F436962

General Info

Members Datasets Scaffolds Average Seq Length
409 221 818 163

Family's Representative Sequence

Representative Sequence 3300006880|Ga0075429_100535867|Ga0075429_1005358672
Length 178
Sequence MAKFTLRINGQRHELDGEAGDSLLAVLRGDLGLTGSKFGCGEGYCGACTVLVDAQVTRSCTARLAAVAGKSITTIEGITAAASGAEGSLHPVQEAFLETEAFQCGYCTPGMVVATVGLLRTNPDPTDQDIAKALDRNVCRCGAYPRIVQAVKLAAQRMRARTLASRGAAPAIQTRIPR

Samples

Sample ID Description Type Environment
1 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
106 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
107 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
108 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
109 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
110 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
114 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
115 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
116 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
117 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
118 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
119 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
120 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
121 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
122 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
123 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
125 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
129 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
130 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
131 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
132 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
133 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
134 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
137 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
138 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
139 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
140 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
141 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
142 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
143 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
144 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
145 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
146 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
147 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
155 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
156 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
157 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
158 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
159 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
172 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
173 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
174 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
175 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
176 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
177 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
178 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
179 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
180 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
181 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
182 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
183 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
184 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
185 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
186 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
187 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
191 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
192 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
193 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
194 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
195 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
206 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
207 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
208 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
209 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
210 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
211 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
212 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
213 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
214 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
215 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
216 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
217 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
218 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
219 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
220 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
221 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.53
