F436973

General Info

Members Datasets Scaffolds Average Seq Length
409 232 818 167

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10724301|Ga0105240_107243012
Length 190
Sequence MAPRSAKLKDHIPTSMMHGAQVVAIYPGSFDPITNGHLDVIERGSKLFDRLIVSILHNETKAPLFSIQERAEMLSESVRPFGNVEIDSFQGLLADYALSKNARVILRGIRAVSDYEYELQMALMNRRLQPQVETVFLLAGEAFSFISSRLVKEVISLGGNITGFVPPLVEQRLRERLRVSEAIHNEVLTT

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
138 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
139 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
140 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
141 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
142 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
143 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
151 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
159 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
165 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
166 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
167 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
168 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
169 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
170 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
171 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
172 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
173 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
174 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
175 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
176 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
177 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
178 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
179 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
180 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
181 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
182 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
183 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
184 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
185 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
186 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
187 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
188 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
189 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
190 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
191 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
192 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
193 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
194 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
195 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
196 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
197 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
198 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
199 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
200 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
201 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
202 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
203 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
204 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
205 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
206 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
211 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
212 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
213 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
214 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
215 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
216 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
217 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
218 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
219 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
220 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
221 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
222 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
223 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
224 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
225 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
226 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
227 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
228 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
229 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
230 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
