I3UVS4-F1-model_v4	Enoyl-[acyl-carrier-protein] reductase FabK	0.9463	89	174	GO:0018580
AF-A0A6A8LXQ2-F1-model_v4	DUF561 domain-containing protein	0.9405	96	201	GO:0018580
AF-A0A7K0MZ09-F1-model_v4	Nitronate monooxygenase	0.9143	7	197	GO:0018580
AF-A0A6B3G9C6-F1-model_v4	Nitronate monooxygenase	0.9104	7	173	GO:0018580
AF-A0A6I3UVS4-F1-model_v4	Enoyl-[acyl-carrier-protein] reductase FabK	0.906	89	174	GO:0018580

Feature Viewer

pLDDT	pTM	Quality
78.39	0.78	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F436994

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF03060

NMO

Nitronate monooxygenase

18

356

0.97

PF00478

IMPDH

IMP dehydrogenase / GMP reductase domain

9

229

0.87

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map