Metatranscriptomes 0.24
Isolates 1.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.49
Rhizoplane 1.71
Rhizosphere 96.82
Stem 0
Stem Tuber 0
Unclassified 7.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075429_100535867 3300006880 Bacteria 1026
2 MBSR1b_contig_1059277 2162886012 Bacteria 1052
3 Ga0070676_11106738 3300005328 Bacteria 599
4 Ga0070683_100013307 3300005329 Bacteria 7172
5 Ga0070670_100028993 3300005331 Bacteria 4764
6 Ga0070670_100736506 3300005331 Bacteria 888
7 Ga0070670_100939521 3300005331 Bacteria 785
8 Ga0070677_10504616 3300005333 Bacteria 656
9 Ga0070666_10106378 3300005335 Unclassified 1938
10 Ga0070682_100389828 3300005337 Bacteria 1050
11 Ga0070660_100126071 3300005339 Bacteria 2046
12 Ga0070660_100752740 3300005339 Bacteria 818
13 Ga0070689_100385004 3300005340 Bacteria 1183
14 Ga0070661_100052667 3300005344 Unclassified 2979
15 Ga0070669_100299547 3300005353 Bacteria 1293
16 Ga0070671_100071384 3300005355 Bacteria 2898
17 Ga0070674_100124924 3300005356 Bacteria 1909
18 Ga0070673_100149790 3300005364 Bacteria 1975
19 Ga0070714_100127000 3300005435 Bacteria 2275
20 Ga0070710_10511036 3300005437 Bacteria 824
21 Ga0070711_100000001 3300005439 Bacteria 370591
22 Ga0070694_100113655 3300005444 Bacteria 1932
23 Ga0070708_100003752 3300005445 Bacteria 11922
24 Ga0070708_100010926 3300005445 Bacteria 7377
25 Ga0070708_100132792 3300005445 Bacteria 2305
26 Ga0070663_100521728 3300005455 Bacteria 989
27 Ga0070678_101447766 3300005456 Unclassified 642
28 Ga0070662_100230369 3300005457 Bacteria 1482
29 Ga0070662_100386101 3300005457 Bacteria 1153
30 Ga0070681_10162250 3300005458 Bacteria 2159
31 Ga0070681_10446204 3300005458 Bacteria 1206
32 Ga0070706_100022878 3300005467 Bacteria 5756
33 Ga0070706_100246515 3300005467 Bacteria 1668
34 Ga0070707_100178709 3300005468 Bacteria 2069
35 Ga0070707_100379266 3300005468 Bacteria 1374
36 Ga0070698_100314552 3300005471 Bacteria 1497
37 Ga0070684_100000301 3300005535 Bacteria 34312
38 Ga0070686_100146280 3300005544 Bacteria 1650
39 Ga0070695_100636790 3300005545 Bacteria 841
40 Ga0070696_100268408 3300005546 Bacteria 1297
41 Ga0070696_100367165 3300005546 Bacteria 1118
42 Ga0070704_100471753 3300005549 Bacteria 1084
43 Ga0068855_101075775 3300005563 Bacteria 842
44 Ga0070664_100007989 3300005564 Bacteria 8546
45 Ga0070664_100028714 3300005564 Bacteria 4630
46 Ga0068857_100026135 3300005577 Bacteria 5142
47 Ga0068856_100601985 3300005614 Bacteria 1120
48 Ga0070702_100182832 3300005615 Bacteria 1373
49 Ga0068852_100499278 3300005616 Bacteria 1211
50 Ga0068859_100335187 3300005617 Bacteria 1607
51 Ga0068859_101455708 3300005617 Bacteria 756
52 Ga0068859_101654032 3300005617 Bacteria 707
53 Ga0068861_100054517 3300005719 Bacteria 3046
54 Ga0068858_100121639 3300005842 Unclassified 2441
55 Ga0068862_100693488 3300005844 Bacteria 986
56 Ga0075432_10341002 3300006058 Bacteria 632
57 Ga0070716_101272711 3300006173 Bacteria 593
58 Ga0097621_100029722 3300006237 Unclassified 4319
59 Ga0068871_100113885 3300006358 Bacteria 2278
60 Ga0075428_100936042 3300006844 Bacteria 918
61 Ga0075430_100005368 3300006846 Bacteria 10820
62 Ga0075430_100010316 3300006846 Bacteria 7911
63 Ga0075430_100091325 3300006846 Bacteria 2546
64 Ga0075430_100116837 3300006846 Bacteria 2223
65 Ga0075430_100144112 3300006846 Bacteria 1984
66 Ga0075430_100297379 3300006846 Bacteria 1335
67 Ga0075430_100875928 3300006846 Bacteria 740
68 Ga0075431_100016422 3300006847 Bacteria 7514
69 Ga0075431_100073724 3300006847 Bacteria 3522
70 Ga0075431_100378801 3300006847 Bacteria 1419
71 Ga0075431_100938031 3300006847 Bacteria 834
72 Ga0075431_101032080 3300006847 Bacteria 788
73 Ga0075433_10006531 3300006852 Bacteria 9226
74 Ga0075433_10060948 3300006852 Bacteria 3305
75 Ga0075434_100219442 3300006871 Bacteria 1921
76 Ga0075434_100486183 3300006871 Bacteria 1255
77 Ga0075429_100002178 3300006880 Bacteria 16367
78 Ga0075429_100005484 3300006880 Bacteria 10925
79 Ga0075436_100000800 3300006914 Bacteria 20861
80 Ga0075436_100641445 3300006914 Bacteria 784
81 Ga0097620_100335223 3300006931 Bacteria 1607
82 Ga0097620_101455822 3300006931 Bacteria 756
83 Ga0097620_101653691 3300006931 Bacteria 707
84 Ga0075435_100021635 3300007076 Bacteria 4950
85 Ga0111539_10001022 3300009094 Bacteria 36697
86 Ga0111539_10003751 3300009094 Bacteria 20000
87 Ga0111539_10080299 3300009094 Bacteria 3837
88 Ga0111539_10110769 3300009094 Bacteria 3221
89 Ga0111539_10941159 3300009094 Unclassified 1005
90 Ga0111539_12181026 3300009094 Bacteria 643
91 Ga0114129_10000746 3300009147 Bacteria 41323
92 Ga0114129_10002550 3300009147 Bacteria 25295
93 Ga0114129_10030963 3300009147 Bacteria 7566
94 Ga0114129_10152720 3300009147 Bacteria 3159
95 Ga0114129_10240003 3300009147 Bacteria 2436
96 Ga0114129_10973364 3300009147 Bacteria 1070
97 Ga0114129_11384723 3300009147 Bacteria 868