231 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
232 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.22
Rhizosphere 97.8
Stem 0
Stem Tuber 0
Unclassified 14.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10724301 3300009093 Bacteria 1084
2 Ga0065704_10082005 3300005289 Bacteria 3657
3 Ga0065704_10128345 3300005289 Bacteria 1663
4 Ga0065712_10187827 3300005290 Bacteria 1162
5 Ga0065715_10006982 3300005293 Bacteria 3846
6 Ga0065707_10241114 3300005295 Bacteria 1155
7 Ga0070676_10073058 3300005328 Bacteria 2063
8 Ga0070676_10174161 3300005328 Unclassified 1394
9 Ga0070676_10494406 3300005328 Unclassified 867
10 Ga0070690_100013676 3300005330 Bacteria 4802
11 Ga0070670_100006009 3300005331 Bacteria 10265
12 Ga0070670_100081529 3300005331 Unclassified 2780
13 Ga0070670_100257945 3300005331 Unclassified 1519
14 Ga0070677_10029170 3300005333 Bacteria 2090
15 Ga0068869_100645197 3300005334 Bacteria 898
16 Ga0068869_100826211 3300005334 Unclassified 798
17 Ga0070666_10805574 3300005335 Bacteria 692
18 Ga0070680_100014552 3300005336 Bacteria 6154
19 Ga0068868_100597969 3300005338 Bacteria 977
20 Ga0070660_100067497 3300005339 Bacteria 2786
21 Ga0070660_100264132 3300005339 Bacteria 1406
22 Ga0070689_100056148 3300005340 Unclassified 3053
23 Ga0070689_100063181 3300005340 Bacteria 2882
24 Ga0070689_100072169 3300005340 Bacteria 2698
25 Ga0070687_100087748 3300005343 Bacteria 1713
26 Ga0070661_100044291 3300005344 Bacteria 3251
27 Ga0070661_100071502 3300005344 Bacteria 2553
28 Ga0070661_100464950 3300005344 Bacteria 1008
29 Ga0070661_101228252 3300005344 Bacteria 627
30 Ga0070668_100139268 3300005347 Unclassified 1954
31 Ga0070668_100980478 3300005347 Bacteria 759
32 Ga0070669_100903045 3300005353 Unclassified 755
33 Ga0070669_100922951 3300005353 Unclassified 746
34 Ga0070675_100026669 3300005354 Bacteria 4637
35 Ga0070671_100016865 3300005355 Bacteria 5908
36 Ga0070671_100142197 3300005355 Bacteria 2025
37 Ga0070671_100382722 3300005355 Bacteria 1203
38 Ga0070671_100603889 3300005355 Bacteria 948
39 Ga0070671_100617205 3300005355 Bacteria 938
40 Ga0070671_101382209 3300005355 Unclassified 622
41 Ga0070674_100005217 3300005356 Bacteria 7473
42 Ga0070674_100879158 3300005356 Bacteria 779
43 Ga0070673_100064883 3300005364 Unclassified 2910
44 Ga0070659_100153611 3300005366 Bacteria 1879
45 Ga0070667_100193106 3300005367 Bacteria 1804
46 Ga0070667_101970588 3300005367 Bacteria 550
47 Ga0070714_100078073 3300005435 Bacteria 2877
48 Ga0070714_100738644 3300005435 Bacteria 951
49 Ga0070713_100042250 3300005436 Bacteria 3720
50 Ga0070713_101229742 3300005436 Bacteria 725
51 Ga0070701_10140532 3300005438 Bacteria 1380
52 Ga0070701_10507257 3300005438 Bacteria 784
53 Ga0070708_100657755 3300005445 Bacteria 987
54 Ga0070663_100061326 3300005455 Unclassified 2708
55 Ga0070678_100016189 3300005456 Bacteria 4761
56 Ga0070662_100140611 3300005457 Bacteria 1870
57 Ga0070662_100448713 3300005457 Bacteria 1070
58 Ga0070681_10066718 3300005458 Bacteria 3567
59 Ga0070681_10139424 3300005458 Bacteria 2355
60 Ga0068867_100287816 3300005459 Bacteria 1350
61 Ga0070685_11140085 3300005466 Bacteria 590
62 Ga0070679_100066011 3300005530 Unclassified 3607
63 Ga0070679_100129099 3300005530 Bacteria 2509
64 Ga0070679_100134778 3300005530 Bacteria 2450
65 Ga0070684_100000055 3300005535 Bacteria 76528
66 Ga0068853_100001660 3300005539 Bacteria 16297
67 Ga0068853_100311312 3300005539 Bacteria 1458
68 Ga0070672_100011717 3300005543 Bacteria 6124
69 Ga0070672_100118611 3300005543 Bacteria 2164
70 Ga0070686_100387775 3300005544 Bacteria 1059
71 Ga0070695_100432749 3300005545 Unclassified 1004
72 Ga0070693_100219774 3300005547 Bacteria 1244
73 Ga0070704_100009079 3300005549 Bacteria 5998
74 Ga0070704_100750084 3300005549 Bacteria 869
75 Ga0068855_100023354 3300005563 Bacteria 7406
76 Ga0068855_100090299 3300005563 Bacteria 3535
77 Ga0068855_100301004 3300005563 Bacteria 1776
78 Ga0068855_100337736 3300005563 Bacteria 1662
79 Ga0070664_100026897 3300005564 Bacteria 4777
80 Ga0070664_100064663 3300005564 Bacteria 3120
81 Ga0070664_100109550 3300005564 Unclassified 2409
82 Ga0070664_100260584 3300005564 Bacteria 1560
83 Ga0070664_100755007 3300005564 Bacteria 908
84 Ga0068857_100053238 3300005577 Bacteria 3591
85 Ga0068854_100391890 3300005578 Bacteria 1147
86 Ga0068856_100960552 3300005614 Bacteria 873
87 Ga0070702_100170501 3300005615 Bacteria 1415
88 Ga0068852_100079210 3300005616 Bacteria 2910