98 Ga0105241_10364221 3300009174 Bacteria 1259
99 Ga0105242_11040325 3300009176 Bacteria 829
100 Ga0105248_10026474 3300009177 Bacteria 6453
101 Ga0105248_10053486 3300009177 Bacteria 4530
102 Ga0105237_11203827 3300009545 Bacteria 764
103 Ga0105249_10462770 3300009553 Bacteria 1308
104 Ga0157373_10783595 3300013100 Bacteria 702
105 Ga0157371_10477863 3300013102 Bacteria 918
106 Ga0157370_10400037 3300013104 Bacteria 1264
107 Ga0157372_10219345 3300013307 Bacteria 2205
108 Ga0163163_10000003 3300014325 Bacteria 455102
109 Ga0163163_10041723 3300014325 Bacteria 4489
110 Ga0157380_10020759 3300014326 Bacteria 4915
111 Ga0157380_10030951 3300014326 Bacteria 4104
112 Ga0157377_10679864 3300014745 Unclassified 745
113 Ga0157379_10561859 3300014968 Unclassified 1062
114 Ga0157379_10953273 3300014968 Bacteria 816
115 Ga0157376_11689715 3300014969 Bacteria 668
116 Ga0206353_11042439 3300020082 Bacteria 2151
117 Ga0207680_10056324 3300025903 Bacteria 2374
118 Ga0207684_10242088 3300025910 Bacteria 1556
119 Ga0207684_10450819 3300025910 Bacteria 1104
120 Ga0207707_10479504 3300025912 Bacteria 1062
121 Ga0207663_10000010 3300025916 Bacteria 177296
122 Ga0207657_10321574 3300025919 Bacteria 1223
123 Ga0207657_10412537 3300025919 Bacteria 1062
124 Ga0207652_10124073 3300025921 Bacteria 2300
125 Ga0207646_10149391 3300025922 Bacteria 2107
126 Ga0207646_10440061 3300025922 Bacteria 1176
127 Ga0207681_10105210 3300025923 Bacteria 2043
128 Ga0207681_10173118 3300025923 Unclassified 1638
129 Ga0207650_10004561 3300025925 Bacteria 9470
130 Ga0207650_10250612 3300025925 Unclassified 1433
131 Ga0207659_10030337 3300025926 Bacteria 3693
132 Ga0207664_10613679 3300025929 Bacteria 977
133 Ga0207664_11396033 3300025929 Bacteria 621
134 Ga0207644_10016947 3300025931 Bacteria 4910
135 Ga0207690_10738334 3300025932 Bacteria 811
136 Ga0207706_10054257 3300025933 Unclassified 3537
137 Ga0207706_10451132 3300025933 Bacteria 1112
138 Ga0207706_10914263 3300025933 Bacteria 741
139 Ga0207709_11156110 3300025935 Bacteria 637
140 Ga0207669_10196483 3300025937 Bacteria 1460
141 Ga0207669_10379577 3300025937 Bacteria 1101
142 Ga0207665_11243153 3300025939 Bacteria 594
143 Ga0207691_10066202 3300025940 Unclassified 3269
144 Ga0207711_10060727 3300025941 Unclassified 3258
145 Ga0207661_10249082 3300025944 Bacteria 1578
146 Ga0207679_10006777 3300025945 Bacteria 7257
147 Ga0207679_10135152 3300025945 Bacteria 1985
148 Ga0207667_11240625 3300025949 Bacteria 724
149 Ga0207651_10087911 3300025960 Bacteria 2264
150 Ga0207712_10111609 3300025961 Bacteria 2052
151 Ga0207703_10656315 3300026035 Bacteria 995
152 Ga0207708_10345967 3300026075 Bacteria 1219
153 Ga0207702_10433974 3300026078 Bacteria 1272
154 Ga0207674_10025223 3300026116 Bacteria 6343
155 Ga0207683_10193143 3300026121 Unclassified 1849
156 Ga0207428_10007286 3300027907 Bacteria 10114
157 Ga0207428_10026983 3300027907 Bacteria 4785
158 Ga0207428_10789709 3300027907 Unclassified 675
159 Ga0268265_10724554 3300028380 Bacteria 963
160 Ga0268264_10170670 3300028381 Unclassified 1967
161 Ga0268264_10600177 3300028381 Bacteria 1085
162 Ga0307408_100009704 3300031548 Bacteria 6344
163 Ga0307408_100202615 3300031548 Bacteria 1607
164 Ga0307408_100264842 3300031548 Bacteria 1424
165 Ga0307408_100557889 3300031548 Bacteria 1012
166 Ga0307405_10317619 3300031731 Bacteria 1188
167 Ga0307405_10362440 3300031731 Bacteria 1122
168 Ga0307410_10507047 3300031852 Bacteria 994
169 Ga0307410_10638350 3300031852 Bacteria 892
170 Ga0307410_10685793 3300031852 Bacteria 862
171 Ga0307406_10128044 3300031901 Bacteria 1777
172 Ga0307406_10624714 3300031901 Bacteria 891
173 Ga0307407_10058072 3300031903 Bacteria 2248
174 Ga0307407_10609087 3300031903 Bacteria 814
175 Ga0307407_10728556 3300031903 Bacteria 749
176 Ga0307412_10110731 3300031911 Bacteria 1960
177 Ga0307409_100174234 3300031995 Bacteria 1897
178 Ga0307416_100004009 3300032002 Bacteria 8789
179 Ga0307416_100009084 3300032002 Bacteria 6474
180 Ga0307416_100026323 3300032002 Bacteria 4285
181 Ga0307416_100048374 3300032002 Bacteria 3373
182 Ga0307416_100059208 3300032002 Bacteria 3111
183 Ga0307416_101796341 3300032002 Bacteria 717
184 Ga0307411_10276751 3300032005 Bacteria 1334
185 Ga0307411_10437545 3300032005 Bacteria 1090
186 Ga0307411_10838747 3300032005 Bacteria 812
187 Ga0307415_100097947 3300032126 Bacteria 2142
188 Ga0307415_100251897 3300032126 Bacteria 1435
189 Ga0307415_100686593 3300032126 Bacteria 922
190 Ga0307415_100847408 3300032126 Bacteria 838
191 Ga0373934_0005222 3300035086 Bacteria 4803
192 Ga0373940_0033964 3300035088 Bacteria 1374
193 Ga0373951_0066183 3300035091 Bacteria 913
194 Ga0373932_0041581 3300035112 Bacteria 1329
195 Ga0373954_0124511 3300035118 Unclassified 1253
196 Ga0373956_0014319 3300035119 Bacteria 3312
197 Ga0373943_0013822 3300035170 Bacteria 3650
198 Ga0373955_0003305 3300035172 Bacteria 7077