89 Ga0068859_100209237 3300005617 Bacteria 2037
90 Ga0068859_100249208 3300005617 Bacteria 1866
91 Ga0068864_100012304 3300005618 Bacteria 7072
92 Ga0068864_100082822 3300005618 Bacteria 2816
93 Ga0068864_100109672 3300005618 Bacteria 2457
94 Ga0068861_100604471 3300005719 Unclassified 1007
95 Ga0068851_10058855 3300005834 Bacteria 1965
96 Ga0068870_10036664 3300005840 Bacteria 2523
97 Ga0068863_100030595 3300005841 Bacteria 5140
98 Ga0068863_100721150 3300005841 Bacteria 992
99 Ga0068863_102144773 3300005841 Bacteria 569
100 Ga0068858_100112459 3300005842 Bacteria 2543
101 Ga0068858_100305490 3300005842 Bacteria 1518
102 Ga0068858_100698915 3300005842 Bacteria 987
103 Ga0068860_100030909 3300005843 Bacteria 5149
104 Ga0068860_100100988 3300005843 Bacteria 2752
105 Ga0068862_100470057 3300005844 Bacteria 1188
106 Ga0068862_100488776 3300005844 Unclassified 1166
107 Ga0068862_101069949 3300005844 Bacteria 800
108 Ga0070717_10326963 3300006028 Bacteria 1367
109 Ga0070717_10925301 3300006028 Bacteria 794
110 Ga0097621_100116538 3300006237 Bacteria 2262
111 Ga0097621_100697191 3300006237 Unclassified 935
112 Ga0068871_100078175 3300006358 Bacteria 2735
113 Ga0068871_100230097 3300006358 Unclassified 1609
114 Ga0075428_101004814 3300006844 Unclassified 883
115 Ga0075429_100887574 3300006880 Bacteria 780
116 Ga0068865_100209061 3300006881 Bacteria 1519
117 Ga0068865_100555856 3300006881 Unclassified 964
118 Ga0097620_100078371 3300006931 Bacteria 3344
119 Ga0097620_100209233 3300006931 Bacteria 2037
120 Ga0097620_100249205 3300006931 Bacteria 1866
121 Ga0105250_10353642 3300009092 Bacteria 644
122 Ga0105240_10001603 3300009093 Bacteria 38377
123 Ga0105240_10264203 3300009093 Bacteria 1984
124 Ga0111539_10053597 3300009094 Bacteria 4801
125 Ga0111539_12591802 3300009094 Unclassified 588
126 Ga0105247_10045618 3300009101 Bacteria 2690
127 Ga0105247_10059972 3300009101 Bacteria 2357
128 Ga0105247_10111076 3300009101 Bacteria 1765
129 Ga0105243_10534960 3300009148 Bacteria 1117
130 Ga0105243_10549372 3300009148 Unclassified 1103
131 Ga0105241_10223096 3300009174 Bacteria 1585
132 Ga0105241_10267147 3300009174 Bacteria 1456
133 Ga0105242_10113812 3300009176 Unclassified 2311
134 Ga0105242_10317508 3300009176 Bacteria 1428
135 Ga0105242_10332910 3300009176 Bacteria 1396
136 Ga0105242_10645149 3300009176 Bacteria 1029
137 Ga0105248_10073052 3300009177 Bacteria 3855
138 Ga0105248_11112232 3300009177 Unclassified 893
139 Ga0105237_10008147 3300009545 Bacteria 11377
140 Ga0105249_10026902 3300009553 Bacteria 5186
141 Ga0105249_10113588 3300009553 Unclassified 2563
142 Ga0105249_10147397 3300009553 Bacteria 2262
143 Ga0105249_10158249 3300009553 Bacteria 2187
144 Ga0105249_10172627 3300009553 Bacteria 2098
145 Ga0105249_10441861 3300009553 Bacteria 1338
146 Ga0105249_12476532 3300009553 Bacteria 591
147 Ga0105239_11559654 3300010375 Bacteria 763
148 Ga0157373_10051436 3300013100 Bacteria 2934
149 Ga0157370_10004440 3300013104 Bacteria 16076
150 Ga0157370_10678494 3300013104 Bacteria 941
151 Ga0157369_10005357 3300013105 Bacteria 14943
152 Ga0157369_10082475 3300013105 Bacteria 3440
153 Ga0157369_10087201 3300013105 Bacteria 3333
154 Ga0157369_10242436 3300013105 Bacteria 1882
155 Ga0157369_11100532 3300013105 Bacteria 812
156 Ga0157374_10778267 3300013296 Bacteria 972
157 Ga0157374_11251257 3300013296 Bacteria 764
158 Ga0157374_11251262 3300013296 Bacteria 764
159 Ga0157378_10151523 3300013297 Unclassified 2161
160 Ga0163162_10197955 3300013306 Bacteria 2138
161 Ga0163162_10261257 3300013306 Bacteria 1863
162 Ga0163162_10728149 3300013306 Bacteria 1112
163 Ga0163162_11036997 3300013306 Bacteria 928
164 Ga0157372_10070687 3300013307 Unclassified 3928
165 Ga0157372_10098920 3300013307 Bacteria 3328
166 Ga0157372_10127551 3300013307 Bacteria 2925
167 Ga0157375_10031552 3300013308 Bacteria 5011
168 Ga0157375_10252481 3300013308 Bacteria 1924
169 Ga0163163_10058352 3300014325 Bacteria 3816
170 Ga0163163_10089362 3300014325 Bacteria 3092
171 Ga0163163_10188827 3300014325 Bacteria 2109
172 Ga0163163_10503264 3300014325 Bacteria 1273
173 Ga0157380_10021055 3300014326 Bacteria 4886
174 Ga0157380_10091491 3300014326 Bacteria 2511
175 Ga0157380_10106066 3300014326 Bacteria 2350
176 Ga0157379_10576513 3300014968 Bacteria 1049
177 Ga0157379_10629209 3300014968 Bacteria 1003
178 Ga0157379_11350231 3300014968 Bacteria 690
179 Ga0157376_10101071 3300014969 Bacteria 2519
180 Ga0163161_10014376 3300017792 Bacteria 5510