199 Ga0373931_0152367 3300035691 Bacteria 1349
200 Ga0373935_0657049 3300035692 Bacteria 769
201 Ga0373935_0887677 3300035692 Bacteria 660
202 Ga0373933_0019846 3300035724 Bacteria 3804
203 Ga0373933_0174629 3300035724 Bacteria 1368
204 Ga0373947_0175818 3300035725 Bacteria 1391
205 Ga0373947_0370675 3300035725 Bacteria 963
206 Ga0373937_0002164 3300036401 Bacteria 16463
207 Ga0373937_0002361 3300036401 Bacteria 15728
208 Ga0373937_0259673 3300036401 Bacteria 1638
209 Ga0395905_1299081 3300037471 Bacteria 631
210 Ga0439435_0001147 3300042436 Bacteria 4744
211 Ga0439435_0027283 3300042436 Bacteria 1527
212 Ga0439444_0056794 3300042437 Bacteria 808
213 Ga0439464_0000387 3300042439 Bacteria 8611
214 Ga0439460_0039908 3300042461 Bacteria 1374
215 Ga0439460_0078575 3300042461 Bacteria 1033
216 Ga0439440_0129468 3300042993 Unclassified 709
217 Ga0466960_0081681 3300044901 Bacteria 1630
218 Ga0451576_0047413 3300045051 Bacteria 4518
219 Ga0466967_0200944 3300045976 Bacteria 1888
220 Ga0495592_0295290 3300046454 Bacteria 1055
221 Ga0495651_0405695 3300046462 Bacteria 889
222 Ga0495608_0018604 3300046511 Bacteria 4789
223 Ga0495608_0151053 3300046511 Bacteria 1480
224 Ga0495630_0543010 3300046517 Bacteria 891
225 Ga0495640_0108602 3300046533 Bacteria 1815
226 Ga0495621_0048806 3300046539 Bacteria 1509
227 Ga0495667_0063413 3300046559 Bacteria 2419
228 Ga0495635_0380216 3300046663 Bacteria 940
229 Ga0495635_0387587 3300046663 Bacteria 929
230 Ga0495613_0396283 3300046689 Bacteria 942
231 Ga0495604_0041914 3300047317 Bacteria 3589
232 Ga0495604_0843456 3300047317 Bacteria 575
233 Ga0495674_0398421 3300047319 Bacteria 1111
234 Ga0495675_0039004 3300047444 Bacteria 3025
235 Ga0496102_0425607 3300048905 Bacteria 1247
236 Ga0496105_0115497 3300048908 Bacteria 2214
237 Ga0496110_0024906 3300048913 Bacteria 5106
238 Ga0496111_0312283 3300048914 Unclassified 1165
239 Ga0496111_0400451 3300048914 Bacteria 1014
240 Ga0496112_0029466 3300048915 Bacteria 5308
241 Ga0496114_0112607 3300048917 Unclassified 2333
242 Ga0496125_0119839 3300048928 Bacteria 1880
243 Ga0501291_097942 3300049514 Bacteria 608
244 Ga0501295_055149 3300049518 Bacteria 859
245 Ga0501298_024956 3300049521 Bacteria 1142
246 Ga0501298_057247 3300049521 Bacteria 819
247 Ga0501299_120403 3300049522 Bacteria 632
248 Ga0501031_0474659 3300049568 Bacteria 807
249 Ga0501031_0488217 3300049568 Bacteria 795
250 Ga0501032_0710283 3300049569 Bacteria 637
251 Ga0501036_0472640 3300049572 Bacteria 1044
252 Ga0501037_0509868 3300049573 Bacteria 815
253 Ga0501038_0435084 3300049574 Bacteria 1011
254 Ga0501038_0477502 3300049574 Bacteria 956
255 Ga0501038_0610929 3300049574 Bacteria 824
256 Ga0501039_0142766 3300049575 Bacteria 1881
257 Ga0501039_0246122 3300049575 Bacteria 1406
258 Ga0501039_0575908 3300049575 Bacteria 883
259 Ga0501039_1186794 3300049575 Bacteria 590
260 Ga0501040_0068849 3300049576 Unclassified 2441
261 Ga0501040_0198018 3300049576 Bacteria 1426
262 Ga0501040_0319508 3300049576 Bacteria 1110
263 Ga0501040_0719353 3300049576 Bacteria 722
264 Ga0501040_0973044 3300049576 Bacteria 615
265 Ga0501041_0030301 3300049577 Bacteria 3266
266 Ga0501041_0238920 3300049577 Bacteria 1141
267 Ga0501041_0242395 3300049577 Bacteria 1133
268 Ga0501042_0069593 3300049578 Bacteria 2517
269 Ga0501042_0074839 3300049578 Bacteria 2423
270 Ga0501042_0206639 3300049578 Bacteria 1416
271 Ga0501043_0819678 3300049579 Bacteria 672
272 Ga0501046_0317076 3300049580 Bacteria 1136
273 Ga0501046_0409114 3300049580 Bacteria 979
274 Ga0501048_0041188 3300049582 Bacteria 3309
275 Ga0501048_0234584 3300049582 Unclassified 1302
276 Ga0501048_0282214 3300049582 Bacteria 1181
277 Ga0501048_0674840 3300049582 Bacteria 742
278 Ga0501048_0991771 3300049582 Bacteria 604
279 Ga0501067_0027593 3300049583 Bacteria 3147
280 Ga0501068_0117052 3300049584 Bacteria 1660
281 Ga0501068_0480912 3300049584 Bacteria 805
282 Ga0501068_0600179 3300049584 Bacteria 717
283 Ga0501069_0639310 3300049585 Bacteria 640
284 Ga0501070_0388019 3300049586 Bacteria 1131
285 Ga0501071_0001326 3300049587 Bacteria 14127
286 Ga0501071_0065106 3300049587 Bacteria 2646
287 Ga0501071_0080624 3300049587 Bacteria 2380
288 Ga0501071_0084241 3300049587 Bacteria 2330
289 Ga0501071_0723441 3300049587 Bacteria 767
290 Ga0501072_0015055 3300049588 Bacteria 5931
291 Ga0501072_0039811 3300049588 Bacteria 3690
292 Ga0501072_0048846 3300049588 Bacteria 3331
293 Ga0501072_0068160 3300049588 Bacteria 2809
294 Ga0501072_0091231 3300049588 Bacteria 2419
295 Ga0501072_0093093 3300049588 Bacteria 2394
296 Ga0501072_0165434 3300049588 Bacteria 1764
297 Ga0501072_0737400 3300049588 Bacteria 773
298 Ga0501074_0237139 3300049590 Bacteria 1298
299 Ga0501074_0400904 3300049590 Bacteria 973
300 Ga0501074_0433762 3300049590 Bacteria 932
301 Ga0501075_0047756 3300049591 Bacteria 3217
302 Ga0501075_0048820 3300049591 Bacteria 3180