181 Ga0163161_10022308 3300017792 Bacteria 4457
182 Ga0197907_11161853 3300020069 Bacteria 902
183 Ga0207682_10030068 3300025893 Bacteria 2174
184 Ga0207642_10370660 3300025899 Unclassified 850
185 Ga0207710_10004493 3300025900 Bacteria 6075
186 Ga0207643_10126428 3300025908 Bacteria 1518
187 Ga0207705_10220497 3300025909 Bacteria 1440
188 Ga0207707_10121380 3300025912 Bacteria 2285
189 Ga0207695_10141266 3300025913 Bacteria 2356
190 Ga0207671_10068395 3300025914 Bacteria 2646
191 Ga0207657_10081599 3300025919 Bacteria 2716
192 Ga0207649_10278656 3300025920 Bacteria 1215
193 Ga0207652_10067359 3300025921 Bacteria 3104
194 Ga0207652_10106785 3300025921 Unclassified 2479
195 Ga0207652_10171345 3300025921 Bacteria 1948
196 Ga0207681_10865617 3300025923 Unclassified 756
197 Ga0207681_10954413 3300025923 Unclassified 719
198 Ga0207650_10002892 3300025925 Bacteria 11851
199 Ga0207650_10008141 3300025925 Bacteria 7147
200 Ga0207650_10177864 3300025925 Unclassified 1694
201 Ga0207659_10122577 3300025926 Bacteria 1994
202 Ga0207659_11113382 3300025926 Unclassified 679
203 Ga0207700_10024302 3300025928 Bacteria 4192
204 Ga0207700_11006677 3300025928 Bacteria 746
205 Ga0207664_10185251 3300025929 Bacteria 1789
206 Ga0207644_10008297 3300025931 Bacteria 6806
207 Ga0207644_10581707 3300025931 Bacteria 929
208 Ga0207644_10638581 3300025931 Bacteria 886
209 Ga0207644_11016078 3300025931 Unclassified 696
210 Ga0207706_10079403 3300025933 Bacteria 2886
211 Ga0207706_10281842 3300025933 Bacteria 1449
212 Ga0207686_10297275 3300025934 Bacteria 1198
213 Ga0207670_10095410 3300025936 Bacteria 2112
214 Ga0207670_10107051 3300025936 Unclassified 2007
215 Ga0207670_10474907 3300025936 Bacteria 1012
216 Ga0207669_10026842 3300025937 Bacteria 3141
217 Ga0207691_10092197 3300025940 Bacteria 2713
218 Ga0207711_10015311 3300025941 Bacteria 6366
219 Ga0207711_10095893 3300025941 Archaea 2617
220 Ga0207711_10781051 3300025941 Bacteria 890
221 Ga0207689_10294977 3300025942 Bacteria 1343
222 Ga0207689_10636128 3300025942 Bacteria 898
223 Ga0207661_10000005 3300025944 Bacteria 557888
224 Ga0207679_10044550 3300025945 Bacteria 3201
225 Ga0207679_10059466 3300025945 Bacteria 2836
226 Ga0207679_10320246 3300025945 Bacteria 1342
227 Ga0207667_10014445 3300025949 Bacteria 9002
228 Ga0207667_10063208 3300025949 Bacteria 3868
229 Ga0207667_10260427 3300025949 Bacteria 1774
230 Ga0207667_11337084 3300025949 Bacteria 692
231 Ga0207651_10383299 3300025960 Bacteria 1192
232 Ga0207651_10494093 3300025960 Bacteria 1057
233 Ga0207712_10006092 3300025961 Bacteria 7610
234 Ga0207712_10038418 3300025961 Bacteria 3274
235 Ga0207712_10100326 3300025961 Bacteria 2151
236 Ga0207712_10369187 3300025961 Bacteria 1198
237 Ga0207712_10877880 3300025961 Unclassified 792
238 Ga0207712_11078083 3300025961 Unclassified 715
239 Ga0207668_10465473 3300025972 Bacteria 1082
240 Ga0207640_10317731 3300025981 Bacteria 1238
241 Ga0207658_10221336 3300025986 Bacteria 1592
242 Ga0207658_10276921 3300025986 Bacteria 1437
243 Ga0207677_10164576 3300026023 Bacteria 1727
244 Ga0207677_10438159 3300026023 Bacteria 1117
245 Ga0207703_10211013 3300026035 Bacteria 1731
246 Ga0207703_10337335 3300026035 Bacteria 1384
247 Ga0207703_10927013 3300026035 Bacteria 834
248 Ga0207639_10013495 3300026041 Bacteria 5720
249 Ga0207639_10217124 3300026041 Bacteria 1649
250 Ga0207678_10207589 3300026067 Bacteria 1675
251 Ga0207708_11176221 3300026075 Bacteria 670
252 Ga0207641_10011313 3300026088 Bacteria 7323
253 Ga0207641_10493681 3300026088 Bacteria 1188
254 Ga0207641_10729952 3300026088 Bacteria 977
255 Ga0207641_10851889 3300026088 Bacteria 903
256 Ga0207641_11546275 3300026088 Bacteria 665
257 Ga0207648_10062782 3300026089 Unclassified 3238
258 Ga0207676_10023867 3300026095 Bacteria 4519
259 Ga0207676_10040544 3300026095 Bacteria 3568
260 Ga0207676_10040699 3300026095 Bacteria 3562
261 Ga0207676_10050060 3300026095 Bacteria 3255
262 Ga0207676_10146027 3300026095 Bacteria 2032
263 Ga0207674_10030861 3300026116 Bacteria 5633
264 Ga0207675_100206109 3300026118 Bacteria 1890
265 Ga0207675_100431610 3300026118 Bacteria 1303
266 Ga0207683_10059885 3300026121 Unclassified 3345
267 Ga0207698_10102451 3300026142 Bacteria 2376
268 Ga0268265_10282034 3300028380 Bacteria 1487
269 Ga0268265_10449742 3300028380 Bacteria 1203
270 Ga0268264_10004986 3300028381 Bacteria 11239
271 Ga0268264_10282078 3300028381 Bacteria 1556
272 Ga0268264_10522386 3300028381 Bacteria 1161
273 Ga0265323_10001760 3300028653 Bacteria 10281
274 Ga0265338_10041241 3300028800 Bacteria 4320
275 Ga0265325_10039849 3300031241 Bacteria 2470
276 Ga0265340_10035285 3300031247 Bacteria 2484
277 Ga0265331_10104425 3300031250 Unclassified 1302
278 Ga0265316_10297043 3300031344 Unclassified 1177
279 Ga0307509_10535369 3300031507 Bacteria 851
280 Ga0307408_100083928 3300031548 Unclassified 2388
281 Ga0307408_100367911 3300031548 Bacteria 1225
282 Ga0265313_10212219 3300031595 Unclassified 801
283 Ga0307405_10060265 3300031731 Bacteria 2394
284 Ga0307405_10103170 3300031731 Unclassified 1917
285 Ga0307405_10302643 3300031731 Bacteria 1214
286 Ga0307413_10003702 3300031824 Bacteria 6499
287 Ga0307413_10047614 3300031824 Bacteria 2557
288 Ga0307410_10000356 3300031852 Bacteria 17794
289 Ga0307410_10067851 3300031852 Bacteria 2461
290 Ga0307410_10088509 3300031852 Bacteria 2192
291 Ga0307410_10372336 3300031852 Bacteria 1147
292 Ga0307406_10011045 3300031901 Bacteria 5115
293 Ga0307406_10035556 3300031901 Bacteria 3065
294 Ga0307406_10102994 3300031901 Bacteria 1949
295 Ga0307406_10117845 3300031901 Unclassified 1840
296 Ga0307407_10134739 3300031903 Bacteria 1585
297 Ga0307407_10146474 3300031903 Unclassified 1530
298 Ga0307407_10618269 3300031903 Bacteria 808
299 Ga0307412_10032806 3300031911 Unclassified 3295
300 Ga0307412_10102440 3300031911 Bacteria 2027
301 Ga0307409_100041413 3300031995 Unclassified 3440
302 Ga0307409_100112191 3300031995 Bacteria 2289
303 Ga0307409_100453211 3300031995 Unclassified 1239
304 Ga0307409_101102577 3300031995 Unclassified 815
305 Ga0307409_101455202 3300031995 Unclassified 712
306 Ga0307416_100010149 3300032002 Bacteria 6207
307 Ga0307416_100233896 3300032002 Unclassified 1774
308 Ga0307416_100488599 3300032002 Bacteria 1293
309 Ga0307416_100838765 3300032002 Bacteria 1017
310 Ga0307416_100878919 3300032002 Bacteria 995
311 Ga0307411_10003624 3300032005 Bacteria 7217
312 Ga0307411_11542421 3300032005 Unclassified 611
313 Ga0307415_100001959 3300032126 Bacteria 10129
314 Ga0307415_100029886 3300032126 Bacteria 3488
315 Ga0307415_100247154 3300032126 Bacteria 1447
316 Ga0373953_0172916 3300035117 Bacteria 930
317 Ga0373943_0103676 3300035170 Bacteria 1491
318 Ga0373943_0392334 3300035170 Bacteria 800
319 Ga0373933_0121549 3300035724 Bacteria 1636
320 Ga0373947_0020575 3300035725 Bacteria 3811
321 Ga0373947_0559296 3300035725 Bacteria 779
322 Ga0373937_0025981 3300036401 Bacteria 5289
323 Ga0373937_0381214 3300036401 Bacteria 1337
324 Ga0373937_0830784 3300036401 Bacteria 872
325 Ga0373937_1254546 3300036401 Bacteria 689
326 Ga0373925_0001400 3300037068 Bacteria 20974
327 Ga0373925_0208623 3300037068 Bacteria 1556
328 Ga0373925_0230954 3300037068 Bacteria 1479
329 Ga0395898_0837071 3300037466 Bacteria 860
330 Ga0395905_0148617 3300037471 Unclassified 2204
331 Ga0436364_0038080 3300037853 Bacteria 1272
332 Ga0436362_0127168 3300039453 Unclassified 653
333 Ga0451807_1957196 3300041486 Eukaryota 682
334 Ga0451837_0488922 3300041494 Unclassified 757
335 Ga0451853_3101992 3300041512 Bacteria 1262
336 Ga0439432_014177 3300042006 Bacteria 2699
337 Ga0466958_0054950 3300045836 Bacteria 2416
338 Ga0466967_0557070 3300045976 Bacteria 1129
339 Ga0495651_0036005 3300046462 Bacteria 3852
340 Ga0495653_0126679 3300046463 Bacteria 1812
341 Ga0495639_0000418 3300046475 Bacteria 20271
342 Ga0495662_0002226 3300046476 Bacteria 9789
343 Ga0495664_0053245 3300046477 Bacteria 2406
344 Ga0495594_0120956 3300046499 Bacteria 1480
345 Ga0495628_0069707 3300046516 Bacteria 2742
346 Ga0495630_0041419 3300046517 Bacteria 3439
347 Ga0495666_0006216 3300046526 Bacteria 6012
348 Ga0495666_0190602 3300046526 Bacteria 945
349 Ga0495652_0079381 3300046529 Bacteria 2713
350 Ga0495665_0209911 3300046531 Bacteria 1008
351 Ga0495586_0001839 3300046535 Bacteria 11559
352 Ga0495586_0373629 3300046535 Bacteria 819
353 Ga0495587_0022305 3300046536 Bacteria 3898
354 Ga0495587_0735143 3300046536 Bacteria 540
355 Ga0495645_0001895 3300046543 Bacteria 14223
356 Ga0495622_0007870 3300046557 Bacteria 4946
357 Ga0495668_0000691 3300046616 Bacteria 40533
358 Ga0495634_0044002 3300046642 Bacteria 3024
359 Ga0495635_0017669 3300046663 Bacteria 4981
360 Ga0495599_0009272 3300046678 Bacteria 6010
361 Ga0495599_0207837 3300046678 Bacteria 1201
362 Ga0495623_0034356 3300046679 Bacteria 3252
363 Ga0495646_0186614 3300046680 Bacteria 1135
364 Ga0495647_0121875 3300046681 Bacteria 1097
365 Ga0495658_0095817 3300046683 Bacteria 1764
366 Ga0495613_0070891 3300046689 Bacteria 2541