303 Ga0501075_0069302 3300049591 Bacteria 2665
304 Ga0501075_0388156 3300049591 Bacteria 1064
305 Ga0501076_0010490 3300049592 Bacteria 6877
306 Ga0501076_0019150 3300049592 Bacteria 5226
307 Ga0501076_0101402 3300049592 Bacteria 2320
308 Ga0501076_0183703 3300049592 Bacteria 1705
309 Ga0501076_0312662 3300049592 Bacteria 1288
310 Ga0501076_0346264 3300049592 Unclassified 1220
311 Ga0501076_0660025 3300049592 Bacteria 863
312 Ga0501077_0000922 3300049593 Bacteria 17681
313 Ga0501077_0071458 3300049593 Unclassified 2200
314 Ga0501077_0082162 3300049593 Bacteria 2042
315 Ga0501077_0127368 3300049593 Bacteria 1614
316 Ga0501077_0316645 3300049593 Bacteria 994
317 Ga0501077_0507871 3300049593 Bacteria 773
318 Ga0501202_055588 3300049652 Bacteria 885
319 Ga0501209_091894 3300049656 Bacteria 883
320 Ga0501209_109804 3300049656 Bacteria 813
321 Ga0501224_040279 3300049664 Bacteria 706
322 Ga0501228_021808 3300049666 Bacteria 730
323 Ga0501235_090992 3300049669 Unclassified 737
324 Ga0501249_060339 3300049679 Bacteria 878
325 Ga0501259_020899 3300049688 Bacteria 1165
326 Ga0501079_0159277 3300049741 Unclassified 1760
327 Ga0501079_0193790 3300049741 Bacteria 1586
328 Ga0501079_0199082 3300049741 Unclassified 1564
329 Ga0501079_0503634 3300049741 Bacteria 952
330 Ga0501079_0718827 3300049741 Bacteria 786
331 Ga0501080_0051157 3300049742 Unclassified 3844
332 Ga0501080_0149682 3300049742 Bacteria 2158
333 Ga0501080_0207243 3300049742 Bacteria 1798
334 Ga0501080_0959539 3300049742 Bacteria 743
335 Ga0501080_1305629 3300049742 Bacteria 621
336 Ga0501081_0026123 3300049743 Bacteria 3934
337 Ga0501081_0036395 3300049743 Bacteria 3357
338 Ga0501081_0309499 3300049743 Bacteria 1160
339 Ga0501081_0363423 3300049743 Bacteria 1068
340 Ga0501081_0493604 3300049743 Bacteria 912
341 Ga0501081_0517508 3300049743 Bacteria 890
342 Ga0501083_0181584 3300049744 Bacteria 1374
343 Ga0501083_0723875 3300049744 Bacteria 647
344 Ga0501264_012192 3300049761 Bacteria 842
345 Ga0501272_018261 3300049769 Bacteria 830
346 Ga0501275_030940 3300049772 Bacteria 708
347 Ga0501279_024203 3300049775 Bacteria 878
348 Ga0501035_0840963 3300049822 Bacteria 731
349 Ga0501035_1173842 3300049822 Bacteria 597
350 Ga0501045_0054071 3300049824 Unclassified 2935
351 Ga0501045_0272911 3300049824 Bacteria 1259
352 Ga0501045_0775771 3300049824 Bacteria 706
353 Ga0501212_056862 3300049851 Bacteria 671
354 nmdc:mga05p37_1095722_c1 3300050507 Bacteria 835
355 nmdc:mga05p37_122086_c1 3300050507 Bacteria 3199
356 nmdc:mga05p37_17215_c1 3300050507 Bacteria 8718
357 nmdc:mga05p37_433874_c1 3300050507 Bacteria 1526
358 nmdc:mga05p37_50787_c1 3300050507 Bacteria 5101
359 nmdc:mga05p37_680935_c1 3300050507 Bacteria 1146
360 nmdc:mga05p37_725594_c1 3300050507 Bacteria 1100
361 nmdc:mga05p37_732317_c1 3300050507 Bacteria 1093
362 nmdc:mga09592_13910_c1 3300050508 Bacteria 6574
363 nmdc:mga09592_73714_c1 3300050508 Bacteria 2901
364 nmdc:mga0qj67_114286_c1 3300050509 Bacteria 2180
365 nmdc:mga0qj67_1932_c1 3300050509 Bacteria 14729
366 nmdc:mga0qj67_63865_c1 3300050509 Bacteria 2928
367 nmdc:mga0qj67_652202_c1 3300050509 Bacteria 840
368 nmdc:mga06r32_115764_c1 3300050510 Bacteria 2641
369 nmdc:mga06r32_150225_c1 3300050510 Bacteria 2308
370 nmdc:mga06r32_153246_c1 3300050510 Bacteria 2284
371 nmdc:mga06r32_52096_c1 3300050510 Bacteria 3919
372 nmdc:mga08y16_240_c1 3300050511 Bacteria 49059
373 nmdc:mga08y16_426286_c1 3300050511 Bacteria 1355
374 nmdc:mga08y16_597848_c1 3300050511 Bacteria 1112
375 nmdc:mga0n895_156565_c1 3300050512 Bacteria 2309
376 nmdc:mga0n895_485_c1 3300050512 Bacteria 26832
377 nmdc:mga0rr50_230021_c1 3300050513 Bacteria 1534
378 nmdc:mga0rr50_6414_c1 3300050513 Bacteria 4128
379 nmdc:mga08x19_153_c1 3300050514 Bacteria 57142
380 nmdc:mga08x19_686650_c1 3300050514 Bacteria 726
381 nmdc:mga0a205_211852_c1 3300050515 Bacteria 1826
382 nmdc:mga0a205_47531_c1 3300050515 Bacteria 4141
383 nmdc:mga0a205_484565_c1 3300050515 Bacteria 1095
384 nmdc:mga0a205_72791_c1 3300050515 Bacteria 3320
385 Ga0495601_0000778 3300053077 Bacteria 17224
386 Ga0495601_0809601 3300053077 Bacteria 594
387 Ga0495595_0151244 3300053084 Bacteria 1142
388 Ga0495619_0010845 3300053085 Bacteria 5736
389 Ga0495619_0017334 3300053085 Bacteria 4561
390 Ga0501084_0134531 3300054114 Bacteria 2081
391 Ga0501084_0357723 3300054114 Unclassified 1233
392 Ga0501084_0464947 3300054114 Bacteria 1069
393 Ga0501084_0757951 3300054114 Bacteria 818
394 Ga0590071_002067 3300059421 Bacteria 5136
395 Ga0590071_009775 3300059421 Bacteria 2250
396 Ga0590074_003317 3300059423 Bacteria 2657
397 Ga0590077_001471 3300059426 Bacteria 5502
398 Ga0501082_0078746 3300060353 Bacteria 2843
399 Ga0501082_0216792 3300060353 Bacteria 1665
400 Ga0530510_0094370 3300061734 Bacteria 2185
401 Ga0530510_0162772 3300061734 Bacteria 1651
402 Ga0530510_0381192 3300061734 Bacteria 1061
403 Ga0530510_1009181 3300061734 Bacteria 637
404 Ga0530510_1014021 3300061734 Bacteria 635
405 2509076966 2508501114 Bacteria 7082538
406 2644088453 2643221614 Bacteria 4260023
407 2644343689 2643221661 Bacteria 4267604
408 2644368833 2643221666 Bacteria 4265935
409 2835314263 2835312727 Bacteria 7413381
410 Ga0075429_100535867
411 MBSR1b_contig_1059277
412 Ga0070676_11106738
413 Ga0070683_100013307
414 Ga0070670_100028993
415 Ga0070670_100736506
416 Ga0070670_100939521
417 Ga0070677_10504616
418 Ga0070666_10106378
419 Ga0070682_100389828
420 Ga0070660_100126071
421 Ga0070660_100752740
422 Ga0070689_100385004
423 Ga0070661_100052667
424 Ga0070669_100299547
425 Ga0070671_100071384
426 Ga0070674_100124924
427 Ga0070673_100149790
428 Ga0070714_100127000
429 Ga0070710_10511036
430 Ga0070711_100000001
431 Ga0070694_100113655
432 Ga0070708_100003752
433 Ga0070708_100010926
434 Ga0070708_100132792
435 Ga0070663_100521728
436 Ga0070678_101447766
437 Ga0070662_100230369
438 Ga0070662_100386101
439 Ga0070681_10162250
440 Ga0070681_10446204
441 Ga0070706_100022878
442 Ga0070706_100246515
443 Ga0070707_100178709
444 Ga0070707_100379266
445 Ga0070698_100314552
446 Ga0070684_100000301
447 Ga0070686_100146280
448 Ga0070695_100636790
449 Ga0070696_100268408
450 Ga0070696_100367165
451 Ga0070704_100471753
452 Ga0068855_101075775
453 Ga0070664_100007989
454 Ga0070664_100028714
455 Ga0068857_100026135
456 Ga0068856_100601985
457 Ga0070702_100182832
458 Ga0068852_100499278
459 Ga0068859_100335187
460 Ga0068859_101455708
461 Ga0068859_101654032
462 Ga0068861_100054517
463 Ga0068858_100121639
464 Ga0068862_100693488
465 Ga0075432_10341002
466 Ga0070716_101272711
467 Ga0097621_100029722
468 Ga0068871_100113885
469 Ga0075428_100936042
470 Ga0075430_100005368
471 Ga0075430_100010316
472 Ga0075430_100091325
473 Ga0075430_100116837
474 Ga0075430_100144112
475 Ga0075430_100297379
476 Ga0075430_100875928
477 Ga0075431_100016422
478 Ga0075431_100073724
479 Ga0075431_100378801
480 Ga0075431_100938031
481 Ga0075431_101032080
482 Ga0075433_10006531
483 Ga0075433_10060948
484 Ga0075434_100219442
485 Ga0075434_100486183
486 Ga0075429_100002178
487 Ga0075429_100005484
488 Ga0075436_100000800
489 Ga0075436_100641445
490 Ga0097620_100335223
491 Ga0097620_101455822
492 Ga0097620_101653691
493 Ga0075435_100021635
494 Ga0111539_10001022
495 Ga0111539_10003751
496 Ga0111539_10080299
497 Ga0111539_10110769
498 Ga0111539_10941159
499 Ga0111539_12181026
500 Ga0114129_10000746
501 Ga0114129_10002550
502 Ga0114129_10030963
503 Ga0114129_10152720
504 Ga0114129_10240003
505 Ga0114129_10973364
506 Ga0114129_11384723
507 Ga0105241_10364221
508 Ga0105242_11040325
509 Ga0105248_10026474
510 Ga0105248_10053486
511 Ga0105237_11203827
512 Ga0105249_10462770
513 Ga0157373_10783595
514 Ga0157371_10477863
515 Ga0157370_10400037
516 Ga0157372_10219345
517 Ga0163163_10000003
518 Ga0163163_10041723
519 Ga0157380_10020759
520 Ga0157380_10030951
521 Ga0157377_10679864
522 Ga0157379_10561859
523 Ga0157379_10953273
524 Ga0157376_11689715
525 Ga0206353_11042439
526 Ga0207680_10056324
527 Ga0207684_10242088
528 Ga0207684_10450819
529 Ga0207707_10479504
530 Ga0207663_10000010
531 Ga0207657_10321574
532 Ga0207657_10412537
533 Ga0207652_10124073
534 Ga0207646_10149391
535 Ga0207646_10440061
536 Ga0207681_10105210
537 Ga0207681_10173118
538 Ga0207650_10004561
539 Ga0207650_10250612
540 Ga0207659_10030337
541 Ga0207664_10613679
542 Ga0207664_11396033
543 Ga0207644_10016947
544 Ga0207690_10738334
545 Ga0207706_10054257
546 Ga0207706_10451132
547 Ga0207706_10914263
548 Ga0207709_11156110
549 Ga0207669_10196483
550 Ga0207669_10379577
551 Ga0207665_11243153
552 Ga0207691_10066202
553 Ga0207711_10060727
554 Ga0207661_10249082
555 Ga0207679_10006777
556 Ga0207679_10135152
557 Ga0207667_11240625
558 Ga0207651_10087911
559 Ga0207712_10111609
560 Ga0207703_10656315
561 Ga0207708_10345967
562 Ga0207702_10433974
563 Ga0207674_10025223
564 Ga0207683_10193143
565 Ga0207428_10007286
566 Ga0207428_10026983
567 Ga0207428_10789709
568 Ga0268265_10724554
569 Ga0268264_10170670
570 Ga0268264_10600177
571 Ga0307408_100009704
572 Ga0307408_100202615
573 Ga0307408_100264842
574 Ga0307408_100557889
575 Ga0307405_10317619
576 Ga0307405_10362440
577 Ga0307410_10507047
578 Ga0307410_10638350
579 Ga0307410_10685793
580 Ga0307406_10128044
581 Ga0307406_10624714
582 Ga0307407_10058072
583 Ga0307407_10609087
584 Ga0307407_10728556
585 Ga0307412_10110731
586 Ga0307409_100174234
587 Ga0307416_100004009
588 Ga0307416_100009084
589 Ga0307416_100026323
590 Ga0307416_100048374
591 Ga0307416_100059208
592 Ga0307416_101796341
593 Ga0307411_10276751
594 Ga0307411_10437545
595 Ga0307411_10838747
596 Ga0307415_100097947
597 Ga0307415_100251897
598 Ga0307415_100686593
599 Ga0307415_100847408
600 Ga0373934_0005222
601 Ga0373940_0033964
602 Ga0373951_0066183