367 Ga0495613_0078994 3300046689 Bacteria 2393
368 Ga0495600_0041753 3300046809 Bacteria 2990
369 Ga0495581_0001107 3300047315 Bacteria 14718
370 Ga0495604_0035751 3300047317 Bacteria 3921
371 Ga0495674_0063558 3300047319 Bacteria 3210
372 Ga0495674_0355442 3300047319 Bacteria 1189
373 Ga0495672_0210545 3300047320 Bacteria 966
374 Ga0495676_0003818 3300047321 Bacteria 13697
375 Ga0495680_0015803 3300047322 Bacteria 6498
376 Ga0495680_0384258 3300047322 Unclassified 972
377 Ga0495675_0222960 3300047444 Bacteria 1140
378 Ga0495675_0403940 3300047444 Unclassified 796
379 Ga0495675_0536614 3300047444 Bacteria 668
380 Ga0495684_0096867 3300047471 Bacteria 2232
381 Ga0495602_0040722 3300048088 Bacteria 4255
382 Ga0495614_0173643 3300048089 Unclassified 968
383 Ga0496104_0145627 3300048907 Bacteria 2275
384 Ga0496109_0738881 3300048912 Bacteria 922
385 Ga0496110_0925258 3300048913 Bacteria 778
386 Ga0496111_0622731 3300048914 Bacteria 789
387 Ga0501202_001759 3300049652 Bacteria 3537
388 Ga0501209_006573 3300049656 Bacteria 2178
389 Ga0501217_068755 3300049661 Bacteria 960
390 Ga0501223_024537 3300049663 Bacteria 1173
391 Ga0501224_039327 3300049664 Bacteria 714
392 Ga0501235_033310 3300049669 Bacteria 1166
393 Ga0501239_001897 3300049672 Bacteria 1853
394 Ga0501247_001382 3300049677 Bacteria 2322
395 Ga0501249_016641 3300049679 Bacteria 1580
396 Ga0501256_030290 3300049685 Bacteria 607
397 Ga0501257_018529 3300049686 Bacteria 1624
398 Ga0501221_041612 3300049704 Bacteria 1004
399 Ga0501225_0013033 3300049705 Bacteria 2329
400 Ga0501266_017387 3300049763 Bacteria 961
401 Ga0501267_011909 3300049764 Unclassified 891
402 Ga0501268_001179 3300049765 Bacteria 3178
403 Ga0501270_000799 3300049767 Bacteria 2818
404 Ga0501272_001797 3300049769 Bacteria 2083
405 Ga0501272_020902 3300049769 Bacteria 786
406 nmdc:mga09592_832001_c1 3300050508 Bacteria 779
407 nmdc:mga08y16_69083_c1 3300050511 Bacteria 3683
408 nmdc:mga0n895_146698_c1 3300050512 Bacteria 2389
409 Ga0501082_0005330 3300060353 Bacteria 11175
410 Ga0105240_10724301
411 Ga0065704_10082005
412 Ga0065704_10128345
413 Ga0065712_10187827
414 Ga0065715_10006982
415 Ga0065707_10241114
416 Ga0070676_10073058
417 Ga0070676_10174161
418 Ga0070676_10494406
419 Ga0070690_100013676
420 Ga0070670_100006009
421 Ga0070670_100081529
422 Ga0070670_100257945
423 Ga0070677_10029170
424 Ga0068869_100645197
425 Ga0068869_100826211
426 Ga0070666_10805574
427 Ga0070680_100014552
428 Ga0068868_100597969
429 Ga0070660_100067497
430 Ga0070660_100264132
431 Ga0070689_100056148
432 Ga0070689_100063181
433 Ga0070689_100072169
434 Ga0070687_100087748
435 Ga0070661_100044291
436 Ga0070661_100071502
437 Ga0070661_100464950
438 Ga0070661_101228252
439 Ga0070668_100139268
440 Ga0070668_100980478
441 Ga0070669_100903045
442 Ga0070669_100922951
443 Ga0070675_100026669
444 Ga0070671_100016865
445 Ga0070671_100142197
446 Ga0070671_100382722
447 Ga0070671_100603889
448 Ga0070671_100617205
449 Ga0070671_101382209
450 Ga0070674_100005217
451 Ga0070674_100879158
452 Ga0070673_100064883
453 Ga0070659_100153611
454 Ga0070667_100193106
455 Ga0070667_101970588
456 Ga0070714_100078073
457 Ga0070714_100738644
458 Ga0070713_100042250
459 Ga0070713_101229742
460 Ga0070701_10140532
461 Ga0070701_10507257
462 Ga0070708_100657755
463 Ga0070663_100061326
464 Ga0070678_100016189
465 Ga0070662_100140611
466 Ga0070662_100448713
467 Ga0070681_10066718
468 Ga0070681_10139424
469 Ga0068867_100287816
470 Ga0070685_11140085
471 Ga0070679_100066011
472 Ga0070679_100129099
473 Ga0070679_100134778
474 Ga0070684_100000055
475 Ga0068853_100001660
476 Ga0068853_100311312
477 Ga0070672_100011717
478 Ga0070672_100118611
479 Ga0070686_100387775
480 Ga0070695_100432749
481 Ga0070693_100219774
482 Ga0070704_100009079
483 Ga0070704_100750084
484 Ga0068855_100023354
485 Ga0068855_100090299
486 Ga0068855_100301004
487 Ga0068855_100337736
488 Ga0070664_100026897
489 Ga0070664_100064663
490 Ga0070664_100109550
491 Ga0070664_100260584
492 Ga0070664_100755007
493 Ga0068857_100053238
494 Ga0068854_100391890
495 Ga0068856_100960552
496 Ga0070702_100170501
497 Ga0068852_100079210
498 Ga0068859_100209237
499 Ga0068859_100249208
500 Ga0068864_100012304
501 Ga0068864_100082822
502 Ga0068864_100109672
503 Ga0068861_100604471
504 Ga0068851_10058855
505 Ga0068870_10036664
506 Ga0068863_100030595
507 Ga0068863_100721150
508 Ga0068863_102144773
509 Ga0068858_100112459
510 Ga0068858_100305490
511 Ga0068858_100698915
512 Ga0068860_100030909
513 Ga0068860_100100988
514 Ga0068862_100470057
515 Ga0068862_100488776
516 Ga0068862_101069949
517 Ga0070717_10326963
518 Ga0070717_10925301
519 Ga0097621_100116538
520 Ga0097621_100697191
521 Ga0068871_100078175
522 Ga0068871_100230097
523 Ga0075428_101004814
524 Ga0075429_100887574
525 Ga0068865_100209061
526 Ga0068865_100555856
527 Ga0097620_100078371
528 Ga0097620_100209233
529 Ga0097620_100249205
530 Ga0105250_10353642
531 Ga0105240_10001603
532 Ga0105240_10264203
533 Ga0111539_10053597
534 Ga0111539_12591802
535 Ga0105247_10045618
536 Ga0105247_10059972
537 Ga0105247_10111076
538 Ga0105243_10534960
539 Ga0105243_10549372
540 Ga0105241_10223096
541 Ga0105241_10267147
542 Ga0105242_10113812
543 Ga0105242_10317508
544 Ga0105242_10332910
545 Ga0105242_10645149
546 Ga0105248_10073052
547 Ga0105248_11112232
548 Ga0105237_10008147
549 Ga0105249_10026902
550 Ga0105249_10113588
551 Ga0105249_10147397
552 Ga0105249_10158249
553 Ga0105249_10172627
554 Ga0105249_10441861
555 Ga0105249_12476532
556 Ga0105239_11559654
557 Ga0157373_10051436
558 Ga0157370_10004440
559 Ga0157370_10678494
560 Ga0157369_10005357
561 Ga0157369_10082475
562 Ga0157369_10087201
563 Ga0157369_10242436
564 Ga0157369_11100532
565 Ga0157374_10778267
566 Ga0157374_11251257
567 Ga0157374_11251262
568 Ga0157378_10151523
569 Ga0163162_10197955
570 Ga0163162_10261257
571 Ga0163162_10728149
572 Ga0163162_11036997
573 Ga0157372_10070687
574 Ga0157372_10098920
575 Ga0157372_10127551
576 Ga0157375_10031552
577 Ga0157375_10252481
578 Ga0163163_10058352
579 Ga0163163_10089362
580 Ga0163163_10188827
581 Ga0163163_10503264
582 Ga0157380_10021055
583 Ga0157380_10091491
584 Ga0157380_10106066
585 Ga0157379_10576513
586 Ga0157379_10629209
587 Ga0157379_11350231
588 Ga0157376_10101071
589 Ga0163161_10014376
590 Ga0163161_10022308
591 Ga0197907_11161853
592 Ga0207682_10030068
593 Ga0207642_10370660
594 Ga0207710_10004493
595 Ga0207643_10126428
596 Ga0207705_10220497
597 Ga0207707_10121380
598 Ga0207695_10141266
599 Ga0207671_10068395
600 Ga0207657_10081599
601 Ga0207649_10278656
602 Ga0207652_10067359
603 Ga0207652_10106785
604 Ga0207652_10171345
605 Ga0207681_10865617
606 Ga0207681_10954413
607 Ga0207650_10002892
608 Ga0207650_10008141
609 Ga0207650_10177864
610 Ga0207659_10122577
611 Ga0207659_11113382
612 Ga0207700_10024302
613 Ga0207700_11006677
614 Ga0207664_10185251
615 Ga0207644_10008297
616 Ga0207644_10581707
617 Ga0207644_10638581
618 Ga0207644_11016078
619 Ga0207706_10079403
620 Ga0207706_10281842
621 Ga0207686_10297275
622 Ga0207670_10095410
623 Ga0207670_10107051
624 Ga0207670_10474907
625 Ga0207669_10026842
626 Ga0207691_10092197
627 Ga0207711_10015311
628 Ga0207711_10095893
629 Ga0207711_10781051
630 Ga0207689_10294977
631 Ga0207689_10636128
632 Ga0207661_10000005
633 Ga0207679_10044550
634 Ga0207679_10059466
635 Ga0207679_10320246
636 Ga0207667_10014445
637 Ga0207667_10063208
638 Ga0207667_10260427
639 Ga0207667_11337084
640 Ga0207651_10383299
641 Ga0207651_10494093
642 Ga0207712_10006092
643 Ga0207712_10038418
644 Ga0207712_10100326
645 Ga0207712_10369187
646 Ga0207712_10877880
647 Ga0207712_11078083
648 Ga0207668_10465473
649 Ga0207640_10317731
650 Ga0207658_10221336
651 Ga0207658_10276921
652 Ga0207677_10164576
653 Ga0207677_10438159
654 Ga0207703_10211013
655 Ga0207703_10337335
656 Ga0207703_10927013
657 Ga0207639_10013495
658 Ga0207639_10217124
659 Ga0207678_10207589
660 Ga0207708_11176221
661 Ga0207641_10011313
662 Ga0207641_10493681
663 Ga0207641_10729952
664 Ga0207641_10851889
665 Ga0207641_11546275
666 Ga0207648_10062782
667 Ga0207676_10023867
668 Ga0207676_10040544
669 Ga0207676_10040699
670 Ga0207676_10050060
671 Ga0207676_10146027
672 Ga0207674_10030861
673 Ga0207675_100206109
674 Ga0207675_100431610
675 Ga0207683_10059885
676 Ga0207698_10102451
677 Ga0268265_10282034
678 Ga0268265_10449742
679 Ga0268264_10004986
680 Ga0268264_10282078
681 Ga0268264_10522386
682 Ga0265323_10001760
683 Ga0265338_10041241
684 Ga0265325_10039849
685 Ga0265340_10035285
686 Ga0265331_10104425
687 Ga0265316_10297043
688 Ga0307509_10535369
689 Ga0307408_100083928
690 Ga0307408_100367911
691 Ga0265313_10212219
692 Ga0307405_10060265
693 Ga0307405_10103170
694 Ga0307405_10302643
695 Ga0307413_10003702
696 Ga0307413_10047614
697 Ga0307410_10000356
698 Ga0307410_10067851
699 Ga0307410_10088509
700 Ga0307410_10372336
701 Ga0307406_10011045
702 Ga0307406_10035556
703 Ga0307406_10102994
704 Ga0307406_10117845
705 Ga0307407_10134739