603 Ga0373932_0041581
604 Ga0373954_0124511
605 Ga0373956_0014319
606 Ga0373943_0013822
607 Ga0373955_0003305
608 Ga0373931_0152367
609 Ga0373935_0657049
610 Ga0373935_0887677
611 Ga0373933_0019846
612 Ga0373933_0174629
613 Ga0373947_0175818
614 Ga0373947_0370675
615 Ga0373937_0002164
616 Ga0373937_0002361
617 Ga0373937_0259673
618 Ga0395905_1299081
619 Ga0439435_0001147
620 Ga0439435_0027283
621 Ga0439444_0056794
622 Ga0439464_0000387
623 Ga0439460_0039908
624 Ga0439460_0078575
625 Ga0439440_0129468
626 Ga0466960_0081681
627 Ga0451576_0047413
628 Ga0466967_0200944
629 Ga0495592_0295290
630 Ga0495651_0405695
631 Ga0495608_0018604
632 Ga0495608_0151053
633 Ga0495630_0543010
634 Ga0495640_0108602
635 Ga0495621_0048806
636 Ga0495667_0063413
637 Ga0495635_0380216
638 Ga0495635_0387587
639 Ga0495613_0396283
640 Ga0495604_0041914
641 Ga0495604_0843456
642 Ga0495674_0398421
643 Ga0495675_0039004
644 Ga0496102_0425607
645 Ga0496105_0115497
646 Ga0496110_0024906
647 Ga0496111_0312283
648 Ga0496111_0400451
649 Ga0496112_0029466
650 Ga0496114_0112607
651 Ga0496125_0119839
652 Ga0501291_097942
653 Ga0501295_055149
654 Ga0501298_024956
655 Ga0501298_057247
656 Ga0501299_120403
657 Ga0501031_0474659
658 Ga0501031_0488217
659 Ga0501032_0710283
660 Ga0501036_0472640
661 Ga0501037_0509868
662 Ga0501038_0435084
663 Ga0501038_0477502
664 Ga0501038_0610929
665 Ga0501039_0142766
666 Ga0501039_0246122
667 Ga0501039_0575908
668 Ga0501039_1186794
669 Ga0501040_0068849
670 Ga0501040_0198018
671 Ga0501040_0319508
672 Ga0501040_0719353
673 Ga0501040_0973044
674 Ga0501041_0030301
675 Ga0501041_0238920
676 Ga0501041_0242395
677 Ga0501042_0069593
678 Ga0501042_0074839
679 Ga0501042_0206639
680 Ga0501043_0819678
681 Ga0501046_0317076
682 Ga0501046_0409114
683 Ga0501048_0041188
684 Ga0501048_0234584
685 Ga0501048_0282214
686 Ga0501048_0674840
687 Ga0501048_0991771
688 Ga0501067_0027593
689 Ga0501068_0117052
690 Ga0501068_0480912
691 Ga0501068_0600179
692 Ga0501069_0639310
693 Ga0501070_0388019
694 Ga0501071_0001326
695 Ga0501071_0065106
696 Ga0501071_0080624
697 Ga0501071_0084241
698 Ga0501071_0723441
699 Ga0501072_0015055
700 Ga0501072_0039811
701 Ga0501072_0048846
702 Ga0501072_0068160
703 Ga0501072_0091231
704 Ga0501072_0093093
705 Ga0501072_0165434
706 Ga0501072_0737400
707 Ga0501074_0237139
708 Ga0501074_0400904
709 Ga0501074_0433762
710 Ga0501075_0047756
711 Ga0501075_0048820
712 Ga0501075_0069302
713 Ga0501075_0388156
714 Ga0501076_0010490
715 Ga0501076_0019150
716 Ga0501076_0101402
717 Ga0501076_0183703
718 Ga0501076_0312662
719 Ga0501076_0346264
720 Ga0501076_0660025
721 Ga0501077_0000922
722 Ga0501077_0071458
723 Ga0501077_0082162
724 Ga0501077_0127368
725 Ga0501077_0316645
726 Ga0501077_0507871
727 Ga0501202_055588
728 Ga0501209_091894
729 Ga0501209_109804
730 Ga0501224_040279
731 Ga0501228_021808
732 Ga0501235_090992
733 Ga0501249_060339
734 Ga0501259_020899
735 Ga0501079_0159277
736 Ga0501079_0193790
737 Ga0501079_0199082
738 Ga0501079_0503634
739 Ga0501079_0718827
740 Ga0501080_0051157
741 Ga0501080_0149682
742 Ga0501080_0207243
743 Ga0501080_0959539
744 Ga0501080_1305629
745 Ga0501081_0026123
746 Ga0501081_0036395
747 Ga0501081_0309499
748 Ga0501081_0363423
749 Ga0501081_0493604
750 Ga0501081_0517508
751 Ga0501083_0181584
752 Ga0501083_0723875
753 Ga0501264_012192
754 Ga0501272_018261
755 Ga0501275_030940
756 Ga0501279_024203
757 Ga0501035_0840963
758 Ga0501035_1173842
759 Ga0501045_0054071
760 Ga0501045_0272911
761 Ga0501045_0775771
762 Ga0501212_056862
763 nmdc:mga05p37_1095722_c1
764 nmdc:mga05p37_122086_c1
765 nmdc:mga05p37_17215_c1
766 nmdc:mga05p37_433874_c1
767 nmdc:mga05p37_50787_c1
768 nmdc:mga05p37_680935_c1
769 nmdc:mga05p37_725594_c1
770 nmdc:mga05p37_732317_c1
771 nmdc:mga09592_13910_c1
772 nmdc:mga09592_73714_c1
773 nmdc:mga0qj67_114286_c1
774 nmdc:mga0qj67_1932_c1
775 nmdc:mga0qj67_63865_c1
776 nmdc:mga0qj67_652202_c1
777 nmdc:mga06r32_115764_c1
778 nmdc:mga06r32_150225_c1
779 nmdc:mga06r32_153246_c1
780 nmdc:mga06r32_52096_c1
781 nmdc:mga08y16_240_c1
782 nmdc:mga08y16_426286_c1
783 nmdc:mga08y16_597848_c1
784 nmdc:mga0n895_156565_c1
785 nmdc:mga0n895_485_c1
786 nmdc:mga0rr50_230021_c1
787 nmdc:mga0rr50_6414_c1
788 nmdc:mga08x19_153_c1
789 nmdc:mga08x19_686650_c1
790 nmdc:mga0a205_211852_c1
791 nmdc:mga0a205_47531_c1
792 nmdc:mga0a205_484565_c1
793 nmdc:mga0a205_72791_c1
794 Ga0495601_0000778
795 Ga0495601_0809601
796 Ga0495595_0151244
797 Ga0495619_0010845
798 Ga0495619_0017334
799 Ga0501084_0134531
800 Ga0501084_0357723
801 Ga0501084_0464947
802 Ga0501084_0757951
803 Ga0590071_002067
804 Ga0590071_009775
805 Ga0590074_003317
806 Ga0590077_001471
807 Ga0501082_0078746
808 Ga0501082_0216792
809 Ga0530510_0094370
810 Ga0530510_0162772
811 Ga0530510_0381192
812 Ga0530510_1009181
813 Ga0530510_1014021
814 2509076966
815 2644088453
816 2644343689
817 2644368833
818 2835314263

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

74

152

0.93

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

6

71

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zoh-assembly1.cif.gz_C-2 crystal structure of glyceraldehyde oxidoreductase 0.9762 2 156
1n5w-assembly1.cif.gz_D crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.9746 4 155
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9735 4 155
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.9689 3 155
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.9615 4 155
ID Description Score Start End Superfamily
1sb3C02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.977 82 156 1.10.150.120
3hrdH02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9738 82 154 1.10.150.120
4zohC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9682 82 156 1.10.150.120
1ffuD02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9614 81 156 1.10.150.120
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9612 3 78 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A562V8J0-F1-model_v4 Carbon-monoxide dehydrogenase small subunit 0.9938 3 154 GO:0016491
GO:0046872
GO:0051537
AF-A0A455SC85-F1-model_v4 Oxidoreductase 0.9928 1 155 GO:0016491
GO:0046872
GO:0051537
AF-A0A7W2ASU0-F1-model_v4 (2Fe-2S)-binding protein 0.9918 3 156 GO:0016491
GO:0046872
GO:0051537
AF-A0A1V5IN85-F1-model_v4 Nicotinate dehydrogenase small FeS subunit (EC 1.17.1.5) 0.991 4 153 GO:0046872
GO:0050138
GO:0051537
AF-A0A838H9F2-F1-model_v4 (2Fe-2S)-binding protein 0.9906 2 156 GO:0016491
GO:0046872
GO:0051537

Map