706 Ga0307407_10146474
707 Ga0307407_10618269
708 Ga0307412_10032806
709 Ga0307412_10102440
710 Ga0307409_100041413
711 Ga0307409_100112191
712 Ga0307409_100453211
713 Ga0307409_101102577
714 Ga0307409_101455202
715 Ga0307416_100010149
716 Ga0307416_100233896
717 Ga0307416_100488599
718 Ga0307416_100838765
719 Ga0307416_100878919
720 Ga0307411_10003624
721 Ga0307411_11542421
722 Ga0307415_100001959
723 Ga0307415_100029886
724 Ga0307415_100247154
725 Ga0373953_0172916
726 Ga0373943_0103676
727 Ga0373943_0392334
728 Ga0373933_0121549
729 Ga0373947_0020575
730 Ga0373947_0559296
731 Ga0373937_0025981
732 Ga0373937_0381214
733 Ga0373937_0830784
734 Ga0373937_1254546
735 Ga0373925_0001400
736 Ga0373925_0208623
737 Ga0373925_0230954
738 Ga0395898_0837071
739 Ga0395905_0148617
740 Ga0436364_0038080
741 Ga0436362_0127168
742 Ga0451807_1957196
743 Ga0451837_0488922
744 Ga0451853_3101992
745 Ga0439432_014177
746 Ga0466958_0054950
747 Ga0466967_0557070
748 Ga0495651_0036005
749 Ga0495653_0126679
750 Ga0495639_0000418
751 Ga0495662_0002226
752 Ga0495664_0053245
753 Ga0495594_0120956
754 Ga0495628_0069707
755 Ga0495630_0041419
756 Ga0495666_0006216
757 Ga0495666_0190602
758 Ga0495652_0079381
759 Ga0495665_0209911
760 Ga0495586_0001839
761 Ga0495586_0373629
762 Ga0495587_0022305
763 Ga0495587_0735143
764 Ga0495645_0001895
765 Ga0495622_0007870
766 Ga0495668_0000691
767 Ga0495634_0044002
768 Ga0495635_0017669
769 Ga0495599_0009272
770 Ga0495599_0207837
771 Ga0495623_0034356
772 Ga0495646_0186614
773 Ga0495647_0121875
774 Ga0495658_0095817
775 Ga0495613_0070891
776 Ga0495613_0078994
777 Ga0495600_0041753
778 Ga0495581_0001107
779 Ga0495604_0035751
780 Ga0495674_0063558
781 Ga0495674_0355442
782 Ga0495672_0210545
783 Ga0495676_0003818
784 Ga0495680_0015803
785 Ga0495680_0384258
786 Ga0495675_0222960
787 Ga0495675_0403940
788 Ga0495675_0536614
789 Ga0495684_0096867
790 Ga0495602_0040722
791 Ga0495614_0173643
792 Ga0496104_0145627
793 Ga0496109_0738881
794 Ga0496110_0925258
795 Ga0496111_0622731
796 Ga0501202_001759
797 Ga0501209_006573
798 Ga0501217_068755
799 Ga0501223_024537
800 Ga0501224_039327
801 Ga0501235_033310
802 Ga0501239_001897
803 Ga0501247_001382
804 Ga0501249_016641
805 Ga0501256_030290
806 Ga0501257_018529
807 Ga0501221_041612
808 Ga0501225_0013033
809 Ga0501266_017387
810 Ga0501267_011909
811 Ga0501268_001179
812 Ga0501270_000799
813 Ga0501272_001797
814 Ga0501272_020902
815 nmdc:mga09592_832001_c1
816 nmdc:mga08y16_69083_c1
817 nmdc:mga0n895_146698_c1
818 Ga0501082_0005330

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01467

CTP_transf_like

Cytidylyltransferase-like

25

154

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6b7b-assembly1.cif.gz_A crystal structure of e.coli phosphopantetheine adenylyltransferase (ppat/coad) in complex with 5-methoxy-2-methyl-1h-indole 0.9658 2 162
6b7d-assembly1.cif.gz_A crystal structure of e.coli phosphopantetheine adenylyltransferase (ppat/coad) in complex with 3-(4-chlorophenyl)-6-methoxy-4,5-dimethylpyridazine 0.9646 2 162
6qmi-assembly1.cif.gz_A phosphopantetheine adenylyltransferase from mycobacterium tuberculosis in complex with 3-(1h-indol-1-yl)propanoic acid at 1.7a resolution. 0.9565 1 161
1qjc-assembly1.cif.gz_B phosphopantetheine adenylyltransferase from escherichia coli in complex with 4'-phosphopantetheine 0.9562 2 160
3l93-assembly1.cif.gz_A phosphopantetheine adenylyltransferase from yersinia pestis. 0.9546 1 161
ID Description Score Start End Superfamily
6g7vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9564 1 161 3.40.50.620
6g7vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9438 1 161 3.40.50.620
5ts2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.943 1 160 3.40.50.620
4f3rC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9399 1 156 3.40.50.620
3nbkD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9322 1 161 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A2V8QWP6-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9767 2 160 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A2A5F3W8-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9722 1 160 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A3S5J5D6-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9719 2 160 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A853HS31-F1-model_v4 deleted 0.97 2 160
AF-A0A2E9X7P9-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9695 2 160 GO:0004595
GO:0005524
GO:0005737
GO:0015937

Map